1XGMA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgmA01
1P6RA 4U7DA 2P7CB 2ZNZA 3ZP5A 5FB2A 2DT5A 2ETHA 3ML6A 2GWRA 1MDMA 1XGNA 1E17A 3IWZA 1XDUA 2WV0A 2DTRA 1BIAA 3K1NA 1ON2A 1LEAA 2EVMA 2RQPA 3KP2A 2OD5A 4LB6B 5CYVA 1U8RA 2EFPA 4BHPA 2CQKA 1TTYA 3CTAA 2XAHA 2A07F 2VC0A 3GZ5A 5HLGA 5CLSA 4RB3C 1ZLKA 2RVCA 4OMZA 3FF5A 3ULQB 1PUEE 3CB5A 1I1GA 2NS0A 4I2OA 2HYGD 2CYYA 2XAFA 1J0RA 3FX3A 1DPRA 2XVCA 4G6DA 2QVOA 2OKNA 1BN5A 2L02A 1SMTA 5CVVA 2BWYA 4WWCA 2XKOA 2P99A 5IT9Z 1P4XA 4M74A 3QP6A 2GAUA 2ISYA 4PNCA 3F8BA 3IU8A 2ZBKA 3V8LA 4P55A 1XSXA 1YS7A 3BZ6A 1ZG5A 4FT8A 5LEKA 3FHZA 1IN5A 3RYRA 1R5GA 2E7XA 1QO0D 1EH6A 1I1SA 4U0VA 1ODDA 2V3XA 1TQIA 4KUMA 2YPRA 3C7JA 3CUOA 3P9IA 3RKWA 2V9VA 3HSFA 2HS5A 2IW2A 4MGRA 3ECHA 2JT1A 2IRFG 2H6CA 4EM2A 3TB5A 3W6JB 4M9SA 2UZKA 3V7RA 1Y0UA 4QLCU 2BWSA 3DV8A 3VFZA 1X3UA 1QXZA 4A6EA 3CDHA 4I09A 2BWTA 1O3SA 4RZZA 3ZQ7A 1D8KA 5BPIA 3EYYA 4LLLA 1W4MA 1KQ9A 2G7HA 2O0YA 3ABTA 3WGHA 3KETA 2FNAA 4FX0A 1LVAA 5E20A 2F5EA 3M8FA 5ICEA 1KQ8A 3T5XA 2XROA 3K2ZA 5E1ZB 5HLIA 4U0YA 3ELKA 4H0EA 5ICFA 5HLHA 2B3KA 2EA4A 2CWEA 2BWXA 1SAXA 1U78A 4YIIA 2VN2A 2EJRA 2XUBA 3TO6A 1PV9A 1LJ9A 1BI2A 4L0ZB 2KJBA 2Q8KA 1FWZA 2P7VB 1IRGA 4IKSA 3ZMUA 4D0PA 3CLOA 3HSEA 3DPLC 4MQVA 4PCQA 1J59A 3I71A 1P2FA 2OAZA 2EFQA 1MDMB 5DYMA 3I58A 1YJ3A 4ZZLA 3LAJA 2XIGA 2VT2A 5KVRA 4MATA 4XRFA 4MTEA 4BYYA 5FD6A 2VBWA 1Q1HA 1DPUA 1AWCA 2K4BA 2BYVE 1YW9A 1ZREA 2WC2A 1YG2A 3WTSC 3LWFA 5CVJA 3C1DA 3WTUC 4WCGA 4CYDA 4I01A 5HVQC 4ZNGA 2YX4A 4P5OA 1CF7B 2LF8A 3T1BA 3TOBA 1KU2A 3K1PA 4EJOA 4EJVA 2BV6A 5ICCA 4PDKA 1YW8A 4LLGF 5D5UB 2W84A 1CHMA 3MZHA 3IRRA 1SMYF 2COMA 4ZZDA 1UFMA 2NNNA 3T8TA 5JVTA 1FLIA 2JSCA 2R7FA 2HDCA 2M5WA 5E18F 3HIFA 1LDDA 3ISPA 1JGSA 3P9CA 3BPVA 1MATA 4M6YA 1ZRDA 2V1DA 3H3UA 4IU6A 4HDUA 1YQAA 3JSPA 2O03A 1QZZA 3LQRA 4CGZA 2IW5A 2EWNA 2ZMEA 1SFEA 1KU9A 3B73A 1F5TA 3BJ6A 1GXPA 2FBIA 4S05A 2O6GE 2XASA 2GG7A 1WY2A 1KYWA 2Z3YA 1ON1A 2IPQX 1XCBA 2AXLA 1W2MA 2W85A 3HTUA 3VB2A 3OOPA 3FMSA 1MZBA 4LK0F 4O3MA 5F64A 2BHAA 3GUDA 3F6OA 1MKMA 3FMRA 3GYHX 3DKWA 1UHWA 2MH2A 1FYLA 1ZHFA 2IP2A 4PGHA 3WTVC 3F3XA 4UV9A 4FLKA 1HW2A 4R1HA 2EK5A 3WE3A 1LDJA 2Q94A 1HW1A 3BY6A 3I53A 5FCHA 3K9TA 1IF1A 2RNJA 6PAXA 3MCZA 3JTGA 1IN6A 4OOKA 3F21A 1U5TC 3LQQA 4EM1A 1S7AA 1SFXA 4ZH4F 4HBLA 1P92A 5AONA 2GGCA 5CDLA 2EB7A 4WF2A 3PQJA 2KKOA 3ZPLA 4I02A 3WGIA 3MWMA 2BEOA 1U2WA 1FBQA 1G3YA 1B4AA 1PP7U 1R1UA 3LA2A 2MD5A 1J7KA 1SD7A 4WXHA 5FLXZ 3BWGA 4P96A 3E5XA 4B28A 4L5JA 2VBXA 5L3GA 1MGTA 2XGXA 4FO7A 3ABUA 2V6CA 1RNLA 1J5YA 3TAVA 4ESJA 1WRJA 4LG0B 3OV8A 3U1DA 2GZWA 3KEOA 1W7PB 3EUHA 4YFXF 1Z6RA 2IJLA 1I6XA 4BH9A 5FFXA 2GG3A 2QBYA 3DF8A 3ZMTA 3Q6DA 1HKSA 3KLNA 4ETSA 3I4PA 4HOBA 4RGSA 3MR1A 5LRSA 3AAFA 2HQNA 5A2QZ 3IHUA 1XSDA 2NQ6A 2MBFA 3BOQA 2EV0A 2VBZA 2GZ5A 2VOPA 2JPBA 1YYVA 1H9GA 1O7LA 3ZN0A 4KMFA 3CUQA 1SD6A 4S00A 4YFKF 2VXZA 3WTYC 2P5KA 2Y48A 4OIOF 2QYOA 4RAYA 1QXWA 2XRNA 2GU6A 4A12A 2STTA 2M45A 4CDGA 1FSHA 2RV8A 1BI0A 3CB6A 5DDGA 2QQAA 2HZTA 1USSA 5A2QK 2ISZA 1WL6A 2H09A 2W24A 4RGXA 4CICA 4KDPA 2GG8A 1IUYA 1JHHA 2M8EA 3L2CA 1XD7A 2GU7A 4U71A 3JAMK 2M30A 3S6BA 5D8KB 2OQRA 1K7AA 4ENJA 2H27A 2GG0A 4IF7A 4IVNA 5EEHA 4ESFA 4MQ9F 3EDPA 2RGVA 4OIPF 5HDKA 3U2RA 5E1WA 2BHBA 1OYYA 3GXOA 2HEOA 3LSTA 5LHHA 2A69F 5J6XA 4IRIA 2FU4A 1M35A 4GO1A 3ZMSA 3WTXC 4PZJA 1WSUA 1U5TB 4QR8A 3V7SA 2KIUA 1FP1D 3L00A 3TKYA 4Y17A 2LF7A 3KE2A 3KZZA 1H9TA 3GFMA 2DK8A 5DV5A 4A0XA 4G7OF 2QZ8A 2FBKA 1FT9A 1F1ZA 2M1BA 3VOEA 3PKBA 2V79A 1YW7A 2Q96A 4XSXF 1ZN2A 2EFNA 4JQFA 4EQQA 2DAOA 2GG9A 4NQWA 3GW2A 4XLNF 1BIBA 3PKAA 3BJAA 5H6QA 2LNBA 3MAJA 4WX9A 2EVOA 2HGCA 3EETA 3DXJF 3QOPA 3J7AO 3D27A 1Z9CA 2GXGA 4CHUA 5JR3A 3LAPA 3RPUA 4MNUA 1YO5C 4EMSA 4IPAA 2EFWA 3ZMDA 2IT0A 2VOOA 4PV4A 2Y0MA 5D6FA 1WQ2A 1MJAA 1FPQA 2IVMA 2OZ6A 1ZRCA 5CDVA 1ULYA 2J5PA 3S2WA 1T2KA 