1XGMA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgmA01
5DD4A 4ENNA 1W2MA 2GGCA 1U5TA 3I54A 3K1NA 2GTXA 1FBQA 4BHCA 4ZYEA 1XCVA 3CB6A 2V9VA 5DYMA 4RGRA 3GFMA 1LEBA 1AWCA 1TLHB 4U6CA 2G9WA 3TGNA 2QENA 3RKWA 1FBUA 3TO7A 2K4JA 3LA7A 2A07F 1J0RA 4M71A 4YFKF 2O61A 4FO7A 1HSJA 1YW9A 1OYIA 1DDNA 4CGZA 4O5VA 3HOTA 3PKDA 4ZZDA 2VBXA 1WL9A 5F64A 1XDUA 2HYFA 2Z33A 3PKAA 3VOEA 3ML6A 1U2WA 3LFKA 2QYOA 3JW4A 1T39A 2DQRA 3F3XA 2G7HA 4KIBA 1K78A 4G8XA 4S2TP 2GXGA 3QRFF 2K86A 4IVNA 2H6CA 3GUDA 4LB5A 3FM3A 4RAZA 2HQNA 4TV7A 4P55A 3V8LA 2D1HA 1XGNA 3MFKA 1RIOH 1IXRC 2EFQA 3WTSC 2GQQA 3L7WA 4CHUA 3DFGA 2TDXA 3I64A 1VTNC 1G6NA 4UVCA 3WU0A 1SD6A 3BROA 4PNCA 4YFNF 5J6XA 5LGTA 1CF7A 3CUOA 4KDPA 4HF1A 3E97A 3KP7A 1MZBA 3Q5FA 1Y1NA 5FD5A 5D6FA 3U1DA 2VT2A 3BOQA 4KYWA 2EV6A 1BOAA 2Z3YA 1A16A 2B3KA 4MGRA 2ZCWA 2WC2A 3RPUA 2F5CA 1O7FA 1M35A 1W7PD 2XUBA 1U3EM 4IRIA 4OIOF 5DV5A 3C1DA 3FMRA 1MDMA 1C21A 4G7HF 1XSVA 2PMHA 4MATA 3J81K 3KLOA 1S29A 1B9NA 3SHFA 2Q92A 3H3ZA 5KK1A 1T0FA 2GU5A 3MZYA 4IKSA 1RUNA 2NS0A 4IHTA 2ETHA 1BJAA 1W5TA 2LDUA 2OKNA 1XCBA 4WXDA 5D4SA 4L9JA 1EH8A 1QZYA 5FCHA 3BPXA 5EEHA 1ZRCA 4FX4A 3HSFA 5DDGA 2NNYA 4FLLA 4BXUA 3CTZA 1R5HA 1P6RA 4LLGF 3IC7A 5AIPA 2P6TA 3H92A 2HQRA 1H0MA 1H9GA 5AIQA 4CICA 1O3SA 2BHDA 2VXZA 2DTRA 1NHAA 2FU4A 2FSWA 2GU7A 3DEUA 3WE2A 2BWXA 1SMYF 4FO8A 3P9CA 2IW2A 4A0ZA 2CYYA 1HKSA 2NQ7A 2L02A 1SD4A 3FXQA 4ESBA 2XKOA 2DU9A 1IRGA 4EVIA 4BYYA 1YO5C 2GG0A 2EVMA 2V1XA 5K1YA 1T2KA 1FBSA 3HSRA 2DK5A 2XAFA 2HGCA 1QZZA 2VBYA 1HXDA 1JHHA 4Y17A 2JZYA 4ON0A 2KIMA 2V1UA 1OR7A 4A2UA 1FLIA 1RZ4A 1KU3A 3FF5A 3BJ6A 4IKTA 2DK8A 4HQEA 1REPC 3EYIA 5DEQA 1USSA 3BY6A 3MX6A 2CQKA 2EVOA 3OOPA 2HOEA 3ZPLA 4EJTA 4GXOA 1XN7A 2DO7A 5DUIA 4R8HA 3VEPA 1PP8F 2QBYA 3I71A 3DPLC 3GO5A 4I7HA 2AS5F 1YS7A 2HS5A 2EFPA 2UXXA 4HX8A 2D1VA 3ZMUA 5DCMA 3IU9A 1R1UA 4OOIA 2BWTA 2KKOA 4PDKA 4KICA 4EM0B 5LEJA 1BIAA 5DCFA 4EQQA 3WGIA 4U73A 3CLOA 4O3MA 2VONA 1QXZA 4WXCA 5HDNA 4HLYA 2FEZA 2VBZA 4BHBA 2FBIA 2HZTA 3D5LA 1S3JA 3SFZA 2XVCA 3WE3A 1W7VA 4HBLA 1F1ZA 2PJPA 1IXSB 3KFWX 2WV0A 4IECA 2B3HA 1XMKA 2QM3A 4LK0F 2GXBA 1QBJA 2H27A 5ICGA 2IP2A 3AAFA 4IRHA 2DAOA 2IJLA 4OIPF 5BPIA 3P9IA 4AVPA 3ZMVA 5A2QK 3COAC 2KIFA 1WKMA 3K1MA 3U9GA 4HX4A 3QOPA 4Q48A 4U70A 2W84A 4UV9A 3GEZA 2L4AA 1G3WA 1JXSA 2STWA 1FNNA 4RGZ1 4KN4X 4CYDA 1FYKA 3K69A 4UHTA 5F1RA 1PV9A 4I02A 3Q9SA 4RGXA 3WTUC 2P6SA 1EH6A 2J5OA 2BHCA 5JI6A 1MJAA 5HLIA 1WY2A 4LLLA 2NRAC 1IZ1A 5DD8A 3T1BA 2V79A 1KA8A 3KLNA 4RB3C 1B6AA 1ZLJA 2EFNA 4LFUA 1GXQA 1WSUA 1IUYA 3BWGA 2BB7A 4ETSA 3CO6C 2CO5A 4I0BA 5ERIA 3KCCA 3HHGA 2QLZA 3KE2A 1D8JA 2RN7A 1J7KA 1IN8A 2XRNA 2MATA 2RQPA 3E5UA 3ABUA 1QNTA 2XAHA 5K5QA 4Q4ZF 1PUEE 3CO7C 1ZRDA 3ABTA 3FXRA 1ZREA 3L7GA 5CVRA 4XLNF 3KP5A 3GFIA 1ZH5A 2FF4A 1LB2A 3DKWA 2BWWA 2B0LA 3WG9A 1YJ3A 1T98A 1ONVA 2BGCA 5E8IA 5L3EA 4IRGA 2GU6A 3GX4X 1AOYA 5D5XB 3F8MA 2Z9OA 1YQAA 3M8EA 3FMQA 1UHWA 4I98B 1XMAA 2WTEA 2NNNA 2BWUA 4WK8F 3BJAA 3RDIA 2HTJA 2PQ8A 3U2RA 1SFUA 2L01A 3V8KA 2IRFG 2COMA 4R79A 1SD7A 1R00A 1MATA 3QP5A 5CLSA 2QVOA 2IPQX 3F8BA 4A5MA 2K7LA 4LB6B 3TDUC 1CGPA 2P9AA 2GU4A 1R22A 3M8FA 4RS8A 2MLKA 1V3FA 5BOXA 2P5LC 4P9UA 1IW7F 2HDCA 1YW8A 1ZARA 5HS7A 3ZMZA 3RORA 1FP1D 4L18B 4IDYA 2MD5A 2PBIA 5FO5A 4YG2F 4RB0A 1MKMA 2A68F 2VBWA 4B28A 1KU9A 2M45A 1HW5A 4P96A 4FLJA 3E6CC 2MC3A 3MWMA 3M7GA 1EV7A 1G3SA 4G6QA 2JSCA 4GGGA 5LHIA 1Z6RA 2IT0A 1JHFA 2W57A 1OYWA 3QPTA 3GZ5A 2BV6A 1P4WA 1BI2A 5CVUA 2ISZA 4N0BA 4JUQA 2GZ5A 2FE3A 2ACJA 1YW7A 3I5UA 2XGXA 2GG7A 1BIBA 2MH2A 1WRJA 2Z5UA 4HDVA 3GF2A 3L9FA 4KM3A 1QXWA 5HS9A 3CUQA 3ECOA 1PDNC 3TDZC 2OD5A 2JPCA 1KU2A 1FT9A 1ZG3A 4JBAA 4BNCA 3TKYA 2VOPA 4RAYA 5L3FA 1O3QA 1FYMA 5J8CA 3ULQB 2XKPA 1Z9CA 4M6YA 4BH9A 1F4KA 2IA1A 2MBFA 4MTDA 4FKCA 2EB7A 4RGSA 4XBFA 1C22A 2FA5A 1KQ9A 4BQAA 1FYLA 1TW3A 5DUKA 1ON2A 2G6PA 1ZGJA 2ESNA 3WGHA 3IL2A 1YFHA 4XSZF 3DXJF 4IHSA 2EV5A 3IKVA 1L0OC 3RKXA 3LSTA 1G4DA 1KGSA 2ZMEA 2F5FA 2F5DA 4M9ZA 1XSXA 3RVAA 4EJOA 2VN2A 5D4RA 4MEYF 1I5ZA 3F6VA 2XV4S 3P7NA 1LEAA 3C7JA 4HX7A 4CZZA 3L24A 3CJNA 2V6CA 4ZZLA 4CDGA 4KIFA 6PAXA 2QUFA 5K5OA 4E70A 2XIGA 2GWRA 4KIGA 1I6XA 1OKRA 2DFIA 3MZHA 2DW4A 3W6KB 1HKTA 3E5XA 3GXOA 1BBYA 1IRFA 4HQMA 3WTTC 2PLYA 1YLFA 3I4PA 4A6EA 1HW1A 3KP3A 3PKBA 4A12A 4IU6A 2IVMA 2QQ9A 1FP2A 2CSOA 1P2FA 2L54A 4I09A 2W24A 3LAJA 4MEXF 1QGPA 4EM1A 3BZ6A 1FWZA 3WTXC 4DQ2A 2ELHA 3MCZA 4HV5A 2EA4A 3R4KA 4M73A 1J75A 3IWZA 1OPCA 1L3LA 1P92A 1DPRA 2HYGD 1I1GA 3L09A 5CE6A 5IT3A 3KEQA 2Q96A 2KJCA 5CVIA 3K1PA 2ADUA 2ZNZA 4JK1X 4EV0A 4UNOA 1OMIA 4NQWA 1DUXC 1KU7A 4U6EA 2M87A 2HTSA 1DPUA 1JGSA 1U5TC 2NQ6A 3LA3A 2D2WA 4G6DA 4EJVA 1SFXA 1O3RA 4KNYA 2E7WA 4N9HA 1D5VA 3F8FA 4LG0A 3QAHA 3TOBA 4KN7X 4Y13A 1FOKA 2P7CB 4D0PA 3O3KA 4M9XA 1YIOA 2L4MA 4QLCU 4LG0B 1H9TA 1SD5A 2EVCA 5LRSA 1D3YA 5HOOA 5TJJA 1YVMA 3J80K 5BMZA 1IF1A 1KYZA 4PZJA 4UXNA 1UCRA 3NRVA 3DQVC 2W25A 5D5VB 5E5BA 4LMYA 1U6GA 2OQRA 2BWYA 4ESFA 3SQNA 5TRDA 5CDEA 4AD9A 3C3WA 1BI1A 1U8RA 3PKCA 3REOA 5KVRA 5HDGA 1K79A 4R60A 2FMYA 