3ZMZA 4P9UA 4Q48A 4BHCA 1EH7A 2ZO4A 4MEYF 1ZLJA 1IZ1A 1XN7A 1STZA 5HS8A 2AS5F 4FX4A 3E5QA 4OIQF 4UNOA 4EGZA 1GXQA 2HOEA 2A6EF 1T98A 4HLXA 4K2EA 3IKVA 4EJTA 1ZGJA 4HF0A 1L0OC 4U76A 3C3WA 2DBBA 1YIOA 1IXSB 1ONVA 2QENA 1EH8A 3RI4A 1Z05A 5DCFA 4EM0B 4G8XA 3E3VA 1QGPA 1MJ9A 3ZN1A 2ELHA 1RIOH 5FLXK 1FNNA 1PP8F 5FFZA 4EGEA 1Z7UA 2M87A 1WWXA 1OYWA 1JE8A 2H6BA 4IDYA 3TO7A 5D5VB 4N0BA 4BAYA 3ROUA 1LQ1A 3R60A 2BB7A 2GQQA 1WKMA 1T38A 1HW5A 4G94A 2QWWA 3IWFA 4HF1A 1YS6A 2X0LA 2C6YA 3FWEA 1XMAA 4IRGA 2PG4A 5HS9A 2OZUA 3IKTA 5K1YA 3SHFA 4U7BA 3KP4A 1J2XA 1UHMA 2P98A 4B8XA 5ILVA 1G4DA 3R0JA 2QQBA 3WTZA 2XV4S 3CTZA 2P4WA 2VT3A 3MEXA 2KRFA 3ERED 2E7WA 2QLZA 3HRTA 4G6QA 1S7OA 2GU4A 3F23A 5TJJA 1OR7A 4I0AA 2HKOA 1I5ZA 4YIFA 4LK1F 3GVAA 1K78A 4Y13A 3J80K 2FOKA 3F22A 1Z91A 2CFXA 3KP7A 1FOKA 2K27A 2KIMA 2ZKZA 5ILSA 4EV0A 2DW4A 2HOWA 1UB9A 2MATA 2OA4A 4N9IA 1R22A 5LEJA 4UVBA 3J81Z 4IRHA 1MJBA 4RB1A 3F6VA 1XGOA 2HTJA 4Q4ZF 4GYGA 2PI0A 1H0MA 3J80Z 2IA0A 3K1MA 1L3LA 4MHGA 4A6VA 2R7DA 3H92A 3MQ0A 2LKPA 3KP5A 2X4HA 3WTWC 3RKXA 5LGTA 1ZRFA 4HYEA 2UWMA 5HDNA 4GCVA 4R79A 2FMYA 4FHTA 3HTSB 4KNYA 3FM5A 2K02A 4KFCA 3HRSA 1E2XA 3R6SA 3HHGA 1IAWA 1JAWA 5E5BA 2JPCA 3BIQA 5D6EA 5FD5A 1RZ4A 1JXSA 1KU3A 2RN7A 4L5IA 1RUOA 2R3SA 4U1BA 5K5RA 4HX8A 3LFKA 4HV6A 5E17F 1B6AA 2K86A 3VEPA 3BIPA 1R00A 3QU6A 4U88A 1ZARA 2OU2A 3HOSA 4RGUA 2G9WA 1P4AA 3C18A 3WGGA 5HDGA 2GA2A 1TW3A 3I59A 3REOA 4M9ZA 4O5VA 4LD5A 1A04A 2B3LA 1I27A 3HRUA 1J75A 2ESHA 3L7WA 3K0LA 4LMYA 4ZYGA 5ED4A 1QZYA 3RTRA 2VE8A 3QAHA 5LGUA 2BGCA 4QWQA 5LGNA 2A6HF 4U73A 1Z6TA 1XDSA 2JZYA 1LNWA 3RKYA 4A6WA 2XAQA 4FLJA 4AIJA 1TNSA 4RGRA 2VBYA 4FLLA 4AVPA 2G7UA 1S6LA 4A6DA 4IKUA 3SZPA 3M7GA 4PGGA 5DEQA 1ZYRF 3CJNA 4FO8A 4UUVA 2FXAA 1KGSA 4IKTA 4OOIA 1R1VA 3ZMVA 3GFJA 1GVJA 4IF4A 1LB2A 1BJAA 5LLQA 3HYIA 4HF2A 1V3FA 4E70A 3HOTA 3EYIA 2PEXA 3KZYA 1P4WA 1IRFA 2FF4A 4KN7X 3L9FA 3W6KB 2PLYA 1W5TA 2MC3A 2RC4A 2P6SA 3TDZC 3WU0A 4A0YA 3G73A 4HLYA 1HKQA 5CNXA 2EFOA 2GG2A 1O3TA 2B3HA 2IA1A 2K4JA 2ADUA 1GHCA 2ACJA 2BWWA 3P9KA 2PMUA 4HV5A 2E1NA 3FMQA 3F8FA 4AIHA 2Z99A 4OU0A 2XHKA 2MLGA 3KFWX 1D3YA 1R1TA 5FO5A 3O3KA 4HX4A 4Z7MA 4IXAA 1B59A 2L4MA 3I0TA 3RPQA 2P6TA 4G7HF 3FXRA 3G3ZA 3Q9SA 4HXXA 2Z33A 3IRQA 2YR2A 1ZGAA 3GLXA 4M73A 4ZYEA 4AD9A 1HSTA 3V7CA 3IU7A 4GYIA 1C21A 3U9GA 4AWXB 5IT9K 5E8IA 3TQNA 3QPHA 2BHDA 1XGSA 1B9MA 2QUFA 1T39A 1USTA 1W7VA 2JRTA 3RYPA 4CXFA 2WWYA 5ERIA 1FC3A 1W7PA 3PKDA 1DP7P 3BROA 1FZPB 2FRHA 3COAC 3KLOA 3B02A 3BDDA 4MEXF 1FBUA 2HWVA 4KIGA 1XNZA 1XCVA 1WL9A 4FKCA 2Q92A 1FBSA 4DNCA 2OBPA 2FQ3A 4OMYA 5F1RA 1ZH5A 2DU9A 4M9XA 1C22A 2H94A 2V1UA 2RDPA 3TOAA 4LFUA 3O2PE 2VC1A 4S2TP 3VODA 1R7JA 2KIFA 3SFZA 1FX7A 4UV8A 1T0FA 1TLHB 1FYMA 5HS7A 4S04A 1D8JA 2BH3A 4EJUA 3I59B 3RJPA 5H6RA 3PKCA 2GA1A 1W7PD 4ZYHA 2XAJA 2V3YA 5EEGA 1WLRA 2ZCWA 3BJOA 3H3ZA 3NRVA 2Q2EA 2LDUA 4ASNA 1REPC 2PFBA 4I7HA 5JI6A 3P7NA 5L3DA 4WK8F 3QP5A 2BE5F 2XKPA 5E1XA 4XLPF 5DCMA 2P9AA 2GIVA 3D5LA 1ZG3A 1LEBA 4KA4A 4YG2F 4P9FA 2FSWA 1B9NA 3HSRA 3BITA 3L09A 1R58A 3KCCA 4A0ZA 1G3TA 5E8GA 3Q9VA 1CGPA 1XB4A 3R61A 4EJWA 5DUKA 1S8NA 2MLKA 3E6MA 3CUQC 3FXQA 2ZFWA 2UXNA 3E6CC 4BQAA 4G9YA 5D4SA 2BWVA 2L4AA 3F8CA 4B09A 3TO9A 3F8NA 5ILUA 3BP8A 1C27A 2PN6A 4IJAA 2BWUA 5CJ9A 3KP6A 4HX7A 5F6FA 2L01A 4A5MA 4JUQA 4TV7A 4S2RP 2FBHA 2VE9A 2HQRA 5J8FA 1BOAA 4ENNA 4Q5SF 4KT5C 1BI1A 1LDKB 1FY7A 4UHTA 1FP2A 1BC7C 3FZVA 1K78B 2EA2A 4U75A 3GEZA 1G3SA 1FSEA 3PQKA 1K6OA 2O8XA 2ZMEB 4UVCA 2HR3A 4R60A 1BI3A 4YFNF 1N51A 5L3EA 1C0WA 2MH9A 4KN4X 5JFRA 4NHJA 5DCMB 2Q93A 3QPTA 3CO6C 1QPMA 4ENKA 2NQ7A 5AIQA 1G3WA 3E6DA 4ZWPA 5H20A 3EQLF 4F7ZA 5CVIA 3BPXA 4O6JA 3GWZA 4CO8A 5TRDA 1R23A 4RZYA 4CZZA 4NB5A 2FEZA 3WODF 1IXCA 3GFLA 3RVAA 3JSOA 4L9TA 3I5UA 4RB0A 4Z2YA 2P8TA 3IU9A 2BBYA 4ENMA 1HQCA 3M8EA 1QBJA 2DO7A 2QM3A 2STWA 1D5VA 3SXYA 2NAZA 2CO5A 4UVAA 4I98B 1S29A 1IN7A 3CO7C 5CDEA 5LRRA 4U6ZA 4AIKA 2E1CA 3IG4A 5K5QA 4HDVA 4LGWA 2FMLA 4U6CA 1IXRC 5HOOA 2B0LA 3IL2A 3SZTA 3PFIA 3NEUA 3DQVC 4LB5A 1AOYA 3HRMA 4HQEA 4GGGA 1KU7A 2J5OA 2ZJ2A 3ECOA 4BNCA 4KM3A 1MD0A 2A61A 5D5XB 2CW0F 2MA3A 2D1HA 5L3BA 1YVMA 3MATA 4DQ2A 1YTYA 1R5HA 2W57A 3IC7A 4A2UA 2PBIA 1S3JA 1V4RA 1YLFA 2A5YB 3TGNA 1O7FA 2KJCA 2WTEA 5D4RA 5BQTA 2O61A 5CE6A 4G7ZF 2Q0OA 3F8MA 2GGBA 4M6XA 4KIBA 2ESNA 1BBYA 2L54A 4L9NA 2EVCA 2BN7A 4FUKA 3D0SA 5JHUA 5CIKA 2VODA 4BXUA 1OPCA 3V4GA 1SD4A 5DD4A 2DPUA 5DUIA 1F4KA 4HZFA 1IW7F 1QQIA 3FM3A 4EGYA 2YSRA 2F5FA 5LHGA 4R8HA 1KP0A 1BM9A 2UXXA 3KEQA 4JBAA 5CVRA 1A16A 3JW4A 2HYFA 3T0YA 3WG9A 1HSJA 4U6WA 4IHSA 4KIFA 2HKXA 3WU1B 3K69A 2DQRA 2VONA 3DFGA 3FXUA 3V8JA 2PJPA 1Y1NA 2DQLA 2LSOA 5LHIA 2BHCA 3N4MA 1EV7A 1YFHA 1O57A 5BOXA 2D2WA 3R4KA 3I54A 3M1EA 3DPTA 4EVIA 1U6GA 3O6BB 2FE3A 2EV6A 4WXDA 1W5SA 2QBYB 3HHHA 1U5TA 1B1BA 2D1VA 2DI3A 5DD8A 1OMIA 3R0AA 3PKEA 2EV5A 3NQOA 1R36A 4N9HA 2ZSGA 2GG5A 1NHAA 1O3RA 3DP7A 3I64A 4RB2C 4LG0A 4ZYDA 4LLNA 4IKRA 5D5WB 2HTSA 5BS6A 5L3CA 3F72A 3T8RA 3M9AA 4L9VA 5LBQA 2XAGA 4ZWUA 4WXCA 1XSVA 3JTHA 5L3FA 2FNPA 4KICA 3L24A 2IA2A 1TQPA 3MFKA 2NRAC 3J81K 1O3QA 1G6NA 3JAMZ 4XSZF 4KYWA 2W25A 4L18B 2Q95A 4L9JA 3LA3A 3HUGA 1ZAOA 2V3ZA 2P5VA 3L7GA 1VTNC 1OKRA 3MZYA 4M71A 1UCRA 5BPDA 4A5NA 1U3EM 1XMKA 2Z5UA 3E97A 4FLIA 1F9NA 3TDUC 2GXBA 2PMHA 3CUQB 3V8KA 3Q5FA 1OYIA 4OINF 2Y75A 1RUNA 4RS8A 1QXYA 3GO5A 1PDNC 4OIRF 1WBQA 2FA5A 4U6EA 2OQGA 4MTDA 2HFHA 3QU3A 4L0YB 2YX7A 4BHBA 2RKHA 1FYKA 1XGMA 5K5OA 2D45A 1TBXA 1ZG1A 4U6JA 3WE2A 2JTVA 3SQNA 4IECA 4U69A 2F2EA 1HBXG 2PQ8A 1WN1A 2GTXA 1KA8A 2P5LC 2Z9OA 2DPDA 1T6SA 4S01A 2TDXA 3E5UA 5BMZA 3KP3A 4ESBA 3E6BA 3RORA 2ZXJA 1KQ0A 3RIRA 4HA8A 5AIPA 2F5DA 4UXNA 5KK1A 1TQMA 3GX4X 2O3FA 3LA7A 1C24A 1QNTA 1C23A 1SFUA 4M72A 4Y15A 1O0XA 5CVUA 4HQMA 3DEUA 1Z1DA 4U0WA 3RDIA 5J8CA 3GFIA 1RI7A 4XBFA 1TNTA 4KMUX 4RGZ1 1KYZA 1K79A 3MX6A 4GXOA 5IT3A 4ZWOA 5ICGA 1HKTA 1DDNA 4JK1X 1IN4A 1JHFA 2NYXA 2G6PA 2DK5A 4IHTA 2QQ9A 2ZNYA 3N97A 5FGMA 2CG4A 2GU5A 4RAZA 2YU3A 2V1XA 2L3DA 2A68F 3GF2A 3WTTC 2DLLA 2F5CA 1BC8C 1J9IA 4HW0A 1SD5A 1CF7A 3QRFF 1TW2A 4ON0A 3GZ6A 1DUXC 1IN8A 4HAMA 2NNYA 2CGPA 4Q47A 4I0BA 5FCFA 2DFIA 4U70A 2A3SA 1WI9A 1HXDA 2CSOA 2K7LA 5D8LB 4LJZF
chains in the Genus database with same CATH superfamily
3NWSA 1P6RA 4U7DA 4CCOA 3FBIB 2P7CB 2ZNZA 3ZP5A 4A3BJ 5FB2A 4BE2A 2P0WA 2DT5A 5FKOA 2WADA 2X1EA 4QSHA 2ETHA 3ML6A 4XRSG 2GWRA 2V26A 1MDMA 1XGNA 2EBIA 4QIWN 2BY3A 1E17A 3W3CA 3IWZA 3GTLJ 1XDUA 3K4MA 1YRNA 2WV0A 4RDUA 3K4NA 2DTRA 4XOTA 3SDBA 1BIAA 3K1NA 2D5VA 2CUEA 1ON2A 1LEAA 1OCOH 3TP0A 1BR2A 2EVMA 1MNEA 2RQPA 3KP2A 3OYCA 5K7ZA 3VYRB 2OD5A 4LB6B 1ZQ3P 5CYVA 4MIMA 1MMGA 1U8RA 2R93J 2EFPA 2E5NA 2F4OB 4BHPA 1E3OC 3CCQI 2CQKA 4XOPA 1TTYA 3CTAA 4RM3A 4C2TA 3A1YA 2XAHA 2WAFA 2A07F 2CUFA 2VC0A 3GZ5A 1R9TJ 5HLGA 5CLSA 2DMPA 5DTDA 5J47A 4RB3C 4A3FJ 1ZLKA 2RVCA 5CPRB 4OMZA 3VYUB 1YJNI 3AKZA 3FF5A 3ULQB 1PUEE 3CB5A 1I1GA 1D0YA 2NS0A 4I2OA 2HYGD 2CYYA 4YEJA 2CQNA 2XAFA 3FX3A 1J0RA 4Y4RA 3H3VK 1RKWA 1DPRA 2XVCA 4G6DA 5HNFA 1U9OA 1X1AA 5TGTA 2QVOA 2HVRA 4E7SA 1BN5A 5F0HA 2OKNA 2L7KA 3RSNA 2DA1A 2L02A 3N05A 4CSWA 3D1NI 1SMTA 5CVVA 4AVZA 3FXKA 1SAUA 2BWYA 4E7KA 4WWCA 2XKOA 2P99A 5IT9Z 1UAAA 3DBHB 1P4XA 2L9SA 4M74A 4XMYA 4XKBA 5E79C 3QP6A 1FOXA 2GAUA 3S93A 2K9QA 5B1BH 4CA0A 4XORA 2ISYA 4PNCA 3F8BA 3IU8A 5HNHA 2ZBKA 1AKHB 3V8LA 4P55A 1XPXA 1XSXA 1YS7A 3BZ6A 3TW7A 3SEQA 2KDOA 1ZG5A 2LFBA 2KRHA 4FT8A 5LEKA 2ECBA 3FHZA 1IN5A 1Q1VA 2E35A 4IZZA 3RYRA 1R5GA 2E7XA 3AG1H 1QO0D 5GTHC 1EH6A 2FD5A 2EZHA 1I1SA 3F0CA 1MBFA 4U0VA 2HYJA 1ODDA 1G59A 2V3XA 5FKLA 1BW5A 4XLAA 1JJ6C 1TQIA 4A3DJ 3L2RA 4KUMA 2YPRA 4UUSB 2KHMA 3QODA 3C7JA 3CUOA 3P9IA 2VQHA 3RKWA 4I76A 2V9VA 3HSFA 2HS5A 2IW2A 4MGRA 3ECHA 2R7ZJ 2JT1A 3NARA 1ZR4A 