3F8CA 5A2QZ 5CJ9A 1TNTA 4U76A 2VT3A 3WTYC 4GO1A 3IKTA 4EJWA 1ZN2A 2PI0A 2QQBA 2VC0A 2E1NA 2V3YA 2BYVE 4LD5A 2O03A 5FFZA 5CIKA 3P9KA 1FSHA 5L3CA 3Q9VA 2CFXA 3L2CA 2EA2A 2PEXA 4XRFA 4U71A 1MD0A 4YIFA 4GYIA 1G3TA 3M9AA 4RZZA 3FMSA 2ZO4A 3GLXA 3J81Z 1HW2A 5H6QA 5HVQC 4ZNGA 1ZRFA 3C18A 3CB5A 3ZMSA 3JSPA 4U0VA 2OAZA 3WU1B 2GG3A 2CG4A 3TAVA 2M5WA 2EFOA 4LJZF 3R61A 2W85A 1XGOA 2BE5F 3ZN1A 1GVJA 3K0LA 4LGWA 1KQ0A 4IF4A 3R0AA 1C27A 1C24A 2L3DA 2GG5A 2VE8A 1Z6TA 2M8EA 2GGBA 3JTHA 1ODDA 1GHCA 1BN5A 2XAGA 5CVJA 4EJUA 1TTYA 5E1WA 4HF2A 1R1TA 3E6DA 2P4WA 3KEOA 5CVVA 5ICCA 1W4MA 1PP7U 4L9NA 1B59A 3HHHA 4G7OF 4U1BA 1MDMB 4Q47A 3IU8A 1T6SA 1MJBA 3TO9A 2GA1A 4DNCA 3O2PE 1K6OA 2IW5A 3ZP5A 2RVCA 1ULYA 3VFZA 5D5UB 4JQFA 3RYRA 4FUKA 2WWYA 4MTEA 2BWVA 2XAQA 3R6SA 2JTVA 2RGVA 1E17A 1TNSA 2A69F 3FM5A 3F23A 3VB2A 5JR3A 4PGHA 1RI7A 2UXNA 4IPAA 2VE9A 5E1ZB 3HOSA 2F2EA 3RI4A 3E3VA 2OU2A 3H3UA 4ZWUA 1Z05A 2IA0A 4FLKA 2K02A 5CYVA 4HXXA 5FGMA 1JAWA 3SZPA 4FT8A 4MQ9F 2MA3A 3ZQ7A 3LA2A 1R7JA 3G3ZA 4IKRA 2OBPA 5H6RA 2X0LA 1YS6A 4OOKA 2NYXA 1DP7P 2DLLA 5D8LB 4AWXB 2GG9A 4AIKA 2OZ6A 3JAMZ 4HA8A 3O6BB 1UFMA 1WQ2A 5BPDA 4S00A 1K7AA 1USTA 2ZFWA 3OV8A 2JPBA 4U69A 4IKUA 3LQRA 1O7LA 4I2OA 4RB1A 1IN5A 1ZGAA 4NB5A 4QWQA 4CXFA 1J5YA 1JE8A 3EYYA 5IT9Z 4R1HA 4AIHA 3FX3A 1LVAA 3R60A 2BBYA 1W7PB 4FX0A 1WLRA 3V7SA 1S6LA 4NHJA 3QPHA 4U6WA 3QU3A 3NEUA 2KRFA 4L5JA 1ZLKA 5HDKA 2XROA 3N97A 2O6GE 5FB2A 1TQIA 2DT5A 2EK5A 1J9IA 4HW0A 4IF7A 2DI3A 1SAXA 2KJBA 3EQLF 3BJOA 3BPVA 2Q95A 3DF8A 1OYYA 2Q94A 4A6DA 4U88A 3PQKA 1WL6A 1P4XA 2FBKA 4K2EA 2KIUA 2EV0A 4U6JA 2P99A 3JTGA 4ASNA 4OU0A 2YSRA 2D45A 3B73A 3SZTA 2LF8A 2P5KA 2O8XA 1V4RA 2OZUA 1O3TA 3HUGA 2LSOA 5IT9K 3HRSA 1W5SA 1FC3A 3HRMA 3KP4A 4S04A 5DCMB 3GZ6A 5CDLA 3Q6DA 3D27A 2HKOA 5LEKA 4GCVA 1Z1DA 5ILUA 4KMFA 4HAMA 1FPQA 2QZ8A 5J8FA 5EEGA 2ZSGA 1SMTA 3F72A 2RC4A 3V7RA 2P98A 1IN6A 1K78B 4XLPF 1YG2A 1HBXG 2V3ZA 5CDVA 2MH9A 5LLQA 2V1DA 1LQ1A 3BDDA 4RB2C 2RDPA 3KETA 4P5OA 2DPUA 4WWCA 3K2ZA 1XNZA 2G7UA 3E5QA 2FOKA 1HKQA 3R0JA 4IJAA 4MNUA 3F8NA 4QR8A 3WGGA 1CF7B 1F9NA 3WTVC 4I01A 1UB9A 3MR1A 3T5XA 3V4GA 2FNAA 4OMYA 4KT5C 4I0AA 1XDSA 3V8JA 1UHMA 4UV8A 2A6HF 2ESHA 1N51A 5D6EA 2EFWA 2DBBA 4Y15A 5AONA 5ICFA 1XGSA 5LHHA 4HLXA 1R36A 1Q1HA 4YIIA 3ZMDA 5HS8A 3M1EA 1QPMA 2GA2A 2Y0MA 2PFBA 3HRUA 4GYGA 1R58A 2ZJ2A 3GYHX 5FLXK 3E6MA 2IA2A 1ZAOA 3IHUA 4ENKA 4HYEA 1RNLA 2LNBA 3HTUA 2E1CA 1KP0A 2R7FA 1ON1A 1FX7A 3CTAA 3F6OA 4MQVA 3HIFA 3JSOA 1SFEA 3RKYA 2LF7A 3HTSB 1P4AA 1XGMA 1B4AA 5BQTA 4BHPA 3J7AO 3HYIA 2JT1A 2PN6A 2CW0F 4Z2YA 4G94A 3BP8A 4EGEA 1TW2A 3CUQB 3EETA 2FRHA 2NAZA 3DP7A 2JRTA 2XHKA 2Q2EA 1RUOA 1ZHFA 2YU3A 1G3YA 4HV6A 4A5NA 2XASA 2V3XA 5LGUA 2YX7A 1CHMA 2BEOA 1F5TA 2O0YA 4HOBA 4Q5SF 4H0EA 4OIQF 4XSXF 5ILSA 2GG2A 4KA4A 3VODA 2A61A 3K9TA 4EMSA 2P8TA 3I59B 2ZMEB 4PGGA 1R5GA 1KQ8A 3PFIA 2MLGA 1QO0D 4L9TA 3LAPA 4B09A 4P9FA 1QXYA 3ZN0A 1STZA 4A6WA 2GZWA 1I1SA 3ECHA 3G73A 2ZNYA 1W7PA 2HOWA 3I53A 4U7DA 1MJ9A 2C6YA 3LQQA 1Z91A 3BIQA 2RV8A 3MAJA 2X4HA 2HWVA 2FNPA 1BI3A 1BI0A 1QQIA 2OQGA 2QWWA 3I58A 4L5IA 5JVTA 3T8RA 2Y48A 4ESJA 2EWNA 3IG4A 2O3FA 2HEOA 4BAYA 3EUHA 2BH3A 4KFCA 3TB5A 5K5RA 4L0YB 1A04A 3DPTA 2ZKZA 1LDDA 5ILVA 3KP6A 3ZMTA 3KP2A 4EGYA 2STTA 1ZG5A 4HZFA 5E8GA 3T8TA 2K4BA 5E17F 4LLNA 3MQ0A 3HSEA 2GIVA 2H09A 2GAUA 3MEXA 2UZKA 1IN4A 5LHGA 3FZVA 4CO8A 4UVBA 2DPDA 1TQPA 1Y0UA 2P5VA 5LBQA 2P7VB 3GVAA 3CDHA 2DQLA 4G9YA 1U5TB 1KYWA 4WCGA 4L9VA 3ISPA 1TBXA 3J80Z 2HFHA 2PMUA 3KZYA 2Q93A 4HF0A 5ICEA 2M30A 5HLHA 1YYVA 2YR2A 3TQNA 2A5YB 2PG4A 4N9IA 5LRRA 5E18F 2LKPA 4ZH4F 1BC8C 4RZYA 2EJRA 4M72A 4L0ZB 4KUMA 4M74A 2ZXJA 4Z7MA 2A3SA 2FBHA 2ISYA 1LNWA 1O57A 4MHGA 1XSDA 5FCFA 1YTYA 3TO6A 1S7AA 3BIPA 1GXPA 3L00A 1ZG1A 4AIJA 2J5PA 4ENMA 2FXAA 2YX4A 3RYPA 5ED4A 2UWMA 1LJ9A 5BS6A 4IXAA 3MATA 4M9SA 4OMZA 4O6JA 1WN1A 2VODA 4RGUA 1WBQA 5JFRA 3HRTA 3CUQC 5FLXZ 4YFXF 1E2XA 2VOOA 4ZWOA 5LGNA 3KZZA 3ROUA 3SXYA 2BN7A 2HKXA 1HQCA 3GFLA 2BHAA 1BM9A 2RKHA 1J2XA 2AXLA 3JAMK 2HR3A 4S01A 3FHZA 3FWEA 5HLGA 3F21A 5E20A 1Z7UA 1WI9A 1C0WA 4WF2A 3E6BA 4EM2A 3EDPA 2GG8A 1R1VA 3V7CA 1S7OA 3N4MA 4B8XA 4S05A 1R23A 1TQMA 3NQOA 1XD7A 5D8KB 5H20A 3W6JB 4WX9A 1O0XA 1XB4A 3S6BA 5L3BA 4ZWPA 5F6FA 3GW2A 4F7ZA 4ENJA 1LDKB 4ZYHA 3D0SA 4KMUX 1EH7A 3ELKA 4U0WA 3TOAA 1S8NA 3RTRA 1FY7A 3IRRA 2RNJA 2E7XA 3RIRA 5D5WB 4U75A 2ZBKA 2VC1A 2H94A 3WODF 4A6VA 1X3UA 4A0XA 1BC7C 5E1XA 3T0YA 3QU6A 2F5EA 3GFJA 5FD6A 2OA4A 1FZPB 2A6EF 1U78A 3DV8A 1I27A 3I0TA 5L3DA 5FFXA 1B9MA 2Z99A 4U6ZA 2YPRA 2R7DA 1LDJA 1J59A 4OINF 4PV4A 2BHBA 3LWFA 1FSEA 3WTZA 4UVAA 2QQAA 1ZYRF 4M6XA 4S2RP 3IRQA 4FLIA 4U0YA 4PCQA 2QBYB 2CWEA 2B3LA 2FMLA 3GWZA 1MGTA 3RPQA 4HDUA 1T38A 4LK1F 3B02A 4ZYGA 4G7ZF 3IU7A 2M1BA 3IWFA 1IN7A 2Q8KA 2Q0OA 1HSTA 1D8KA 2FQ3A 4WXHA 1B1BA 2CGPA 2K27A 3I59A 3WTWC 4EGZA 4A0YA 2Y75A 1C23A 3F22A 4UUVA 4U7BA 1IAWA 5JHUA 2R3SA 3ERED 1WWXA 4OIRF 5CNXA 3RJPA 2BWSA 1IXCA 3QP6A 4ZYDA 3S2WA 2XAJA 3PKEA 2H6BA 3FXUA 4FHTA 3PQJA 5L3GA 3BITA
chains in the Genus database with same CATH superfamily