2IRFG 5EZHA 1Y1VJ 2H6CA 1TL8A 2CQXA 1VQ4I 4D5CA 3DTKA 4EM2A 3KPHA 1FOWA 3TB5A 2ICWG 3W6JB 4M9SA 4B48A 2UZKA 3V7RA 3RZOJ 1Y0UA 4QLCU 2BWSA 3DV8A 2Y2ZA 3VFZA 1X3UA 5IP6A 2NVQJ 1QXZA 4A6EA 1Z77A 2HXOA 4BEHA 4PJLA 3KYDB 2A05A 3CDHA 4BXXJ 2AO9A 4I09A 2BWTA 1VQMI 1O3SA 4RZZA 2R7WA 3ZQ7A 1D8KA 4HSRA 3S16J 5BPIA 3EYYA 4LLLA 1W4MA 2ZFUA 1KQ9A 2G7HA 2O0YA 3ABTA 3WGHA 3KETA 2JA2A 2JA8J 2G0EA 3ZQHA 3U1KA 2FNAA 4FX0A 1LVAA 5E20A 2F5EA 5F08A 3M8FA 2QCOA 5ICEA 1JT0A 1D0ZA 1KQ8A 3T5XA 3K2ZA 4LIVA 5E1ZB 5HLIA 4U0YA 2XROA 4A93J 3ELKA 4H0EA 3OYDA 5ICFA 5HLHA 4BQNA 4V19K 2EA4A 2B3KA 2CWEA 3OY9A 2BWXA 1U78A 1SAXA 1ZR2A 4YIIA 2VN2A 2VJ5A 1N75A 3H9JA 2X6WA 2HOTA 2EJRA 2XUBA 3TO6A 1A36A 4A3KJ 1YITI 2VJJA 3U21A 3W2WA 4DZPA 2W7NA 1PV9A 1LJ9A 1BI2A 1HC8A 3CC2I 4L0ZB 4G12A 2KJBA 2MG4A 2HZDA 3TL4X 2Q8KA 1FWZA 2P7VB 1IRGA 3VSLA 4IKSA 3ZMUA 5DS9A 4PSXA 4D0PA 2VQLA 4IHWA 3CLOA 3HSEA 3LSMA 3DPLC 1GLNA 4PJMA 2V7FA 3RCOA 4MQVA 4PCQA 4MFEA 4E7LA 3I71A 1J59A 1VQ6I 1P2FA 2IXSA 3W2AA 2OAZA 2EFQA 4UUSA 1MDMB 5DYMA 3I58A 1YJ3A 4OWRB 2NVXJ 4ZZLA 5FLMJ 3LAJA 3OYHA 4BQQA 2XIGA 1X2MA 2VT2A 2VUMJ 2HNHA 5KVRA 4MATA 4XRFA 3C2GA 5C4JJ 4MTEA 4BYYA 5FD6A 2XAUA 2VBWA 1Q1HA 3HPHA 1DPUA 1AWCA 4A3CJ 2OJED 2K4BA 2BYVE 1YW9A 1EKEA 4BJ6C 1ZREA 1EA3A 2WC2A 1YG2A 4CCLA 3I56I 3W6VA 4ZC3A 3DPUA 3WTSC 3LWFA 5CVJA 3C1DA 3SFIA 3WTUC 3HC7A 4WCGA 4CYDA 1HOMA 4XK4A 1Y56A 5CQGA 3ZQCA 2K9NA 4I01A 4AYBA 5HVQC 4DIQA 1V5FA 2YX4A 4ZNGA 4P5OA 1CF7B 2LF8A 3T1BA 3TOBA 3ZQIA 1KU2A 3K1PA 4V2GA 4EJOA 2GBYA 4EJVA 2BV6A 5IP9J 1YX3A 5ICCA 1FOYA 4PDKA 2X9DA 3M8JA 1AU7A 4ZYAA 1YW8A 4LLGF 5D5UB 2W84A 1CHMA 2CV1A 3MZHA 3IRRA 5FLVA 2VKHA 2F4IA 2DA3A 1YJWI 3I4NJ 1SMYF 4KJZA 2COMA 3IAS2 4ZZDA 1UFMA 2EPFA 2NNNA 3T8TA 3CP8A 5JVTA 1FLIA 5J40A 2JSCA 3QPSA 2ZJPF 2R7FA 2HDCA 2M5WA 3VYSB 5E18F 3KZIC 3HIFA 1LDDA 3ISPA 1JGSA 4A3GJ 3P9CA 1B72A 4MLOA 3BPVA 2KLOA 1A31A 1MATA 4M6YA 1ZRDA 2V1DA 3H3UA 1DP3A 5IYBJ 4IU6A 2W1OA 3K4LA 4HDUA 1YQAA 2E1MC 3JSPA 2O03A 2L7MP 1SVMA 1QZZA 3LQRA 3ZQGA 4CGZA 4BJTA 3G1MA 9ANTA 1E0EA 2IW5A 2EWNA 2ZMEA 2XPUA 1SFEA 1KU9A 4BBSJ 3B73A 1F5TA 3BJ6A 4M3FA 4BACA 1UHSA 1X1BA 1GXPA 1YJ9I 1T56A 2FBIA 3J7AY 3PO2J 5FKMA 4S05A 2Y0SA 2VPLA 4ZJZA 2O6GE 2XASA 3PO3J 2GG7A 1WY2A 2JSPA 3MZ8A 2BVMA 2WY8Q 1KYWA 1IDYA 2V9KA 2Z3YA 1Y6IA 1ON1A 2IPQX 1XCBA 3K7AJ 2AXLA 1W2MA 2W85A 3OS0A 3HTUA 3VB2A 3OOPA 4Y3OA 1MMNA 1JUPA 3SEZA 3FMSA 4CUGA 1MZBA 3OYLA 4LK0F 4O3MA 5F64A 1V55H 2BHAA 3C2BA 3GUDA 4XKVA 3GTGJ 3F6OA 2KFDA 1MKMA 3O8HA 3ABLH 2I10A 3CLQA 3FMRA 4B4CA 3GYHX 5B1AH 2BW3B 1U8BA 3K6GA 3DKWA 1UHWA 2LREA 2XPWA 2MH2A 3LFUA 1FYLA 1ZHFA 2IP2A 4PGHA 2JK3A 3GTOJ 3WTVC 1DGWY 1Z21A 3F3XA 2R5ZB 1VFCA 2EILH 4UV9A 2IS6A 4FLKA 1HW2A 4R1HA 3CJTB 2EK5A 3WE3A 1LDJA 2Q94A 2QKLB 1HW1A 2VXDA 3CCMI 3S8PA 3BY6A 4J19A 3I53A 5FCHA 1UELB 3DKYA 3K9TA 3ZQLA 1SEUA 1IF1A 2RNJA 6PAXA 3MCZA 3JTGA 1IN6A 1TT5B 3C2HA 4OOKA 1D0XA 1SVLA 3F21A 1U5TC 2CUJA 2DODA 3LQQA 4DBQA 4EM1A 1OCRH 1S7AA 3GMEA 1OLTA 2WBMA 1SFXA 4ZH4F 2MC4A 3W2VA 4C2UA 4HBLA 2B63J 4ZTFA 1P92A 5AONA 2GGCA 5CDLA 1WVRA 2EB7A 1Z7LA 3LOCA 3OR2C 5E3OA 1WFXA 1UZCA 3AFHA 2DN0A 2I5UA 4WF2A 3PQJA 1JI8A 2KKOA 4MFDA 2BHYA 3ZPLA 4I02A 4BUPA 2GOMA 4DJAA 3WGIA 3MWMA 1QHGA 3FDYA 2BEOA 4OAZA 1U2WA 2L9NA 4DYQA 3OYNA 1WJBA 1FBQA 3M3YJ 1ENHA 1UMQA 3FXJA 1ZGWA 1G3YA 3OWTA 2WB1N 1B4AA 1PP7U 1I50J 1R1UA 3HOWJ 3LA2A 2MD5A 1J7KA 1N25A 1SD7A 5K7HA 4WXHA 2ZJRF 5FLXZ 2M4GA 3BWGA 3PNYA 4P96A 2X85A 3E5XA 1RESA 1MBEA 4NNJA 3S3MA 5IOZA 4B28A 1TWHJ 1XS9A 2JUGA 2E2HJ 2W00A 5J4VA 3FKIJ 2DDBA 1NG7A 3IUOA 4L5JA 2JQ7A 2VBXA 3H36A 5C4XJ 2VJ4A 5L3GA 3SJMA 1MGTA 2XGXA 4PSWA 4FO7A 2R92J 3ABUA 2V6CA 3HL2A 1RNLA 1J5YA 2IGOA 3BG7A 4BU2A 3TAVA 1WJ5A 3HBLA 1WRJA 4ESJA 4LG0B 1JTXA 3OV8A 2XC7A 2DCEA 3U1DA 2Y30A 2GZWA 3KEOA 1W7PB 3EUHA 4YFXF 1Z6RA 4N4NB 2IJLA 1I6XA 4BH9A 5FFXA 2GG3A 1V54H 2QBYA 