5DD4A 4ENNA 4E4HA 3JRCA 1ERDA 2OTLI 1W36C 1W2MA 2GGCA 1ETQA 1U5TA 2VL8A 3HKZA 3I54A 3SDGA 2E2JJ 3K1NA 2GTXA 3G1OA 3CP8A 1FBQA 2OCCH 3HEFA 5J1YA 1MMNA 1T0FC 3FDYA 3A01A 4BHCA 4CCLA 1XCVA 4ZYEA 2IS4A 2V9VA 3CB6A 5DYMA 4RGRA 2VQCA 3GFMA 2RREA 1LEBA 1AWCA 1TLHB 4U6CA 2G9WA 3TL4X 3B6AA 3TGNA 2QENA 3RKWA 3VWBA 1FBUA 3TO7A 2JSPA 2K4JA 3LA7A 4PSWA 1SAUA 2A07F 3D5SC 3ABLH 1J0RA 4M71A 1D1BA 3HZJA 4YFKF 1SANA 2O61A 4FO7A 1HSJA 1YW9A 1OYIA 1MMGA 3OYCA 1DDNA 4C3HJ 2KDZA 4O5VA 4CGZA 3HOTA 3PKDA 4ZZDA 2JUCA 2VBXA 1SC7A 1JUPA 4CH7A 1XC5A 5JVGF 2ZB9A 1WL9A 5F64A 2O7OA 5EG0B 1XDUA 1Z3XA 2HYFA 4PJJA 1IDYA 2Z33A 3PKAA 3VOEA 2O5RA 3ML6A 1U2WA 1V5GA 1VI0A 2BXZA 3LFKA 1MMAA 2QYOA 4KT6A 3JW4A 1I6HJ 1T39A 2DQRA 3OYJA 1FTZA 2MW8A 1I3AA 3F3XA 4FE7A 3UNGC 2G7HA 4KIBA 4E7IA 4XONA 2LRDA 1K78A 4G8XA 4S2TP 2GXGA 3QRFF 3AL0C 2K86A 2E1MC 3BQYA 4IVNA 2H6CA 3GUDA 4BE2A 4LB5A 3FM3A 4RAZA 2HQNA 4TV7A 1BR4A 4P55A 3V8LA 2D1HA 1XGNA 3MFKA 1RIOH 3HG9A 1IXRC 2EFQA 3WTSC 2CRGA 2GQQA 3L7WA 2O8KA 3K4KA 4CHUA 3DFGA 4AUXA 5J1UA 5DM6F 2DMUA 2TDXA 3I64A 3G71I 1VTNC 1Y0NA 2F5VA 4C3IJ 1G6NA 4UVCA 3WU0A 1SD6A 3RPUD 3BROA 4PNCA 4YFNF 5J6XA 5LGTA 3RZDJ 1CF7A 3CUOA 1Z21A 4KDPA 3IAM2 5FKOA 3E97A 3RKQA 4HF1A 3KP7A 1JKOC 1XMXA 1MZBA 3Q5FA 2DMQA 5FD5A 1Y1NA 1APLC 2X6WA 1JKRC 5D6FA 1TWCJ 5TGTA 4FISA 3U1DA 3GTOJ 2VT2A 3BOQA 4KYWA 4DYQA 2F6CA 3OR2C 4A3JJ 2EV6A 4A3LJ 1BOAA 2Z3YA 1IV8A 1A16A 1LFBA 2I10A 3FISA 2B3KA 1FMWA 5B1AH 5J4YA 4MGRA 4F91B 4B1RA 2UUZA 1Y8QB 3CJRB 2ZCWA 3K6GA 2WC2A 3RPUA 5GTIC 2F5CA 4ZDLA 1O7FA 4ANJA 3DU5A 1M35A 2EIKH 1W7PD 2XUBA 1U3EM 4IRIA 1POGA 4OIOF 5DV5A 1TWFJ 5J3LA 2ECBA 3C1DA 4UB6C 3NAUA 3FMRA 4B47A 2EINH 4RM2A 1MDMA 1C21A 2GXAA 4G7HF 1W5CC 1XSVA 2PMHA 4MATA 1TP4A 3J81K 3KLOA 1S29A 1B9NA 3SHFA 2Q92A 3CCJI 3H3ZA 1LKXA 5KK1A 2HDDA 1NK3P 1T0FA 2QQ8A 2OTJI 2GU5A 2ECCA 3MZYA 4IKSA 1V55H 3L2WA 1RUNA 1A6QA 2NS0A 4IHTA 3KIOA 3H9QA 1T33A 2ETHA 1BJAA 1W5TA 2LDUA 1VQ5I 3S17J 3BTJA 2OKNA 4BQNA 3ZOBA 1XCBA 4JX4A 4WXDA 5D4SA 2BHYA 2E5ZA 4L9JA 1EH8A 2CS3A 1MBEA 3DWLE 3G1MA 1QZYA 2FX0A 2XPVA 5FCHA 3BPXA 3VYTB 5EEHA 3S2HJ 1ZRCA 4FX4A 4HNVA 3HSFA 4HRIA 5DDGA 4BQOA 4IHVA 2NNYA 4FLLA 3PJRA 4ZC3A 1Q1VA 4BXUA 3CTZA 3DCFA 1R5HA 4Y52J 1P6RA 4LLGF 3IC7A 5AIPA 2P6TA 5GPCA 4IL6C 3H92A 4XQFA 2HQRA 1H0MA 1LE8B 1H9GA 3OIQA 3DEEA 1QPIA 5AIQA 4CICA 1O3SA 2BHDA 2VXZA 2DTRA 1NHAA 2FU4A 2KQRA 2FSWA 2GU7A 2X6XA 3DEUA 2DCEA 4LIUA 2VKHA 3LOCA 3WE2A 2XGEA 2A6TA 1N75A 4DIQA 2BWXA 1SMYF 4FO8A 2MG4A 4BEHB 2L7FP 1A36A 3P9CA 1VF9A 2EZKA 2IW2A 2ZXHA 4A0ZA 2V26A 2CYYA 3K4MA 1HKSA 1BR2A 1XX5A 1YE9A 3BG6A 3FXOA 2HDWA 2NQ7A 1WJBA 1B8IA 2L02A 1SD4A 1GV2A 1EF4A 2OUMA 3FXQA 4ESBA 1EJ9A 2V6EA 2XKOA 1UJ8A 2DU9A 1IRGA 1OCRH 4EVIA 3CESA 4BYYA 1YO5C 1A35A 2GG0A 3CZ6A 2EVMA 3L2VA 2NS8A 3QOEA 1CQTA 2CU7A 2V1XA 2M8GX 5K1YA 2R7QA 2XRLA 3GTQJ 2R7WA 1T2KA 1FBSA 2XAUA 4MLOA 3HSRA 2DK5A 1X1AA 2HGCA 3H35A 2XAFA 1QZZA 1Y39A 2VBYA 1HXDA 1JHHA 1A5JA 2OCEA 4Y17A 3B6CA 4L5EA 2Z2SB 2JZYA 4ON0A 2KIMA 5K7FA 2EBIA 2V1UA 1OR7A 1VQ6I 4FE4A 2JA2A 4A2UA 1FLIA 2R5YA 1RZ4A 1KU3A 3FK6A 3SJMA 2XGDA 3FF5A 3BJ6A 4IKTA 2DK8A 4HQEA 1REPC 3G4SI 3EYIA 5DEQA 2LFBA 1USSA 3BY6A 3MX6A 5M5WJ 2CQKA 2EVOA 3OOPA 2HOEA 4D5FA 3ZPLA 4EJTA 1PUFA 2QCOA 4GXOA 4PFPA 2WB1N 1XN7A 2DO7A 3NWSA 5DUIA 1NK2P 4XL9A 2RQQA 4R8HA 3VEPA 1PP8F 2QBYA 3I71A 3DPLC 3DKYA 1A6IA 3GO5A 2H8WA 1BW5A 1TWAJ 4I7HA 2DDBA 1XPXA 2NOGA 2AS5F 1YS7A 2HS5A 2EFPA 3AG2H 2K3FA 2UXXA 3QYEA 4HX8A 2D1VA 3ZMUA 5DCMA 3IU9A 1R1UA 3HC7A 4E7KA 4OOIA 1G59A 4OAZA 2BWTA 2XSJC 2KKOA 4PDKA 4KICA 4EM0B 1B72A 1OCCH 2V4JC 1KZHA 5LEJA 1BIAA 5DCFA 4EQQA 3WGIA 4U73A 1MNEA 3LSJA 1Z0XA 2V9PA 3CLOA 4D7NA 1KQ8A 1BOBA 4O3MA 2VONA 3CF2A 5FJ8J 1QXZA 4CA0A 4WXCA 1A31A 1MW7A 2HVRA 2M0CA 5HDNA 1TWHJ 4HLYA 2FEZA 2LH9A 3HGYA 3CC2I 2VBZA 3D1NI 4BHBA 2XF5A 4II3A 2E71A 2FBIA 2HZTA 3D5LA 1S3JA 2CV2A 3H3VK 3SFZA 2XVCA 3WE3A 1W7VA 3C2HA 4HBLA 2JQ7A 1F1ZA 4U87A 2V9KA 5HNHA 3DPUA 1HLVA 2PJPA 1IXSB 3KFWX 2WV0A 4IECA 2B3HA 2JWTA 1XMKA 3VYSB 2M0MA 2QM3A 4LK0F 2GXBA 4OWRB 2Y30A 1WJAA 3JRBA 2FD5A 2E1OA 3QYBA 1QBJA 2H27A 1EKEA 4HSRA 5ICGA 1LFUP 2IP2A 3A0BC 3AAFA 4IRHA 2DAOA 1QHGA 4B43A 1YX3A 2IJLA 4OIPF 2UV1A 5BPIA 4BACA 3MKYB 3P9IA 4AVPA 3ZMVA 2M4GA 5A2QK 3COAC 4Y7NJ 2KIFA 1UMQA 1WKMA 3K1MA 3U9GA 3RQ4A 4HX4A 1X4PA 3QOPA 2WAEA 4Q48A 4U70A 1WGXA 2W84A 3P5JA 3BC8A 4UV9A 3GEZA 2L4AA 3G6EI 1G3WA 2E34A 1B72B 1JXSA 2WAFA 2STWA 2DXIA 1FNNA 3A4CA 3J7AY 3D5RC 4XLFA 4RGZ1 3CQZJ 3IH3A 4KN4X 2A5WA 4CYDA 1FYKA 1FIPA 1AA7A 4J00A 1X58A 3K69A 1Y56A 2EZLA 4UHTA 5F1RA 4ZTJA 1VQ9I 1PV9A 3HL2A 4BXFA 1NG7A 4X6AJ 4I02A 3Q9SA 5M3FJ 5B66C 4NBQA 4RGXA 3WTUC 2XSDC 2VJJA 2P6SA 3ZQLA 2IS2A 3K10A 5B5EC 1EH6A 3LFUA 3OYGA 1X2MA 4W97A 2J5OA 5J4VA 1K61A 2V1NA 2BHCA 5C44J 5JI6A 1MJAA 2CQNA 5HLIA 1WY2A 4LLLA 1QRYA 1WFXA 2VJIA 2NRAC 1TC3C 1IZ1A 2CQ7A 2CFOA 5DD8A 3T1BA 2V79A 1KA8A 4UUSB 3KLNA 5E3OA 1VQNI 4RB3C 1B6AA 1ZLJA 2EFNA 4LFUA 1GXQA 1WSUA 2HOAA 2OF7A 1IUYA 3BWGA 4PJNA 2BB7A 4ETSA 4ABZA 4NC8A 