3MKZA 3DF8A 3ZMTA 3Q6DA 1HKSA 3KLNA 4ETSA 3I4PA 4HOBA 1TZLA 4RGSA 5LRSA 3AAFA 3MR1A 3RZDJ 2HQNA 4IEJA 5A2QZ 3IHUA 4F92B 2F4MB 1XSDA 2FUG2 2NQ6A 2MBFA 4W1UA 3BOQA 3H9QA 1QPIA 4IL6C 4V2FA 2WV1A 2EV0A 2LKSA 2XSDC 2VBZA 2GZ5A 1FIPA 2VOPA 4FTHA 2JPBA 1YYVA 1H9GA 1O7LA 3ZN0A 2JA5J 4KMFA 4XQFA 3OYIA 3CUQA 1T8IA 1D1AA 1SD6A 4BJ5C 1WH5A 4FISA 4S00A 4YFKF 2VXZA 5FRMA 3WTYC 1R4NB 2P5KA 4XKWA 2KT0A 2Y48A 4OIOF 4D5FA 1TT0A 2QYOA 4RAYA 1QXWA 2XRNA 2GU6A 4A12A 3CCYA 4DZJA 2STTA 2M45A 4CDGA 1FSHA 2RV8A 5B3SH 2PMZA 2KDZA 1BI0A 3CB6A 1LE8B 4S0HB 3HUGB 1X4PA 3M1CA 1Y8RB 5DDGA 1ZKGA 2QQAA 4IHYA 2HZTA 1USSA 5A2QK 2DT7B 2ISZA 1WL6A 2H09A 2W24A 4RGXA 5JVGF 4CICA 4KDPA 2GG8A 2YU9J 1IUYA 1JHHA 2M8EA 5EGOB 2NS7A 3BG9A 5EG0A 3L2CA 4ZDLA 1XD7A 2GU7A 2O9LA 4U71A 3JAMK 3JRCA 2M30A 4GFBA 3S6BA 2QSFX 2OQRA 3BR2A 5D8KB 1K7AA 2E36A 4ENJA 2H27A 2GG0A 4OAYA 4IF7A 4IVNA 5EEHA 4HNUA 4ESFA 4MQ9F 2VKEA 2E1OA 5FJ8J 2R4GA 4A3LJ 3EDPA 2RGVA 1ETQA 3HXLA 4OIPF 2LG4A 5HDKA 3U2RA 3Q3SA 5E1WA 2BHBA 1WI3A 1OYYA 3LSGA 2VIXA 1WGXA 3GXOA 3BZCA 2LD5A 2HEOA 3LSTA 3Q0VA 2R7XA 5LHHA 2R7TA 2A69F 3S2HJ 3MVPA 5J6XA 4IRIA 2FU4A 2DYSH 2H8RA 1M35A 5DM7F 4GO1A 5KHDA 2L5QA 4FCYA 2LR8A 3ZMSA 5B66C 3WTXC 4PZJA 2WAEA 3CCSI 1WSUA 1ERDA 4CCNA 2DFEA 1W1WE 2JMWA 1U5TB 1Y8QB 2GM4A 3OL4A 4BEHB 1A5JA 4QR8A 3PIPF 2COBA 3V7SA 3RKQA 5M5YJ 2KIUA 1FP1D 4ANJA 2DYRH 1ACIA 4I99C 3K4BA 3L00A 2DMNA 3TKYA 3G4SI 4Y17A 2LF7A 2XPVA 1MNDA 3KE2A 3QYBA 3KZZA 3L2QA 3GFMA 1H9TA 4IQJA 2DK8A 1NK2P 5DV5A 3I3LA 4CCKA 4A0XA 4G7OF 2QZ8A 2FBKA 1FT9A 4Y52J 1F1ZA 3BZKA 2M1BA 4NC8A 3H9GA 3VOEA 3PKBA 2ECCA 3FISA 2V79A 1YW7A 2Q96A 2HU9A 4XSXF 2ZSHB 1ZN2A 2EFNA 4JQFA 4EQQA 3A01B 2AQFA 2DAOA 2GG9A 1JUMA 4NQWA 3V42A 3GW2A 4XLNF 1BIBA 4A3JJ 4AIDA 3PKAA 1AHDP 3BJAA 4RAFA 5H6QA 3PFYA 2LNBA 4UUTA 3MAJA 4WX9A 2EVOA 3DLAA 2KRCA 1AKHA 2HGCA 3EETA 3DXJF 3QOPA 3J7AO 3D27A 3K70D 3CF5F 1Z9CA 2GXGA 3OMYA 4CHUA 3M07A 1VQLI 5KAFC 3HPGA 3B6CA 4FE7A 3CCVI 1QVUA 5JR3A 3LAPA 5FKNA 3CJQB 3MKWB 3RPUA 3OYAA 3OYFA 2Z16A 1WJFA 5GAGJ 2FQ4A 1EJ9A 4MNUA 2JVHA 3JR9A 2RNGA 4EMSA 1YO5C 2R7VA 2DJNA 3ERMA 4IPAA 2K40A 3ZOBA 3K10A 2EFWA 3ZMDA 2IT0A 3PNTA 2VOOA 4PV4A 3KX2A 2Y0MA 4BGDA 2M34A 5D6FA 1WQ2A 1B8IA 4HRIA 1XMXA 3S3NA 1LVKA 2M2EA 2QF7A 2B7EA 2X48A 1MJAA 2NOGA 1FPQA 4C30A 2IVMA 2OZ6A 1ZRCA 5CDVA 1ULYA 2J5PA 3FK7A 4IOAF 3S2WA 5IY5H 1T2KA 3ZMZA 4P9UA 2E5ZA 4Q48A 4NUBA 2AHQA 4BHCA 1NH3A 2M9HA 1PUFB 5KCMA 1EH7A 2QQ8A 4FETA 1FTTA 2ZO4A 4MEYF 1ZLJA 1IZ1A 1XN7A 2O7OA 3VYTB 1ZK8A 2XGCA 4G6TB 4FASD 1STZA 2EH3A 5HS8A 2AS5F 2KPMA 4FX4A 1BOBA 3E5QA 1D5YA 1IO2A 1JUSA 3HDDA 4OIQF 4UNOA 4EGZA 2NVUB 1GXQA 4E7ZA 2HOEA 2BY2A 3ZQQA 4XONA 1JJ8C 2ZXIA 1G8XA 4BE0A 2A6EF 1T98A 3SDGA 3HOYJ 4BDZA 1Z3XA 5CQEA 3LSJA 4HLXA 3IV5A 1IDZA 4K2EA 2LOOA 3IKVA 2IBDA 4EJTA 1ZGJA 3M4OJ 5EZGA 4HF0A 4RAGA 2JVGA 1L0OC 4U76A 4XM3A 4GDFA 3C3WA 2DBBA 2WAQN 1YIOA 2X1CA 3HGYA 1UG0A 3D5RC 1IXSB 3HEFA 1ONVA 2QENA 1IV8A 1EH8A 3RI4A 1Z05A 5DCFA 1P7IA 4EM0B 4G8XA 2KISA 3E3VA 3CDIA 1QGPA 2K9MA 3BCAA 5LFAA 3A0HC 1MJ9A 4LITA 3ZN1A 2ELHA 2MFZA 1RIOH 5FLXK 3GTKJ 1FNNA 1WJDA 1PP8F 3L2VA 3AL0C 5FFZA 4EGEA 1Z7UA 1GVDA 4AU7A 2M87A 1WWXA 2VKDA 2FX0A 3DLLF 1OYWA 3ABMH 1JE8A 2H6BA 4IDYA 3TO7A 3LSRA 5KNLA 5D5VB 1LFBA 3PL8A 3S3OA 4N0BA 4BAYA 3L2UA 3ROUA 1LQ1A 4BY1J 3R60A 3S14J 2BB7A 2X6YA 2GQQA 2LRDA 1WKMA 2JWTA 1HW5A 4G94A 5JLXA 1T38A 1O4XA 1E3PA 5B5EC 2QWWA 4AM3A 3IWFA 4HF1A 3ZGKA 1TP4A 2DA6A 1TWFJ 1YS6A 2X0LA 4IX7A 2C6YA 3FWEA 1XMAA 4IRGA 2PG4A 5HS9A 2OZUA 1PVEA 3IKTA 1LUJB 3FHNA 3SHFA 5K1YA 1I3AA 4U7BA 2E2JJ 1RC9A 4JX6A 2DFFA 2R7UA 2M0MA 3KP4A 4M3EA 1J2XA 3NWTA 1UHMA 3DBRB 2P98A 4B8XA 5ILVA 4I6ZA 1G4DA 3R0JA 2QQBA 3GBGA 2ID6A 2W48A 2XV4S 4IQ4A 3WTZA 3OS2A 2P4WA 2VT3A 1OCTC 3CTZA 3MEXA 2KRFA 3UNGC 3ERED 2EIJH 2DMTA 2E7WA 2QLZA 4A69C 3HRTA 4G6QA 5IYCJ 1S7OA 4XN0A 2GU4A 3F23A 5TJJA 