3CO6C 2CO5A 1P9QC 4I0BA 5ERIA 1ZELA 3KCCA 3HHGA 2QLZA 2HVSA 2DA6A 3KE2A 3BZCA 2PJRB 4PJLA 3PSFA 1D8JA 2L2OA 2RN7A 3SDBA 1J7KA 1E0EA 1IN8A 3HKZN 2XRNA 2KT0A 5J1RA 4M6VA 4UUTA 2MATA 4MFEA 2ID3A 2RQPA 3W2VA 3E5UA 3BT9A 3ABUA 1QNTA 2XAHA 5K5QA 4Q4ZF 1PUEE 3CO7C 1O4XA 1ZRDA 3ABTA 1KONA 3BLYA 1TWGJ 3FXRA 2DA2A 1ZREA 3L7GA 5CVRA 4DZJA 4XLNF 2OPTA 3KP5A 3GFIA 1ZH5A 2FF4A 1LB2A 2X6OA 4W1UA 3DKWA 4Y33A 2BWWA 3ZQQA 3AG3H 3HBLA 2DYSH 2B0LA 3WG9A 3ZQIA 2ZJRF 5EZHA 2VLAA 3DKXA 1YJ3A 3H0GJ 1T98A 1ONVA 2BGCA 5E8IA 2AHQA 5L3EA 4BE1A 4IRGA 2PMZN 2GU6A 3GX4X 3CCYA 1AOYA 5D5XB 3F8MA 2Z9OA 2HOSA 2BY3A 1YQAA 3M8EA 3JRGA 3FMQA 1UHWA 1VQ8I 2LP0A 4I98B 2M7AA 1XMAA 2WTEA 2NNNA 2LY9A 3LMMA 2BWUA 4WK8F 3S2DJ 3BJAA 4E6KG 3RDIA 2VQLA 2HTJA 4BBRJ 1X1CA 3GMEA 4OAYA 1MIJA 2H1KA 3ERMA 2PQ8A 3U2RA 1JKQC 4RLQA 1SFUA 2L01A 4QTRA 3V8KA 3HJEA 5FRNA 1ETVA 4RMNA 2IRFG 2COMA 2XB5A 4R79A 3S1NJ 1SD7A 1R00A 2QSGX 1MATA 3QP5A 5CLSA 2QVOA 5LFAA 2IPQX 3F8BA 5F0FA 4A5MA 2GIZA 2K7LA 4LB6B 1WCMJ 3TDUC 1CGPA 2P9AA 3H9GA 1SVMA 1NG6A 4IOCF 2GU4A 1R22A 3M8FA 4RS8A 3ASNH 2MLKA 3BTIA 1V3FA 3FIWA 4M3GA 2F48A 3GLLA 4B4CA 5BOXA 2P5LC 2Y0SN 4P9UA 1IW7F 3PNVA 4XR6A 2HDCA 4YEJA 1ETKA 1TT0A 1YW8A 5E3LA 3S14J 1ZARA 4Z6YA 5HS7A 1F43A 2W1OA 3PUFA 3ZMZA 2HNHA 3RORA 1FP1D 4L18B 4IDYA 2MD5A 3OWTA 2PBIA 3BTCA 5FO5A 4YG2F 4RB0A 3OR1C 1MKMA 2A68F 4A3DJ 2G0EA 2VBWA 4B28A 1KU9A 2M45A 4Y4RA 1HW5A 1HDPA 4P96A 4HNUA 4FLJA 1R6RA 3E6CC 2MC3A 2WY8Q 3C2GA 3M7GA 3MWMA 1EV7A 1G2HA 1OLTA 1G3SA 1MBFA 2R7TA 4G6QA 2KZGA 3LSPA 2JSCA 5CQEA 1GV5A 4GGGA 5LHIA 1N25A 1Z6RA 3S8PA 2IT0A 1N77A 1J09A 1JHFA 2W4SA 4PFOA 1NH3A 2JUGA 2W57A 3VPRA 3OS0A 1OYWA 3QPTA 3IP4B 4LG3A 1ZTRA 3GZ5A 2BV6A 3EPZA 1P4WA 1BI2A 3H9JA 4PSXA 5CVUA 2OJED 2ISZA 4N0BA 1UELB 4JUQA 1OCZH 2CQXA 2LG4A 2JMWA 4CYCA 1VQMI 4JP0A 1OQYA 4PK4A 5IOZA 4IQJA 2GZ5A 2FE3A 2ACJA 4NC6A 1YW7A 4E7SA 3I5UA 2XGXA 1T56A 2GG7A 1BIBA 4HNTA 2MH2A 1WRJA 2Z5UA 4HDVA 2R7ZJ 3GF2A 4QIWN 3L9FA 5E79C 3ZQHA 4KM3A 2LY2A 1QXWA 5HS9A 3CUQA 1LUJB 2K9QA 3ECOA 1JGGA 3TDZC 2OD5A 2M4KA 1PDNC 2JPCA 1KU2A 2F4OB 4CUGA 2MD0A 1FT9A 3PIPF 1T95A 1ZG3A 4JBAA 4BNCA 3TKYA 2VOPA 4RAYA 5L3FA 1OCOH 1O3QA 1FYMA 5EDNA 5J8CA 1OCTC 1Z77A 2L5QA 3ULQB 3LL7A 4E7HA 1YRNB 4XORA 5IP9J 2DA3A 2XKPA 1QHHD 2KISA 4M6YA 1Z9CA 4BH9A 1F4KA 2IA1A 1F36A 1MBKA 2JRMA 2MBFA 4MTDA 2K3PA 4DYRA 1AKHA 4FKCA 2EB7A 4RGSA 5GPAA 4XBFA 2JVHA 4KJZA 2IGOA 1C22A 2FA5A 1YI2I 1KQ9A 4BQAA 1FYLA 5IY5H 3CCUI 3S93A 1JUSA 1JTYA 3A0HC 3JRAA 3HOVJ 2PMZA 3L1PA 1TW3A 5DUKA 1VQOI 2E2IJ 4C2UA 1ON2A 2G6PA 1ZGJA 1FTTA 5EZGA 2ESNA 3WGHA 1HF0A 3IL2A 2LYCA 1YFHA 3BR0A 1GVDA 2JA6J 3S15J 4XSZF 3DXJF 4IHSA 4C3JJ 2EV5A 3IKVA 4CYCB 4G6TB 1L0OC 3RKXA 1VZ0A 3LSTA 1G4DA 1KGSA 2ZMEA 1YITI 2F5FA 2K40A 3OYAA 4IEJA 4CSWA 2F4IA 3TP3A 4RLFA 5EEAA 4IHXA 3K2AA 1R9TJ 2F5DA 2KP6A 2R7XA 4M9ZA 1DU0A 4XLAA 3M07A 1XSXA 3RVAA 4EJOA 2VN2A 5D4RA 2A05A 5F04A 4MEYF 1I5ZA 5EGOB 3BR6A 1BJZA 3F6VA 2XV4S 3AKZA 5F0HA 3DLLF 3P7NA 1LEAA 1NTCA 3C7JA 4HX7A 4CZZA 3L24A 3MN2A 3CJNA 2V6CA 5F08A 2DA5A 4ZZLA 3IV5A 4NUBA 4CDGA 5KAFC 3BCBA 1SFOJ 4KIFA 5GTHC 6PAXA 5FKKA 1WHUA 2QUFA 2DT7B 2TRTA 4XLEA 3GTJJ 4HG2A 4XM3A 4E70A 5K5OA 2X51A 2XIGA 2GWRA 2YU9J 4KIGA 1I6XA 1OKRA 2NS7A 2DFIA 3MZHA 2BVLA 2R92J 2DW4A 3I9V2 3FK7A 1T8IA 2HXIA 3W6KB 1HKTA 3E5XA 3GXOA 1BBYA 1IRFA 4HQMA 3WTTC 2PLYA 4MIMA 5CPRB 1YLFA 3I4PA 3A03A 3JCUC 4A6EA 3PFYA 1HW1A 3KP3A 4N4NB 1WVRA 3PKBA 4A12A 2IGKA 2M9HA 5IOYA 3OMYA 3W6VA 4IU6A 2VPLA 2IVMA 2QQ9A 3BG7A 1FP2A 3GTKJ 2CSOA 1P2FA 2L54A 4I09A 2W24A 4XK4A 3LAJA 4MEXF 3TP0A 1QGPA 4EM1A 3JR9A 4NNJA 1S7EA 5C4XJ 4Y3OA 3BZ6A 3K70C 1HDDC 2EIMH 1FWZA 3G1LA 1RESA 2QSFX 3WTXC 3TBIA 3TW7A 1IJWC 1MH3A 3ZXSA 4DQ2A 4DYCA 3GTPJ 1QZEA 3N05A 1IDZA 3H5RA 1E3OC 2WADA 4BE0A 2ELHA 3MCZA 4HV5A 4XKVA 2EA4A 2YS9A 5IPAA 3R4KA 4M73A 4XLCA 5IP6A 1J75A 3IUOA 3MKWB 3QYFA 1Y1WJ 2QEXI 1GLNA 4F3QA 3IWZA 1OPCA 1Z7LA 4RDUA 4FQGA 1L3LA 1P92A 3PO2J 1LVKA 1DPRA 2CUFA 2HYGD 4I99C 1I1GA 1FOWA 3L09A 2PJRA 3K4CA 2R7UA 5CE6A 5IT3A 5F1JA 2R4GA 3KEQA 2Q96A 2KJCA 3UR3C 2L0KA 5M5XJ 5CVIA 1YJNI 3K1PA 2ADUA 2ZNZA 2W00A 4JK1X 4MO7A 4EV0A 2JVGA 4UNOA 3HOUJ 1OMIA 2DMTA 3K4LA 4NQWA 4AM3A 1DUXC 1KU7A 3FXJA 3Q3SA 4U6EA 2M87A 3KYCB 3HDDA 1MMSA 2HTSA 1DPUA 3VSLA 1JGSA 1U5TC 2NQ6A 1YIJI 2R5YB 3LA3A 2D2WA 4G6DA 1SVOA 4EJVA 1VQ4I 1YOVB 1SFXA 1O3RA 4KNYA 3BR5A 2E7WA 4N9HA 4BL0B 3JRIA 1D5VA 3E7LA 3F8FA 3OL4A 4LG0A 1V5FA 2LD5A 3RZOJ 3QAHA 3TOBA 2BVMA 4KN7X 4DBQA 4Y13A 2R0QC 4M3BA 1R5ID 1FOKA 1XTAA 3M1CA 2P7CB 4D0PA 3O3KA 1X2NA 4M9XA 5C3EJ 2VUMJ 1YIOA 2L4MA 1UZCA 1OCPA 2M3AA 4QLCU 4LG0B 3QPSA 1H9TA 1SD5A 5E3MA 1JI8A 2EVCA 2KPMA 5LRSA 1D3YA 4CCOA 2VKVA 3M3YJ 5HOOA 5TJJA 1BA5A 3O8HA 1IV6A 3J80K 1YVMA 3RSNA 5BMZA 2LOOA 1IF1A 4IX7A 1KYZA 4PZJA 3S3OA 4UXNA 1UCRA 4DGWB 3NRVA 5KCMA 2VQHA 1X1PA 2LBFA 3DQVC 2W25A 5D5VB 1DP3A 5E5BA 3OYNA 4LMYA 4BGDA 1U6GA 2EZIA 2OQRA 3PUBA 4C2TA 3W2AA 2BWYA 4ESFA 3SQNA 5TRDA 4BXXJ 2DT6A 2P0WA 5CDEA 4AD9A 4YELA 2K5CA 3C3WA 1BI1A 4F52A 2X85A 1U8RA 3PKCA 3REOA 5KVRA 5HDGA 