4E6KG 5K7FA 3J7ZI 1OR7A 3QQAA 4JP0A 5HLTA 2DDAA 4I0AA 2HKOA 4NC6A 1I5ZA 2H8WA 3VSKA 4BDYA 1YIJI 4BY7J 4YIFA 4LK1F 3GVAA 3VPRA 1K78A 4M3GA 4Y13A 3J80K 2FOKA 1Z91A 3F22A 2CFXA 3KP7A 1FOKA 2K27A 2KIMA 2MSYA 2ZKZA 5ILSA 5M5WJ 1HCRA 3CC7I 1ETKA 3K4JA 1RETA 4EV0A 2DW4A 3F9KA 4BS9A 2HOWA 3ZXSA 1BJZA 2O8KA 1UB9A 4PFOA 2MATA 2OA4A 3A0BC 2VKVA 4N9IA 5GP9A 4B1RA 1R22A 2NS8A 3HM5A 5LEJA 3PIOF 4DYCA 4IOCF 3PM1A 4UVBA 3J81Z 1FIAA 3IH4A 4IRHA 1MJBA 4RB1A 3HOXJ 3F6VA 1XGOA 2HTJA 3RQIA 2K3PA 1TWGJ 4Q4ZF 4GYGA 1TC3C 1FEXA 1H0MA 2PI0A 3J80Z 2IA0A 3K1MA 1L3LA 1FTZA 4MHGA 4A6VA 2R7DA 1ZTRA 1OQYA 2KL4A 1D1BA 1RR7A 3H92A 3MQ0A 2LKPA 1IV6A 3H1CA 3KP5A 2X4HA 3WTWC 2ME6A 3RKXA 5LGTA 1ZRFA 4HYEA 3ZCOA 2BY1A 2UWMA 5HDNA 4GCVA 5JLWA 4R79A 3CCUI 2FMYA 4FHTA 4A3EJ 3HTSB 1JGGA 4KNYA 3FM5A 2K02A 2NOJB 5GPAA 4DOZA 2LBFB 4KFCA 3HRSA 1E2XA 2QEXI 2HVQA 3R6SA 4EATA 4XIDA 4RM2A 2OTLI 3HHGA 3RQ4A 3H0DA 1IAWA 1JAWA 5E5BA 1KONA 1A6QA 2JPCA 3BIQA 2DOEA 4X6AJ 3KIOA 5D6EA 4CCMA 5FD5A 1RZ4A 1DU0A 1JXSA 1KU3A 2RN7A 4L5IA 1RUOA 2R3SA 3HOVJ 2FJ1A 2M7AA 3I55I 4U1BA 4UB8C 5K5RA 4HX8A 3LFKA 4CYCA 2KZGA 4FE4A 4HV6A 1T95A 3JRGA 5E17F 1WCMJ 1B6AA 1QZEA 2K86A 3VEPA 3TW6A 5EF6A 1Y39A 3BIPA 1R00A 3CMYA 3QU6A 2GIZA 4U88A 1QA6A 1ZARA 3BG5A 2EZIA 2ZMEC 1XTAA 2OU2A 2ID3A 3HOSA 4RGUA 5EDNA 4HNTA 2G9WA 5LD2C 2CS3A 1B8IB 1X3ZB 2HVSA 1P4AA 3C18A 4J01A 3WGGA 5HDGA 1IUFA 2GA2A 1TW3A 3I59A 3REOA 5J4YA 2LY1A 2KQRA 4M6VA 3HG9A 3E0JB 4M9ZA 1GV2A 4O5VA 4LD5A 1A04A 2HXIA 3OR1C 2B3LA 1I27A 5E3LA 3HRUA 2MW8A 1J75A 2ESHA 4XL9A 3TBIA 1FMWA 3L7WA 3K0LA 4F52A 2A5WA 4LMYA 4ZYGA 2CUZA 5ED4A 1QZYA 3RTRA 3CP2A 2VE8A 3QAHA 5LGUA 2BGCA 4QWQA 5LGNA 2R7OA 3QYFA 2CV2A 2A6HF 4XRSA 3BG3A 4ZDPA 1MBKA 1Z6TA 2L0KA 4U73A 2DA7A 5F1JA 3A01A 1XDSA 2JZYA 1P9QC 1LNWA 3OS1A 2ZXWH 2HQAA 3RKYA 3K4CA 4C2MJ 4A6WA 2XAQA 1RRJA 4FLJA 4AIJA 4N4OB 2VQGA 4EEFG 1TNSA 4RGRA 2M7BA 2VBYA 4C3JJ 5EEAA 4FLLA 2PJRA 4AVPA 4HNVA 2G7UA 1S6LA 4A6DA 3AG3H 3SZPA 4F91B 3M7GA 4IKUA 2WB1A 4PGGA 3K70C 5DEQA 1ZYRF 5KAIC 5IOYA 3G2BA 1T33A 3CJNA 4FO8A 1ORKA 4UUVA 2FXAA 1KGSA 4IKTA 2DMQA 4OOIA 2LYCA 4CCJA 4IO9F 1R1VA 3ZMVA 3GFJA 4CH7A 1VQ8I 3IH2A 1GVJA 4IF4A 1LB2A 1BJAA 5LLQA 3CCEI 3HYIA 3CMEI 4IHXA 3FXMA 1IG7A 4HSTA 2E19A 4HF2A 1V3FA 1W36D 4E70A 4RA2A 3HOTA 3EYIA 2PEXA 3KZYA 1P4WA 2LY9A 2BY0A 3FKJA 1IRFA 2FF4A 3L1PA 4KN7X 3L9FA 2CU7A 4II3A 3W6KB 4AUXA 2PLYA 1W5TA 2MC3A 3CESA 1N78A 2RC4A 3VWBA 2P6SA 1KZHA 3TDZC 3WU0A 4A0YA 4C3IJ 4E7HA 3BQZA 4XICA 1P7JA 3G73A 1IRZA 3BTCA 3WHBA 1GV5A 4HLYA 3I4MJ 1HKQA 2A6TA 2OV7A 5CNXA 2XB5A 1RKTA 2EFOA 2GG2A 1WJCA 1VQKI 1O3TA 2B3HA 1YE9A 2IA1A 2K4JA 2VASA 2ADUA 4HPQA 1GHCA 2ACJA 2X6OA 1R5ID 2BWWA 2EZKA 5EG0B 3P9KA 2PMUA 3JCUC 4B3AA 4HV5A 2E1NA 3FMQA 5E3NA 3F8FA 1OCZH 5GAEJ 4AIHA 2Z99A 4OU0A 2XHKA 1MMSA 2MLGA 3KFWX 1D3YA 4JX5A 1R1TA 2Z1DA 4KT6A 5C44J 4PJNA 1W36C 3ZQFA 2CJJA 1ETOA 2AXTC 4NBQA 5FO5A 3JRFA 3UKGA 3O3KA 4HX4A 4A3MJ 4Z7MA 1S5LC 4IXAA 1B59A 2L4MA 3I0TA 3RPQA 3HZJA 2P6TA 2DA4A 4G7HF 3FXRA 1A6IA 1XC5A 3G3ZA 3Q9SA 4HXXA 4XRMA 2Z33A 1BA5A 2PX9A 3BCBA 3IRQA 3CCLI 2YR2A 1HA8A 3ASOH 3PNVA 3DTEA 2H1LA 2JA6J 1ZGAA 2HDDA 3TP3A 3GLXA 4M73A 2CMPA 4B43A 4ZYEA 2F48A 4AD9A 1HSTA 3BTJA 1PYVA 3V7CA 1ITYA 4XKCA 2MYSA 3IU7A 4GYIA 4E4HA 1C21A 3U9GA 3PUFA 4AWXB 2X51A 5IT9K 2RAEA 1X2NA 2JA7J 1SFOJ 2LLKA 5E8IA 3TQNA 3QPHA 2BHDA 2QSGX 1XGSA 3JRDA 2V4JC 4B47A 2VB6A 1B9MA 2LBFA 2MABA 2QUFA 5J3LA 1T39A 1N77A 1USTA 1W7VA 2E71A 3Q0WA 2JRTA 4FQGA 3RYPA 4CXFA 2WWYA 1W0UA 5ERIA 1FC3A 1W7PA 3PKDA 4YIRX 1DP7P 3BROA 1FZPB 1X19A 1LFUP 3RPUD 2FRHA 3COAC 3KLOA 3B02A 3BDDA 2Y31A 5C3EJ 4MEXF 1FBUA 1U0JA 2HWVA 4KIGA 1XNZA 1XCVA 3E1SA 1ETWA 1F36A 1WL9A 2E60A 3LL7A 2XF7A 4FKCA 2Q92A 1OJLA 4QTRA 1FBSA 2M8GX 4NC7A 2UV1A 2XGDA 3LSIA 4DNCA 3OIOA 4BE1A 2OBPA 1VNDA 2FQ3A 1FJLA 1K61A 4OMYA 5F1RA 2R5YA 3VDXA 3DEEA 2DU9A 4M9XA 2LC2A 1OISA 1ZH5A 1C22A 3HJEA 3HGGA 2H94A 2V1UA 2RDPA 3BC8A 3TOAA 4LFUA 3LSPA 3O2PE 4B44A 2VC1A 4S2TP 5BNGA 3QPLA 2VQCA 3VODA 3GLLA 1R7JA 2KIFA 3SFZA 1FX7A 4UV8A 1T0FA 1ZELA 1TLHB 2EIKH 4M3DA 1HDDC 1FYMA 5HS7A 3PSIA 4S04A 1D8JA 4MO7A 1J09A 2W4SA 3D5SC 3S1RJ 3H5RA 1MBHA 2BH3A 4EJUA 3I59B 3RJPA 3DTIA 1WJAA 5H6RA 3PKCA 1S7EA 2ZC2A 1SFKA 3WG7H 2GA1A 1BR4A 2K85A 1W7PD 4ZYHA 4U6CA 2AQEA 2XAJA 2V3YA 5EEGA 1WLRA 3MKYB 2ZCWA 3OSFA 3BJOA 2Z2SB 3H3ZA 3NRVA 2Q2EA 2LDUA 3BR3A 1I3QJ 4ASNA 3ESWB 1REPC 2PFBA 4M3BA 4I7HA 5JI6A 3P7NA 4LIUA 1X1CA 4CYCB 5L3DA 4B3XA 4WK8F 1HDPA 3QP5A 3FXOA 1BR1A 3BTLA 2BE5F 2XKPA 5E1XA 5JHFA 2BHZA 4XLPF 1T0FC 5DCMA 4BQOA 2MD0A 2P9AA 3D5LA 2GIVA 1ZG3A 1G2HA 4E7JA 2K9SA 2KMUA 1LEBA 4KA4A 3CCRI 4YG2F 1ETVA 2FSWA 4P9FA 3OYBA 2OTJI 1B9NA 2F5VA 2IGMA 3SZGA 2QA4I 3JRBA 3HSRA 1D1CA 3BITA 3L09A 1R58A 3KCCA 4A0ZA 1G3TA 5E8GA 4XLCA 4XN3A 3Q9VA 1CGPA 1OCCH 1XB4A 3R61A 4EJWA 5DUKA 2HOSA 1S8NA 2MLKA 2CRGA 1H8AC 1MIJA 3A2KA 2QSHX 3E6MA 2BXYA 2LMDA 3G1OA 3FXQA 3CUQC 2ZFWA 3ZR8X 2R5ZA 1IC8A 1LFPA 1APLC 3G71I 2ZSIB 2UXNA 3E6CC 4BQAA 4G9YA 5D4SA 1H89C 2BWVA 2L4AA 1RR8C 3F8CA 1K83J 4B09A 2DJIA 3TO9A 4IKFA 3EUAA 1VZ0A 3WU2C 3DCFA 1PJRA 3F8NA 2K5CA 5ILUA 3BP8A 1R4MB 1C27A 2PN6A 4IJAA 1F43A 1DU6A 3S15J 2BWUA 5CJ9A 3KP6A 2CQQA 5F04A 2Y9YA 4HX7A 1OFCX 4UB6C 5TISC 5F6FA 2L01A 4A5MA 1V5EA 4JUQA 4TV7A 4S2RP 2W82A 1MH4A 2FBHA 2UUZA 3OIQA 4PFPA 2VE9A 2HQRA 1ETYA 2CW8A 5J8FA 2V1NA 3EUHC 1BOAA 4ENNA 1GT0C 3DKXA 4Q5SF 2DFHA 4KT5C 1BI1A 1LDKB 3KYCB 4RMNA 1FY7A 4UHTA 1FP2A 1YI2I 4F55A 2DA5A 1BC7C 3FZVA 1WHUA 1K78B 2EA2A 5HODA 2WY7Q 4U75A 5GTIC 3GEZA 1G3SA 1X1DA 1FSEA 2JN6A 3PQKA 1CQTA 1K6OA 2EINH 2O8XA 2ZMEB 2X1DA 1OCPA 4UVCA 2HR3A 3UR3C 4R60A 3CF2A 1GDTA 1BI3A 4YFNF 1N51A 3ZRGA 5L3EA 1C0WA 2IS4A 2MH9A 4KN4X 5JFRA 4NHJA 2IGNA 2E1MB 2DMUA 5DCMB 2XB0X 2Q93A 3QPTA 4QPQA 1FMVA 3CO6C 1QPMA 4ENKA 2NVTJ 2NVYJ 1PUFA 2NQ7A 5AIQA 2YS9A 4AC0A 1G3WA 3E6DA 4ZWPA 1MH3A 2LP0A 5F0FA 2L7FP 5H20A 2HDWA 5EYRA 3EQLF 4F7ZA 5CVIA 3BPXA 4O6JA 2Q2EB 3GWZA 4CO8A 3OOUA 5TRDA 1R23A 4RZYA 4CZZA 4NB5A 1VQPI 1WZ2A 4DYRA 2FEZA 2PMZN 3WODF 3JRIA 1IXCA 3GFLA 3RVAA 3G1LA 3I9V2 3JSOA 4F3QA 4L9TA 1DGRM 3I5UA 4RB0A 3BLYA 2VJIA 4Z2YA 4YRVA 1JKQC 3B6AA 2P8TA 5FKKA 1UJ8A 3IU9A 3OSGA 1NK3P 2OCEA 5DM6F 2BBYA 4KITB 4ENMA 1HQCA 2QGUA 3M8EA 5F27A 1QBJA 1W5CC 4ZTJA 5IYDJ 2DO7A 2QM3A 4BXFA 2STWA 3K2AA 1D5VA 3SXYA 3ONQA 3L2WA 4E7IA 2NAZA 2CO5A 4UVAA 5FROA 4I98B 2R5YB 1S29A 1HF0A 1IN7A 4D9JA 2O5RA 2NXNB 4D1QA 3CO7C 5CDEA 2DTZA 5LRRA 4U6ZA 1Y0NA 3BR1A 2QKMB 4AIKA 3P5JA 2E1CA 3CC4I 3IG4A 4U87A 5K5QA 1LPQA 4YELA 4HDVA 4ABZA 3K4KA 1TWCJ 2M0CA 4LGWA 1OR7C 2FMLA 1BW6A 1MMAA 1IXRC 2CH0A 5J1YA 5HOOA 3JRHA 2B0LA 3IL2A 3SZTA 3PFIA 3NEUA 3DQVC 4LB5A 4KISA 1Z3YA 3HRMA 1AOYA 3S1QJ 1IRXA 3BG6A 4HQEA 4GGGA 1KU7A 2J5OA 1W0TA 1R49A 1NG6A 1UG2A 2ZJ2A 3A03A 3ECOA 3DBLB 4BKXA 3G6EI 4BNCA 4KM3A 1MD0A 2A61A 1LKXA 4C3HJ 3AG4H 4P1WA 2OUMA 1I6HJ 5D5XB 4X0GA 2DT6A 2EQRA 1JKRC 4ZDOA 3HKZA 2CW0F 2MA3A 3JREA 4UY8I 2D1HA 4HEA2 5L3BA 4IHVA 3JRAA 1YVMA 3MATA 3DU5A 1SANA 1R5HA 2W57A 4DQ2A 1YTYA 3IC7A 4A2UA 2PBIA 1S3JA 1V4RA 4Y33A 3CZ6A 1MMDA 1YLFA 5GADJ 2RQQA 2A5YB 3TGNA 1O7FA 2KJCA 2WTEA 1I39A 5D4RA 5BQTA 5IP7J 2O61A 2HOAA 5CE6A 2JJ7A 4G7ZF 2Q0OA 3OL3A 3F8MA 3HOUJ 4RLQA 1JTYA 2TCTA 3CJRB 2GGBA 2EZLA 2IGKA 2RREA 4M6XA 1XX5A 2XSJC 4KIBA 2ESNA 3LMMA 1BBYA 2L54A 4L9NA 2EVCA 2IAIA 2BN7A 3H5NA 4FUKA 3D0SA 2BOLA 1X4OA 5JHUA 3ASNH 2CW7A 1GUUA 1RPWA 5CIKA 2VODA 5EGOA 4BXUA 5E3MA 1OPCA 3V4GA 2R0QC 1SD4A 5DD4A 4PK4A 1MSFC 2DPUA 1T08B 2Y0SN 5DUIA 1F4KA 4HZFA 1IW7F 1QQIA 3FM3A 4EGYA 4A3IJ 2YSRA 2P81A 2R7QA 2F5FA 1Z67A 4XNFA 5LHGA 3O8GA 4R8HA 1LE8A 1X3WB 1KP0A 1BM9A 2CQ7A 2UXXA 3FXLA 3KEQA 2LTPA 4ITVA 1QVTA 4JBAA 5CVRA 1A16A 5GPCA 3JW4A 1POGA 2HI3A 2HYFA 3T0YA 5FRNA 3WG9A 1HSJA 4U6WA 1VF9A 2ME0A 4NQWB 