1K79A 4R60A 2FMYA 5H2FC 3F8CA 5A2QZ 5IYDJ 5CJ9A 4A3EJ 1TNTA 3OYLA 4U76A 2VT3A 3WTYC 4GO1A 3IKTA 4EJWA 4XRSG 5CQGA 1ZN2A 2PI0A 2QQBA 2AO9A 2VC0A 2E1NA 2V3YA 3AL0B 2BYVE 4XNFA 2CV0A 3FXMA 4D1QA 2BY1A 1WZ2A 2ZJPF 4LD5A 2O03A 4XOPA 2HVQA 5FFZA 2IS1A 5CIKA 3P9KA 4LITA 1FSHA 5L3CA 3Q9VA 5GADJ 2CFXA 2CJJA 3RCOA 2ZXIA 3OYFA 3L2CA 2EA2A 2PEXA 4XRFA 4U71A 1MD0A 4JYKA 3K7AJ 4YIFA 2XF7A 1WJ5A 4GYIA 1G3TA 3S32A 3M9AA 3Q0UA 5EGOA 4RZZA 2DOFA 1VQPI 1QU3A 5K7ZA 2LY1A 3FMSA 5EJCA 2DMPA 3SEQA 2ZO4A 3GLXA 1AU7A 3J81Z 1HW2A 5H6QA 2MSYA 4JX5A 5HVQC 4ZNGA 1ZRFA 3C18A 3OSFA 1X1BA 3W3CA 3CC4I 2X1EA 3LSIA 4RA2A 3CB5A 3ZMSA 3JSPA 4U0VA 2OAZA 3MKLA 3CF5F 3V42A 4BY7J 3VYUB 3WU1B 2CV1A 5GAHJ 3NWTA 4XICA 5E3NA 2HXOA 2H1LA 1RPWA 3BCAA 3BQZA 4XRMA 2F4MB 1ETOA 2GG3A 1WH7A 2CG4A 3TAVA 2M5WA 3PL8A 2EFOA 4LJZF 3R61A 3E0JB 1JKPC 2W85A 1XGOA 2BE5F 3ZN1A 4M3FA 1RRJA 1GVJA 3K0LA 4LGWA 1KQ0A 4IF4A 3R0AA 1C27A 1C24A 2L3DA 2CUEA 2VJ5A 2GG5A 1YRNA 3QODA 2VE8A 2X6YA 2DODA 4FASD 2L7KA 1Z6TA 1Y8RB 2M8EA 2KLOA 1FEXA 2GGBA 5F27A 3GBGA 3JTHA 1RR8C 1ODDA 4IHYA 2K9LA 1GHCA 1BN5A 2XAGA 5CVJA 4DZPA 1FJLA 4EJUA 3QPLA 1TTYA 1X3ZB 1ITYA 3DTEA 5E1WA 4HF2A 3OS1A 3FXKA 1R1TA 3E6DA 5DTDA 3OY9A 2LKSA 2P4WA 2LREA 3KEOA 1ACIA 2LMDA 3A02A 2E1MB 3PSIA 5CVVA 5ICCA 1IO2A 1W4MA 3L2QA 1PP7U 1B8IB 3OYBA 2P81A 4QPQA 3ASOH 4L9NA 3KYDB 1B59A 3HHHA 4G7OF 4U1BA 3CMYA 1GDTA 1D1CA 5FLMJ 1MDMB 1IG7A 2R5ZA 3DTIA 1MSEC 4NDLA 2WAQA 3EUKL 4Q47A 3IU8A 1G8XA 1T6SA 3GTLJ 3LSGA 1MJBA 4J01A 1K4TA 3TO9A 2GA1A 4DNCA 4GRIA 3O2PE 1K6OA 1MBJA 4BKXA 2IW5A 3Q0WA 3ZP5A 2RVCA 1ULYA 2E19A 5LD2C 3VFZA 1W0UA 2D5VA 5D5UB 4A3FJ 4JQFA 1S9HA 2LC2A 2ELJA 3RYRA 4FUKA 2WWYA 4MTEA 3CCMI 2BWVA 2XAQA 3R6SA 2JTVA 1ORKA 3DEWA 2RGVA 2R7RA 1ENHA 1E17A 5IYCJ 2TCTA 1TNSA 2A69F 3FM5A 3F23A 3VB2A 2DN0A 3WG7H 2E36A 4IKFA 5JR3A 4PGHA 1RI7A 2UXNA 1OFCX 4IPAA 2VE9A 5E1ZB 3HOSA 2F2EA 3RI4A 3E3VA 2OU2A 1HA8A 4X0GA 3H3UA 3L2RA 4ZWUA 1Z05A 2VASA 2IA0A 4FLKA 2K02A 5CYVA 4HXXA 2B7EA 3KZIC 5FGMA 4CCKA 1JAWA 3SZPA 4FT8A 1OR7C 4MQ9F 4AYBN 2MA3A 1E3PA 2ZC2A 4P1WA 2JA8J 3ZQ7A 4DW6A 3LA2A 1R7JA 3G3ZA 3AFHA 3OYHA 1RC9A 4D5CA 4IKRA 3K4JA 2OBPA 5H6RA 2VXDA 2OV7A 2X0LA 1YS6A 4OOKA 2MYSA 2NYXA 1DP7P 2DLLA 5D8LB 3BZKA 1EA3A 4AWXB 4AIKA 2GG9A 2OZ6A 3JAMZ 2NVYJ 1JTXA 3IH2A 4HA8A 4NQWB 4S0HB 3O6BB 1WI3A 1UFMA 1WQ2A 5BPDA 4S00A 1QVUA 3AG4H 4BJTA 5EG0A 1K7AA 2ME0A 1TZLA 1USTA 2ZFWA 3OV8A 2JPBA 4U69A 5KHDA 3HOZJ 4IKUA 3LQRA 1O7LA 4I2OA 2CUZA 4G12A 4RB1A 2X9DA 1IN5A 1ZGAA 4NB5A 2NVTJ 4QWQA 4B44A 4CXFA 1J5YA 2M7BA 1JE8A 3M4OJ 2L9NA 3EYYA 3DTKA 5IT9Z 4R1HA 4AIHA 3FX3A 1LVAA 3R60A 1PYVA 2BBYA 4ZDPA 1T08B 1W7PB 4FX0A 1WLRA 2LR8A 3V7SA 3J7YJ 1S6LA 2VB6A 3QPHA 5M3MJ 4NHJA 4U6WA 3QU3A 3NEUA 2KRFA 4L5JA 4CCJA 1ZLKA 5HDKA 3M8JA 1RKWA 2XROA 3N97A 2O6GE 2OC6A 4V2GA 5FB2A 1TQIA 2DT5A 2EK5A 4M3EA 2DFEA 1J9IA 4HW0A 4IF7A 3MZ8A 2DI3A 3HOXJ 2KJBA 3WHBA 1SAXA 1V5EA 3EQLF 4FCYA 4B48A 1VNDA 3SEZA 3BJOA 3BPVA 3I4NJ 2Q95A 3BG5A 3DF8A 1DQUA 2X48A 1OYYA 3ZQGA 1P7JA 2NXNB 2Q94A 1RETA 4A6DA 4U88A 3PQKA 1WL6A 1P4XA 2FBKA 4K2EA 2KIUA 4IHWA 2XF6A 1D0YA 3X2QH 3H0DA 2EV0A 2DA7A 1JT6A 3KPHA 4U6JA 2P99A 3JTGA 3LSKA 3CCSI 4ASNA 5FRMA 5BNGA 5K7HA 2BY0A 2AQFA 3HGGA 3JRHA 2W7NA 4OU0A 2YSRA 4B3AA 2D45A 4XIDA 3B73A 3SZTA 2LF8A 2P5KA 2I5UA 2O8XA 2VI6A 1V4RA 4RAGA 2HYJA 1WH5A 2OZUA 2LVSA 3HUGA 4A3IJ 1O3TA 3S1QJ 5F0CA 2LSOA 1QVTA 3HRSA 1W5SA 4BU2A 5IT9K 1FC3A 2KRHA 3HRMA 3KP4A 2DJNA 3VDXA 4S04A 5DCMB 3I56I 2H8RA 4BBSJ 1X19A 3GZ6A 5CDLA 1I50J 5FKMA 3Q6DA 3D27A 2HKOA 5LEKA 4GCVA 1Z1DA 5ILUA 4KMFA 4GFBA 2ZJQF 1QA6A 4PJ0C 3OL3A 4HAMA 4LOCA 1FPQA 4UB8C 2QZ8A 1W0TA 5J8FA 2ZFUA 5EEGA 2ZSGA 1W36D 1SMTA 3F72A 2RC4A 3V7RA 2P98A 4AVZA 4D7MA 1IN6A 1ZQ3P 2ZSIB 2LK2A 3LSMA 1D5YA 2KRCA 3DU6A 1K78B 2HZDA 4XLPF 1YG2A 3S1RJ 1IGNA 4YRVA 1HBXG 2HPIA 2V3ZA 5CDVA 2MH9A 1X3WB 3OSGA 5LLQA 2V1DA 1K6YA 3BDDA 1LQ1A 2Z1DA 4RB2C 3PO3J 3HXLA 4ZYAA 2RDPA 4DOZA 3KETA 3ZRGA 4ZJZA 2IEKA 4P5OA 2DPUA 1YJWI 4EEFG 1VQLI 2NOJB 3FKIJ 4WWCA 3K2ZA 1XNZA 2G7UA 1WJCA 2KMUA 3E5QA 2FOKA 1DGRM 1HKQA 3R0JA 4IJAA 4MNUA 3F8NA 3JRFA 1TL8A 4QR8A 2Y69H 3WGGA 3BG3A 1CF7B 2WV1A 2R7VA 2DFFA 3FBNB 2RNGA 3FBIB 4AC0A 3O8GA 1F9NA 2ZSHB 1R4MB 3WTVC 5M5YJ 4I01A 1UB9A 3MR1A 3T5XA 3V4GA 2FNAA 4E7LA 2BY2A 5GP9A 4OMYA 4KT5C 4I0AA 1XDSA 3V8JA 4ZDOA 2M34A 2E35A 1R71A 1UHMA 2QF7A 1ZKGA 5FROA 4UV8A 2A6HF 2ESHA 3K4NA 1RKTA 1N51A 5D6EA 2EFWA 2DBBA 4Y15A 2GBYA 1WJEA 5AONA 5ICFA 1XGSA 5LHHA 4HLXA 1R36A 1Q1HA 4YIIA 3ZMDA 3U21A 5HS8A 3M1EA 2K9NA 4XLHA 1QPMA 1UG0A 2GA2A 5HLTA 2Y0MA 2PFBA 3HRUA 2BHZA 3S16J 1JJ6C 4GYGA 1R58A 3IH4A 1ZGWA 3EUHC 4F92B 3DBRB 4ITVA 1U8BA 4D9JA 2ZJ2A 1X1DA 4LIVA 3GYHX 5FLXK 3E6MA 2IA2A 1ZAOA 3IHUA 2WBMA 2FJ1A 4FETA 4ENKA 4HYEA 1Z67A 1RNLA 2LNBA 4UUSA 2GOXB 3HTUA 4NC7A 2E1CA 2DA4A 2R7FA 1ON1A 3WU2C 1KP0A 1FX7A 3CTAA 4I6ZA 3F6OA 3L2UA 3G2BA 4MQVA 3HIFA 3JSOA 1SFEA 4MFDA 3RKYA 3ESWB 2LF7A 3S3NA 1GT0C 3LNQA 3HTSB 1P4AA 1DU6A 1XGMA 3GTMJ 2IXSA 1B4AA 5J40A 2FOWA 5BQTA 4BHPA 2MC4A 3J7AO 1PVEA 3HYIA 2KIQA 3NARA 3SYTA 2L9RA 2JT1A 2PN6A 2IGMA 4V19K 2CW0F 4Z2YA 4G94A 3BP8A 1D0ZA 1PUFB 4YIRX 1TW2A 3CUQB 3EETA 4EGEA 2FRHA 1U0JA 3MVPA 2NAZA 5B3SH 3DLAA 3DP7A 2JA7J 1U9NA 2JRTA 2NVUB 2R7SA 2XDVA 2XHKA 2Q2EA 1RUOA 4E7JA 3CLQA 1ETYA 2QA4I 1ZHFA 2YU3A 1G3YA 4HV6A 4A5NA 2XASA 2V3XA 3HPHA 2HU9A 5LGUA 2YX7A 3J7ZI 1CHMA 3I55I 2BEOA 1UG2A 1F5TA 2O0YA 3OYEA 3A2KA 2EZHA 3OS2A 2COBA 2LTPA 3BR2A 1HC8A 4HOBA 4Q5SF 4H0EA 4OIQF 5FLVA 4XSXF 2B63J 3CCRI 4C9YA 5IYBJ 2JN6A 5ILSA 2GG2A 2E2HJ 4KA4A 1PJRA 1FIAA 3VODA 3MKZA 2A61A 2MABA 3K9TA 4EATA 2EILH 1XG1A 4EMSA 1K4SA 2P8TA 2AXTC 3I59B 4XN0A 1HCRA 2ZMEB 4PGGA 1R5GA 3QQAA 2I8DA 1TT5B 3PFIA 4QSHA 2V7FA 2MLGA 3CMAI 3HB9A 4JX6A 1GUUA 1LFPA 1QO0D 4L9TA 4E7ZA 3I4MJ 3LAPA 9ANTA 5GAGJ 2Y9ZA 4HSTA 4B09A 4A3KJ 4P9FA 1H89C 3BR1A 1QXYA 4GDFA 3ZN0A 2BOLA 2L9VA 1STZA 4BY1J 2GZWA 4A6WA 2KHMA 1WPKA 1I1SA 3ECHA 2WAQN 3S3MA 3HM5A 1X4OA 3G73A 3SZGA 2ZNYA 4RBOA 4II2A 3PIOF 1W7PA 2LKXA 1IUFA 2HOWA 1YX5A 2Q1ZB 3I53A 1MJ9A 3K4BA 4U7DA 2CW7A 2C6YA 2HI3A 3LQQA 1Z91A 1MBHA 2RV8A 3BIQA 3MAJA 2Y2ZA 4C30A 3CCEI 2X4HA 2HWVA 2FNPA 1BI3A 1BI0A 1QQIA 2OQGA 2QWWA 3I58A 2K9SA 2GLOA 4L5IA 2KDOA 2WA0A 2NVXJ 4BJ5C 5JVTA 2IBDA 2DMNA 2VQGA 2CMPA 2DA1A 3T8RA 5HNFA 2Y48A 1VQKI 1Y1VJ 2EWNA 4ESJA 3IG4A 2O3FA 1MBGA 2WY7Q 2Y9YA 3EUHA 4BAYA 5JHFA 2HEOA 1S5LC 4A3BJ 2BH3A 4KISA 4KFCA 4B3XA 3TB5A 1Z3YA 5JLWA 5K5RA 4L0YB 1A04A 3DPTA 2ZKZA 1LDDA 5ILVA 4A3MJ 2R93J 3KP6A 1WJDA 4DBRA 4XKWA 3ZMTA 3PNTA 4RAFA 2BW3A 2K9MA 3HPGA 3KP2A 1IRZA 4EGYA 1LE8A 1ZG5A 2STTA 4HZFA 5E8GA 3CMMA 3DBHB 4A93J 3T8TA 2K4BA 3ZGKA 5E17F 2XPUA 5FKLA 4LLNA 3MQ0A 5EYRA 3HSEA 2XPWA 1SFKA 1IC8A 2GIVA 4M3DA 2H09A 2GAUA 3MEXA 2UZKA 1IN4A 5LHGA 3FZVA 4XMYA 4CO8A 4UVBA 2QKLB 2FQ4A 2DPDA 1TQPA 3AG1H 1Y0UA 2P5VA 4QPOA 2AQEA 2P7VB 3DBLB 3GVAA 5LBQA 3TMOA 5DM7F 2GM4A 4JOMA 3CDHA 2DQLA 4G9YA 1JJ8C 1U5TB 1KYWA 4WCGA 4CCNA 4L9VA 3ISPA 1MSFC 2DOAA 1TBXA 1MMDA 3J80Z 2ZMEC 5DS9A 2B9SA 2HFHA 2PMUA 3KZYA 3TEDA 2Q93A 4HF0A 1BR1A 5ICEA 2Y31A 1MNMC 2M30A 5HLHA 2L7MP 4IZZA 3CCVI 1YYVA 2DYRH 2YR2A 3TQNA 3LSRA 2A5YB 5FKNA 2KL4A 2PG4A 4N9IA 3OYKA 2XC7A 3HOYJ 3H36A 4XRSA 5LRRA 5E18F 2LKPA 4ZH4F 1BC8C 4ZTFA 3WHCA 4F55A 4RZYA 2EJRA 1VQ7I 5TISC 4M72A 2VPRA 4CCMA 4L0ZB 2N8GA 3ZR8X 4KUMA 4M74A 5IP7J 2ZXJA 4Z7MA 2A3SA 2FBHA 2KZVA 3FXLA 2ISYA 4A3CJ 1AKHB 1LNWA 1UHSA 1O57A 4MHGA 2W48A 1XSDA 3F9KA 2Q2EB 4PUSA 5FCFA 1YTYA 2DJIA 3TO6A 1W1WE 2IS6A 4XKCA 3CJQB 1SEUA 1XS9A 1S7AA 3OYIA 3BIPA 1GXPA 3L00A 3ABMH 1ZG1A 4AIJA 2J5PA 4ENMA 2FUG2 4BS9A 2FXAA 2YX4A 3RYPA 5ED4A 4A3GJ 1LJ9A 2UWMA 1M1EB 5JLXA 3SFIA 5BS6A 2ICWG 3F0CA 1E3HA 4IXAA 3TW6A 2HPMA 2CH0A 1N78A 4DJAA 3HOWJ 1D0XA 3MATA 4H4KC 4M9SA 3OOUA 4OMZA 2IAIA 1ZR2A 4O6JA 1WN1A 3K70D 2VODA 4RGUA 1WBQA 5JFRA 2E60A 2VKEA 1ETWA 1WJFA 3HRTA 4IQ4A 3H5NA 4BUPA 4X1EA 3CUQC 3H5AA 3ZCOA 2CW8A 4C2MJ 5FLXZ 2Y0SA 4YFXF 1E2XA 2BZTA 4AYBA 3CJTB 2VOOA 1RR7A 3EUAA 2K85A 1FOYA 3ZQCA 3ONQA 2X1DA 1OJLA 4ZWOA 5LGNA 3KZZA 3ROUA 3SXYA 3CCLI 1ZR4A 2BN7A 3MD2A 2HKXA 1HQCA 3GFLA 4AIDA 2R5ZB 1UAAA 2BHAA 1BM9A 2RKHA 1J2XA 3CD6I 1IRXA 2E5NA 2JK3A 4F93B 2ID6A 3CDIA 2DTZA 1BL0A 5CKTA 2AXLA 4BJ6C 2KFDA 3KEYA 1JUMA 3JAMK 2HR3A 3CP2A 1JT0A 4S01A 3FHZA 3FWEA 5J47A 5HLGA 3F21A 1ETXA 5E20A 3ZQFA 1Z7UA 3A1YA 1WI9A 2IGNA 1C0WA 4WF2A 3OYMA 3OYDA 2EPFA 3E6BA 1BW6A 4EM2A 2W82A 3EDPA 2GG8A 1R1VA 2YUSA 2QGUA 3V7CA 3KX2A 1S7OA 1LPQA 3N4MA 2L9SA 4B8XA 4S05A 4BDYA 3U1KA 1R23A 1TQMA 3NQOA 1XD7A 5D8KB 1V54H 5HODA 3OIPA 5H20A 3W6JB 4WX9A 3MMYB 4XN3A 1O0XA 1XB4A 3S6BA 5L3BA 1MH4A 4ZWPA 5F6FA 1SVLA 3GW2A 2BXYA 4F7ZA 4ENJA 5KNLA 2QSHX 3PM1A 1LDKB 2BW3B 3FKJA 2QKMB 4ZYHA 3D0SA 4KMUX 1ZK8A 1EH7A 3ELKA 1FMVA 4U0WA 1VFCA 3TOAA 1S8NA 3E1SA 3RTRA 1FY7A 4CZCA 3IRRA 2GOMA 2RNJA 1R4NB 2E7XA 4HEA2 3RIRA 5D5WB 3IAS2 4U75A 2LBFB 2ZBKA 3KYLA 3LSHA 2VC1A 2H94A 3WODF 4A6VA 2HQAA 3PNYA 4BDZA 4HPQA 4RM3A 1X3UA 4A0XA 4AU7A 1BC7C 5E1XA 3T0YA 3CCQI 2M2EA 1S72I 3OIOA 1H88C 3QU6A 2XGCA 2F5EA 3GFJA 3H1CA 5FD6A 3ABKH 1Y6IA 3BG9A 2OA4A 4IO9F 2X1CA 1FZPB 3GCMA 2A6EF 1U78A 2EH3A 1I3QJ 5C4JJ 3DV8A 4UY8I 1MNDA 2MGQA 2NVQJ 1I27A 3I0TA 4IOAF 5L3DA 2EQRA 5FFXA 1B9MA 3W2WA 2Z99A 4N4OB 3UKGA 4U6ZA 3GTGJ 2HQ5A 5GAEJ 2YPRA 2R7DA 3I3LA 2L7ZA 1LDJA 3FHNA 1J59A 2ELKA 4OINF 3S1MJ 2MFZA 2Z16A 4PV4A 2VKDA 1YHQI 2BHBA 3LWFA 1FSEA 3WTZA 3A01B 4UVAA 1FOXA 2QQAA 1ZYRF 4M6XA 4KITB 4S2RP 3IRQA 3JRDA 4FLIA 4U0YA 4PCQA 2QBYB 3Q0VA 5B1BH 2CWEA 2PX9A 2B3LA 2FMLA 3GWZA 1MGTA 3RPQA 3VYRB 4HDUA 1T38A 4A69C 4LK1F 3CMEI 1D1AA 3B02A 4ZYGA 4G7ZF 3IU7A 1R49A 2M1BA 3IWFA 3C2BA 1IN7A 1DGWY 2RAEA 2Q0OA 2Q8KA 3GZNB 2VJ4A 2HOTA 1HSTA 1D8KA 2FQ3A 2ZXWH 4I76A 1B1BA 4WXHA 5EF6A 1YJ9I 3BTLA 2CGPA 2K27A 2CUJA 3VSKA 2WB1A 3I59A 3WTWC 4EGZA 2CQQA 4A0YA 4J19A 2DDAA 2Y75A 2JJ7A 2VIXA 3HUGB 1K83J 3F22A 1C23A 2LLKA 2R7OA 4BQQA 4UUVA 4V2FA 3CDLA 2EIJH 3BR3A 4U7BA 1AHDP 1IAWA 5JHUA 4FTHA 1OISA 2R3SA 4BEHA 1I39A 3JREA 3ERED 4XOTA 5KAIC 3QWLA 4PJMA 3RQIA 1WWXA 4OIRF 5CNXA 2XB0X 1P7IA 2DOEA 3RJPA 2DFHA 2BWSA 1IXCA 3QP6A 4ZYDA 1HOMA 3S2WA 2JA5J 3CC7I 2XAJA 1U9OA 2O9LA 3PKEA 2ME6A 2H6BA 4XKBA 3FXUA 4FHTA 3PQJA 1H8AC 5L3GA 3BITA
chains in the Genus database with same CATH topology
5DD4A 4ENNA 1W2MA 2GGCA 1U5TA 3I54A 3K1NA 2GTXA 1FBQA 4BHCA 4ZYEA 1XCVA 3CB6A 2V9VA 5DYMA 4RGRA 3GFMA 1LEBA 1AWCA 1TLHB 4U6CA 2G9WA 3TGNA 2QENA 3RKWA 1FBUA 3TO7A 2K4JA 3LA7A 2A07F 1J0RA 4M71A 4YFKF 2O61A 4FO7A 1HSJA 1YW9A 1OYIA 1DDNA 4CGZA 4O5VA 3HOTA 3PKDA 4ZZDA 2VBXA 1WL9A 5F64A 1XDUA 2HYFA 2Z33A 3PKAA 3VOEA 3ML6A 1U2WA 3LFKA 2QYOA 3JW4A 1T39A 2DQRA 3F3XA 2G7HA 4KIBA 1K78A 4G8XA 4S2TP 2GXGA 3QRFF 2K86A 4IVNA 2H6CA 3GUDA 4LB5A 3FM3A 4RAZA 2HQNA 4TV7A 4P55A 3V8LA 2D1HA 1XGNA 3MFKA 1RIOH 1IXRC 2EFQA 3WTSC 2GQQA 3L7WA 4CHUA 3DFGA 2TDXA 3I64A 1VTNC 1G6NA 4UVCA 3WU0A 1SD6A 3BROA 4PNCA 4YFNF 5J6XA 5LGTA 1CF7A 3CUOA 4KDPA 4HF1A 3E97A 3KP7A 1MZBA 3Q5FA 1Y1NA 5FD5A 5D6FA 3U1DA 2VT2A 3BOQA 4KYWA 2EV6A 1BOAA 2Z3YA 1A16A 2B3KA 4MGRA 2ZCWA 2WC2A 3RPUA 2F5CA 1O7FA 1M35A 1W7PD 2XUBA 1U3EM 4IRIA 4OIOF 5DV5A 3C1DA 3FMRA 1MDMA 1C21A 4G7HF 1XSVA 2PMHA 4MATA 3J81K 3KLOA 1S29A 1B9NA 3SHFA 2Q92A 3H3ZA 5KK1A 1T0FA 2GU5A 3MZYA 4IKSA 1RUNA 2NS0A 4IHTA 2ETHA 1BJAA 1W5TA 2LDUA 2OKNA 1XCBA 4WXDA 5D4SA 4L9JA 1EH8A 1QZYA 5FCHA 3BPXA 5EEHA 1ZRCA 4FX4A 3HSFA 5DDGA 2NNYA 4FLLA 4BXUA 3CTZA 1R5HA 1P6RA 4LLGF 3IC7A 5AIPA 2P6TA 3H92A 2HQRA 1H0MA 1H9GA 5AIQA 4CICA 1O3SA 2BHDA 2VXZA 2DTRA 1NHAA 2FU4A 2FSWA 2GU7A 3DEUA 3WE2A 2BWXA 1SMYF 4FO8A 3P9CA 2IW2A 4A0ZA 2CYYA 1HKSA 2NQ7A 2L02A 1SD4A 3FXQA 4ESBA 2XKOA 2DU9A 1IRGA 4EVIA 4BYYA 1YO5C 2GG0A 2EVMA 2V1XA 5K1YA 1T2KA 1FBSA 3HSRA 2DK5A 2XAFA 2HGCA 1QZZA 2VBYA 1HXDA 1JHHA 4Y17A 2JZYA 4ON0A 2KIMA 2V1UA 1OR7A 4A2UA 1FLIA 1RZ4A 1KU3A 3FF5A 3BJ6A 4IKTA 2DK8A 4HQEA 1REPC 3EYIA 5DEQA 1USSA 3BY6A 3MX6A 2CQKA 2EVOA 3OOPA 2HOEA 3ZPLA 4EJTA 4GXOA 1XN7A 2DO7A 5DUIA 4R8HA 3VEPA 1PP8F 2QBYA 3I71A 3DPLC 3GO5A 4I7HA 2AS5F 1YS7A 2HS5A 2EFPA 2UXXA 4HX8A 2D1VA 3ZMUA 5DCMA 3IU9A 1R1UA 4OOIA 2BWTA 2KKOA 4PDKA 4KICA 4EM0B 5LEJA 1BIAA 5DCFA 4EQQA 3WGIA 4U73A 3CLOA 4O3MA 2VONA 1QXZA 4WXCA 5HDNA 4HLYA 2FEZA 2VBZA 4BHBA 2FBIA 2HZTA 3D5LA 1S3JA 3SFZA 2XVCA 3WE3A 1W7VA 4HBLA 1F1ZA 2PJPA 1IXSB 3KFWX 2WV0A 4IECA 2B3HA 1XMKA 2QM3A 4LK0F 2GXBA 1QBJA 2H27A 5ICGA 2IP2A 3AAFA 4IRHA 2DAOA 2IJLA 4OIPF 5BPIA 3P9IA 4AVPA 3ZMVA 5A2QK 3COAC 2KIFA 1WKMA 3K1MA 3U9GA 4HX4A 3QOPA 4Q48A 4U70A 2W84A 4UV9A 3GEZA 2L4AA 1G3WA 1JXSA 2STWA 1FNNA 4RGZ1 4KN4X 4CYDA 1FYKA 3K69A 4UHTA 5F1RA 1PV9A 4I02A 3Q9SA 4RGXA 3WTUC 2P6SA 1EH6A 2J5OA 2BHCA 5JI6A 1MJAA 5HLIA 1WY2A 4LLLA 2NRAC 1IZ1A 5DD8A 3T1BA 2V79A 1KA8A 3KLNA 4RB3C 1B6AA 1ZLJA 2EFNA 4LFUA 1GXQA 1WSUA 1IUYA 3BWGA 2BB7A 4ETSA 3CO6C 2CO5A 4I0BA 5ERIA 3KCCA 3HHGA 2QLZA 3KE2A 1D8JA 2RN7A 1J7KA 1IN8A 2XRNA 2MATA 2RQPA 3E5UA 3ABUA 1QNTA 2XAHA 5K5QA 4Q4ZF 1PUEE 3CO7C 1ZRDA 3ABTA 3FXRA 1ZREA 3L7GA 5CVRA 4XLNF 3KP5A 3GFIA 1ZH5A 2FF4A 1LB2A 3DKWA 2BWWA 2B0LA 3WG9A 1YJ3A 1T98A 1ONVA 2BGCA 5E8IA 5L3EA 4IRGA 2GU6A 3GX4X 1AOYA 5D5XB 3F8MA 2Z9OA 1YQAA 3M8EA 3FMQA 1UHWA 4I98B 1XMAA 2WTEA 2NNNA 2BWUA 4WK8F 3BJAA 3RDIA 2HTJA 2PQ8A 3U2RA 1SFUA 2L01A 3V8KA 2IRFG 2COMA 4R79A 1SD7A 1R00A 1MATA 3QP5A 5CLSA 2QVOA 2IPQX 3F8BA 4A5MA 2K7LA 4LB6B 3TDUC 1CGPA 2P9AA 2GU4A 1R22A 3M8FA 4RS8A 2MLKA 1V3FA 5BOXA 2P5LC 4P9UA 1IW7F 2HDCA 1YW8A 1ZARA 5HS7A 3ZMZA 3RORA 1FP1D 4L18B 4IDYA 2MD5A 2PBIA 5FO5A 4YG2F 4RB0A 1MKMA 2A68F 2VBWA 4B28A 1KU9A 2M45A 1HW5A 4P96A 4FLJA 3E6CC 2MC3A 3MWMA 3M7GA 1EV7A 1G3SA 4G6QA 2JSCA 4GGGA 5LHIA 1Z6RA 2IT0A 1JHFA 2W57A 1OYWA 3QPTA 3GZ5A 2BV6A 1P4WA 1BI2A 5CVUA 2ISZA 4N0BA 4JUQA 2GZ5A 2FE3A 2ACJA 1YW7A 3I5UA 2XGXA 2GG7A 1BIBA 2MH2A 1WRJA 2Z5UA 4HDVA 3GF2A 3L9FA 4KM3A 1QXWA 5HS9A 3CUQA 3ECOA 1PDNC 3TDZC 2OD5A 2JPCA 1KU2A 1FT9A 1ZG3A 4JBAA 4BNCA 3TKYA 2VOPA 4RAYA 5L3FA 1O3QA 1FYMA 5J8CA 3ULQB 2XKPA 1Z9CA 4M6YA 4BH9A 1F4KA 2IA1A 2MBFA 4MTDA 4FKCA 2EB7A 4RGSA 4XBFA 1C22A 2FA5A 1KQ9A 4BQAA 1FYLA 1TW3A 5DUKA 1ON2A 2G6PA 1ZGJA 2ESNA 3WGHA 3IL2A 1YFHA 4XSZF 3DXJF 4IHSA 2EV5A 3IKVA 1L0OC 3RKXA 3LSTA 1G4DA 1KGSA 2ZMEA 2F5FA 2F5DA 4M9ZA 1XSXA 3RVAA 4EJOA 2VN2A 5D4RA 4MEYF 1I5ZA 3F6VA 2XV4S 3P7NA 1LEAA 3C7JA 4HX7A 4CZZA 3L24A 3CJNA 2V6CA 4ZZLA 4CDGA 4KIFA 6PAXA 2QUFA 5K5OA 4E70A 2XIGA 2GWRA 4KIGA 1I6XA 1OKRA 2DFIA 3MZHA 2DW4A 3W6KB 1HKTA 3E5XA 3GXOA 1BBYA 1IRFA 4HQMA 3WTTC 2PLYA 1YLFA 3I4PA 4A6EA 1HW1A 3KP3A 3PKBA 4A12A 4IU6A 2IVMA 2QQ9A 1FP2A 2CSOA 1P2FA 2L54A 4I09A 2W24A 3LAJA 4MEXF 1QGPA 4EM1A 3BZ6A 1FWZA 3WTXC 4DQ2A 2ELHA 3MCZA 4HV5A 2EA4A 3R4KA 4M73A 1J75A 3IWZA 1OPCA 1L3LA 1P92A 1DPRA 2HYGD 1I1GA 3L09A 5CE6A 5IT3A 3KEQA 2Q96A 2KJCA 5CVIA 3K1PA 2ADUA 2ZNZA 4JK1X 4EV0A 4UNOA 1OMIA 4NQWA 1DUXC 1KU7A 4U6EA 2M87A 2HTSA 1DPUA 1JGSA 1U5TC 2NQ6A 3LA3A 2D2WA 4G6DA 4EJVA 1SFXA 1O3RA 4KNYA 2E7WA 4N9HA 1D5VA 3F8FA 4LG0A 3QAHA 3TOBA 4KN7X 4Y13A 1FOKA 2P7CB 4D0PA 3O3KA 4M9XA 1YIOA 2L4MA 4QLCU 4LG0B 1H9TA 1SD5A 2EVCA 5LRSA 1D3YA 5HOOA 5TJJA 1YVMA 3J80K 5BMZA 1IF1A 1KYZA 4PZJA 4UXNA 1UCRA 3NRVA 3DQVC 2W25A 5D5VB 5E5BA 4LMYA 1U6GA 2OQRA 2BWYA 4ESFA 3SQNA 5TRDA 5CDEA 4AD9A 3C3WA 1BI1A 1U8RA 3PKCA 3REOA 5KVRA 5HDGA 1K79A 4R60A 2FMYA 3F8CA 5A2QZ 5CJ9A 1TNTA 4U76A 2VT3A 3WTYC 4GO1A 3IKTA 4EJWA 1ZN2A 2PI0A 2QQBA 2VC0A 2E1NA 2V3YA 2BYVE 4LD5A 2O03A 5FFZA 5CIKA 3P9KA 1FSHA 5L3CA 3Q9VA 2CFXA 3L2CA 2EA2A 2PEXA 4XRFA 4U71A 1MD0A 4YIFA 4GYIA 1G3TA 3M9AA 4RZZA 3FMSA 2ZO4A 3GLXA 3J81Z 1HW2A 5H6QA 5HVQC 4ZNGA 1ZRFA 3C18A 3CB5A 3ZMSA 3JSPA 4U0VA 2OAZA 3WU1B 2GG3A 2CG4A 3TAVA 2M5WA 2EFOA 4LJZF 3R61A 2W85A 1XGOA 2BE5F 3ZN1A 1GVJA 3K0LA 4LGWA 1KQ0A 4IF4A 3R0AA 1C27A 1C24A 2L3DA 2GG5A 2VE8A 1Z6TA 2M8EA 2GGBA 3JTHA 1ODDA 1GHCA 1BN5A 2XAGA 5CVJA 4EJUA 1TTYA 5E1WA 4HF2A 1R1TA 3E6DA 2P4WA 3KEOA 5CVVA 5ICCA 1W4MA 1PP7U 4L9NA 1B59A 3HHHA 4G7OF 4U1BA 1MDMB 4Q47A 3IU8A 1T6SA 1MJBA 3TO9A 2GA1A 4DNCA 3O2PE 1K6OA 2IW5A 3ZP5A 2RVCA 1ULYA 3VFZA 5D5UB 4JQFA 3RYRA 4FUKA 2WWYA 4MTEA 2BWVA 2XAQA 3R6SA 2JTVA 2RGVA 1E17A 1TNSA 2A69F 3FM5A 3F23A 3VB2A 5JR3A 4PGHA 1RI7A 2UXNA 4IPAA 2VE9A 5E1ZB 3HOSA 2F2EA 3RI4A 3E3VA 2OU2A 3H3UA 4ZWUA 1Z05A 2IA0A 4FLKA 2K02A 5CYVA 4HXXA 5FGMA 1JAWA 3SZPA 4FT8A 4MQ9F 2MA3A 3ZQ7A 3LA2A 1R7JA 3G3ZA 4IKRA 2OBPA 5H6RA 2X0LA 1YS6A 4OOKA 2NYXA 1DP7P 2DLLA 5D8LB 4AWXB 2GG9A 4AIKA 2OZ6A 3JAMZ 4HA8A 3O6BB 1UFMA 1WQ2A 5BPDA 4S00A 1K7AA 1USTA 2ZFWA 3OV8A 2JPBA 4U69A 4IKUA 3LQRA 1O7LA 4I2OA 4RB1A 1IN5A 1ZGAA 4NB5A 4QWQA 4CXFA 1J5YA 1JE8A 3EYYA 5IT9Z 4R1HA 4AIHA 3FX3A 1LVAA 3R60A 2BBYA 1W7PB 4FX0A 1WLRA 3V7SA 1S6LA 4NHJA 3QPHA 4U6WA 3QU3A 3NEUA 2KRFA 4L5JA 1ZLKA 5HDKA 2XROA 3N97A 2O6GE 5FB2A 1TQIA 2DT5A 2EK5A 1J9IA 4HW0A 4IF7A 2DI3A 1SAXA 2KJBA 3EQLF 3BJOA 3BPVA 2Q95A 3DF8A 1OYYA 2Q94A 4A6DA 4U88A 3PQKA 1WL6A 1P4XA 2FBKA 4K2EA 2KIUA 2EV0A 4U6JA 2P99A 3JTGA 4ASNA 4OU0A 2YSRA 2D45A 3B73A 3SZTA 2LF8A 2P5KA 2O8XA 1V4RA 2OZUA 1O3TA 3HUGA 2LSOA 5IT9K 3HRSA 1W5SA 1FC3A 3HRMA 3KP4A 4S04A 5DCMB 3GZ6A 5CDLA 3Q6DA 3D27A 2HKOA 5LEKA 4GCVA 1Z1DA 5ILUA 4KMFA 4HAMA 1FPQA 2QZ8A 5J8FA 5EEGA 2ZSGA 1SMTA 3F72A 2RC4A 3V7RA 2P98A 1IN6A 1K78B 4XLPF 1YG2A 1HBXG 2V3ZA 5CDVA 2MH9A 5LLQA 2V1DA 1LQ1A 3BDDA 4RB2C 2RDPA 3KETA 4P5OA 2DPUA 4WWCA 3K2ZA 1XNZA 2G7UA 3E5QA 2FOKA 1HKQA 3R0JA 4IJAA 4MNUA 3F8NA 4QR8A 3WGGA 1CF7B 1F9NA 3WTVC 4I01A 1UB9A 3MR1A 3T5XA 3V4GA 2FNAA 4OMYA 4KT5C 4I0AA 1XDSA 3V8JA 1UHMA 4UV8A 2A6HF 2ESHA 1N51A 5D6EA 2EFWA 2DBBA 4Y15A 5AONA 5ICFA 1XGSA 5LHHA 4HLXA 1R36A 1Q1HA 4YIIA 3ZMDA 5HS8A 3M1EA 1QPMA 2GA2A 2Y0MA 2PFBA 3HRUA 4GYGA 1R58A 2ZJ2A 3GYHX 5FLXK 3E6MA 2IA2A 1ZAOA 3IHUA 4ENKA 4HYEA 1RNLA 2LNBA 3HTUA 2E1CA 1KP0A 2R7FA 1ON1A 1FX7A 3CTAA 3F6OA 4MQVA 3HIFA 3JSOA 1SFEA 3RKYA 2LF7A 3HTSB 1P4AA 1XGMA 1B4AA 5BQTA 4BHPA 3J7AO 3HYIA 2JT1A 2PN6A 2CW0F 4Z2YA 4G94A 3BP8A 4EGEA 1TW2A 3CUQB 3EETA 2FRHA 2NAZA 3DP7A 2JRTA 2XHKA 2Q2EA 1RUOA 1ZHFA 2YU3A 1G3YA 4HV6A 4A5NA 2XASA 2V3XA 5LGUA 2YX7A 1CHMA 2BEOA 1F5TA 2O0YA 4HOBA 4Q5SF 4H0EA 4OIQF 4XSXF 5ILSA 2GG2A 4KA4A 3VODA 2A61A 3K9TA 4EMSA 2P8TA 3I59B 2ZMEB 4PGGA 1R5GA 1KQ8A 3PFIA 2MLGA 1QO0D 4L9TA 3LAPA 4B09A 4P9FA 1QXYA 3ZN0A 1STZA 4A6WA 2GZWA 1I1SA 3ECHA 3G73A 2ZNYA 1W7PA 2HOWA 3I53A 4U7DA 1MJ9A 2C6YA 3LQQA 1Z91A 3BIQA 2RV8A 3MAJA 2X4HA 2HWVA 2FNPA 1BI3A 1BI0A 1QQIA 2OQGA 2QWWA 3I58A 4L5IA 5JVTA 3T8RA 2Y48A 4ESJA 2EWNA 3IG4A 2O3FA 2HEOA 4BAYA 3EUHA 2BH3A 4KFCA 3TB5A 5K5RA 4L0YB 1A04A 3DPTA 2ZKZA 1LDDA 5ILVA 3KP6A 3ZMTA 3KP2A 4EGYA 2STTA 1ZG5A 4HZFA 5E8GA 3T8TA 2K4BA 5E17F 4LLNA 3MQ0A 3HSEA 2GIVA 2H09A 2GAUA 3MEXA 2UZKA 1IN4A 5LHGA 3FZVA 4CO8A 4UVBA 2DPDA 1TQPA 1Y0UA 2P5VA 5LBQA 2P7VB 3GVAA 3CDHA 2DQLA 4G9YA 1U5TB 1KYWA 4WCGA 4L9VA 3ISPA 1TBXA 3J80Z 2HFHA 2PMUA 3KZYA 2Q93A 4HF0A 5ICEA 2M30A 5HLHA 1YYVA 2YR2A 3TQNA 2A5YB 2PG4A 4N9IA 5LRRA 5E18F 2LKPA 4ZH4F 1BC8C 4RZYA 2EJRA 4M72A 4L0ZB 4KUMA 4M74A 2ZXJA 4Z7MA 2A3SA 2FBHA 2ISYA 1LNWA 1O57A 4MHGA 1XSDA 5FCFA 1YTYA 3TO6A 1S7AA 3BIPA 1GXPA 3L00A 1ZG1A 4AIJA 2J5PA 4ENMA 2FXAA 2YX4A 3RYPA 5ED4A 2UWMA 1LJ9A 5BS6A 4IXAA 3MATA 4M9SA 4OMZA 4O6JA 1WN1A 2VODA 4RGUA 1WBQA 5JFRA 3HRTA 3CUQC 5FLXZ 4YFXF 1E2XA 2VOOA 4ZWOA 5LGNA 3KZZA 3ROUA 3SXYA 2BN7A 2HKXA 1HQCA 3GFLA 2BHAA 1BM9A 2RKHA 1J2XA 2AXLA 3JAMK 2HR3A 4S01A 3FHZA 3FWEA 5HLGA 3F21A 5E20A 1Z7UA 1WI9A 1C0WA 4WF2A 3E6BA 4EM2A 3EDPA 2GG8A 1R1VA 3V7CA 1S7OA 3N4MA 4B8XA 4S05A 1R23A 1TQMA 3NQOA 1XD7A 5D8KB 5H20A 3W6JB 4WX9A 1O0XA 1XB4A 3S6BA 5L3BA 4ZWPA 5F6FA 3GW2A 4F7ZA 4ENJA 1LDKB 4ZYHA 3D0SA 4KMUX 1EH7A 3ELKA 4U0WA 3TOAA 1S8NA 3RTRA 1FY7A 3IRRA 2RNJA 2E7XA 3RIRA 5D5WB 4U75A 2ZBKA 2VC1A 2H94A 3WODF 4A6VA 1X3UA 4A0XA 1BC7C 5E1XA 3T0YA 3QU6A 2F5EA 3GFJA 5FD6A 2OA4A 1FZPB 2A6EF 1U78A 3DV8A 1I27A 3I0TA 5L3DA 5FFXA 1B9MA 2Z99A 4U6ZA 2YPRA 2R7DA 1LDJA 1J59A 4OINF 4PV4A 2BHBA 3LWFA 1FSEA 3WTZA 4UVAA 2QQAA 1ZYRF 4M6XA 4S2RP 3IRQA 4FLIA 4U0YA 4PCQA 2QBYB 2CWEA 2B3LA 2FMLA 3GWZA 1MGTA 3RPQA 4HDUA 1T38A 4LK1F 3B02A 4ZYGA 4G7ZF 3IU7A 2M1BA 3IWFA 1IN7A 2Q8KA 2Q0OA 1HSTA 1D8KA 2FQ3A 4WXHA 1B1BA 2CGPA 2K27A 3I59A 3WTWC 4EGZA 4A0YA 2Y75A 1C23A 3F22A 4UUVA 4U7BA 1IAWA 5JHUA 2R3SA 3ERED 1WWXA 4OIRF 5CNXA 3RJPA 2BWSA 1IXCA 3QP6A 4ZYDA 3S2WA 2XAJA 3PKEA 2H6BA 3FXUA