4KIFA 4IHSA 2HKXA 3WU1B 3K69A 1TWAJ 2ZXHA 2DQRA 2VONA 4DW6A 3FK6A 3NAUA 3DFGA 3PUBA 3FXUA 3V8JA 2HPMA 2ELJA 2PJPA 1Y1NA 2DQLA 2XF6A 4PJJA 2LSOA 2LY2A 3TEDA 4J00A 5LHIA 2BHCA 3N4MA 1EV7A 1YFHA 4D7NA 1O57A 1XG1A 5BOXA 2D2WA 4BBRJ 3R4KA 3GTPJ 3I54A 1WJEA 3M1EA 3DPTA 3KYLA 4EVIA 1HLVA 1U6GA 3O6BB 3OYGA 2FE3A 2EV6A 4WXDA 2DA2A 1W5SA 3CQZJ 2QBYB 2KIQA 3HHHA 2CV0A 1U5TA 1B1BA 2D1VA 3QWLA 3CCJI 3HKZN 2DI3A 5DD8A 1OMIA 3R0AA 2PJRB 1YX5A 3BQYA 1Z0XA 3PKEA 2EV5A 3NQOA 2DXIA 2XDVA 1R36A 4N9HA 2ZSGA 2EIMH 2I8DA 3MN2A 5M5XJ 3AG2H 1NHAA 2GG5A 3CD6I 1O3RA 3DP7A 3I64A 5M3MJ 3PJRA 4RB2C 4LG0A 4ZYDA 4LLNA 4IKRA 5D5WB 3CMAI 2LVSA 2HTSA 5BS6A 5L3CA 3F72A 3T8RA 4XLFA 3M9AA 4L9VA 5LBQA 2XAGA 2M4KA 2M3AA 4ZWUA 1MSEC 4WXCA 1XSVA 4BL0B 1VQOI 2B9SA 3J7YJ 3H0GJ 1VQ5I 1VI0A 3JTHA 5L3FA 2FNPA 4KICA 3L24A 2IA2A 2BZTA 4JYKA 1TQPA 3IP4B 1WH7A 3A02A 3MFKA 2NRAC 3J81K 1O3QA 1G6NA 2LH9A 2OPTA 2BVLA 3JAMZ 4XSZF 3BR0A 2VL8A 2LK2A 4KYWA 4L5EA 2W25A 2WA0A 3SYTA 4L18B 3TMOA 2Q95A 4Y7NJ 2HQ5A 3DWLE 4L9JA 3OYKA 3LA3A 3HUGA 3IH3A 1ZAOA 2YUSA 1Y1WJ 2V3ZA 2VLAA 2CFOA 3WHCA 3GTMJ 2P5VA 3L7GA 1VTNC 1H88C 2ELKA 1OKRA 1YRNB 1X1PA 3MZYA 4M71A 3DU6A 5CKTA 4II2A 1UCRA 5BPDA 4A5NA 1U3EM 3GZNB 1VQNI 1XMKA 2Z5UA 3BT9A 3E97A 4FLIA 2DOAA 3MMYB 1F9NA 2VI6A 2IS2A 3TDUC 1MBGA 2GXBA 4NDLA 1K4TA 1MBJA 1QU3A 2OC6A 2PMHA 4F93B 1BL0A 3Q0UA 1S9HA 1SC7A 3CUQB 3V8KA 2GLOA 2KZVA 3E7LA 2H1KA 3Q5FA 1OYIA 1IGNA 2Y69H 3CDLA 4XR6A 4OINF 2X6XA 2Y75A 3HB9A 3FIWA 3QOEA 2BXZA 1RUNA 4RS8A 4Z6YA 1QXYA 3GO5A 3BTIA 1PDNC 5J1RA 2K9LA 2N8GA 1X58A 4OIRF 2FA5A 1WBQA 2VPRA 3OYJA 1DQUA 2DOFA 2Y9ZA 2Q1ZB 4U6EA 4DGWB 3OYMA 2R7RA 1EF4A 2JUCA 2OQGA 2GOXB 4MTDA 2HFHA 2OF7A 3QU3A 3S2DJ 1IJWC 3GTQJ 2WAQA 3H5AA 2YX7A 4L0YB 4D7MA 5F0CA 4BHBA 2RKHA 2GXAA 2L9RA 1FYKA 1MNMC 1XGMA 5K5OA 2D45A 1TBXA 1E3HA 4PJ0C 1ZG1A 1QRYA 3IAM2 3OIPA 4U6JA 3WE2A 2JTVA 2XRLA 3SQNA 4IECA 4U69A 3S32A 2F2EA 1QHHD 2HPIA 2PQ8A 3LSHA 4RBOA 1HBXG 1A35A 1WN1A 2GTXA 1WPKA 2L7ZA 2F6CA 1KA8A 3LNQA 5M3FJ 2BW3A 1U9NA 2P5LC 2Z9OA 5GAHJ 2DPDA 1YOVB 1T6SA 2ZB9A 2MGQA 4H4KC 3HOZJ 4S01A 2R7SA 3QYEA 3H35A 2TDXA 3E5UA 1SVOA 5BMZA 3KP3A 4ESBA 2IS1A 3E6BA 3RORA 2ZXJA 4X1EA 1KQ0A 3RIRA 4HA8A 5AIPA 3CMMA 2F5DA 4UXNA 5KK1A 1R71A 3LSKA 1TQMA 3GX4X 2O3FA 3LA7A 4AYBN 3BR6A 1C24A 3DEWA 5J1UA 2LKXA 2V6EA 1NTCA 1QNTA 2ZJQF 1C23A 1SFUA 4W97A 4LOCA 4M72A 4Y15A 3EPZA 1AA7A 2XF5A 1O0XA 5CVUA 4HQMA 3DEUA 1Z1DA 4U0WA 3RDIA 5J8CA 3GFIA 1RI7A 4HG2A 4XBFA 3BR5A 3S17J 1TNTA 4KMUX 4RGZ1 1JKPC 1JKOC 4JOMA 1KYZA 1JT6A 1K79A 3MX6A 2TRTA 2K3FA 4GXOA 1YHQI 3S1NJ 4C9YA 2V9PA 1VQ7I 3GTJJ 3EUKL 2XGEA 2FOWA 1R6RA 5IT3A 4ZWOA 2L2OA 1B72B 5ICGA 1HKTA 1DDNA 5IPAA 4JK1X 1IN4A 3A4CA 1JHFA 2NYXA 1S72I 2G6PA 3MD2A 4JX4A 2DK5A 4IHTA 2QQ9A 2ZNYA 2JRMA 4CZCA 3N97A 5FGMA 2CG4A 2GU5A 3KEYA 4XLEA 4RAZA 2YU3A 3PSFA 2V1XA 4PUSA 5H2FC 3X2QH 3GCMA 2L3DA 2A68F 3GF2A 3WTTC 2DLLA 2L9VA 1MW7A 1VQ9I 1K6YA 2F5CA 1BC8C 1J9IA 4HW0A 2E2IJ 1K4SA 1SD5A 1V5GA 4DBRA 3QRFF 3MKLA 1CF7A 1TW2A 4ON0A 4RLFA 3GZ6A 3FBNB 1DUXC 3S1MJ 1IN8A 4HAMA 2NNYA 3OYEA 2CGPA 4LG3A 3ABKH 2OCCH 4XLHA 4Q47A 4I0BA 5FCFA 2DFIA 4QPOA 4U70A 2A3SA 3AL0B 5EJCA 2E34A 1WI9A 1ETXA 4GRIA 2IEKA 1M1EB 1HXDA 2CSOA 2K7LA 2KP6A 5D8LB 4LJZF
chains in the Genus database with same CATH topology
1P6RA 4U7DA 2P7CB 2ZNZA 3ZP5A 5FB2A 2DT5A 2ETHA 3ML6A 2GWRA 1MDMA 1XGNA 1E17A 3IWZA 1XDUA 2WV0A 2DTRA 1BIAA 3K1NA 1ON2A 1LEAA 2EVMA 2RQPA 3KP2A 2OD5A 4LB6B 5CYVA 1U8RA 2EFPA 4BHPA 2CQKA 1TTYA 3CTAA 2XAHA 2A07F 2VC0A 3GZ5A 5HLGA 5CLSA 4RB3C 1ZLKA 2RVCA 4OMZA 3FF5A 3ULQB 1PUEE 3CB5A 1I1GA 2NS0A 4I2OA 2HYGD 2CYYA 2XAFA 1J0RA 3FX3A 1DPRA 2XVCA 4G6DA 2QVOA 2OKNA 1BN5A 2L02A 1SMTA 5CVVA 2BWYA 4WWCA 2XKOA 2P99A 5IT9Z 1P4XA 4M74A 3QP6A 2GAUA 2ISYA 4PNCA 3F8BA 3IU8A 2ZBKA 3V8LA 4P55A 1XSXA 1YS7A 3BZ6A 1ZG5A 4FT8A 5LEKA 3FHZA 1IN5A 3RYRA 1R5GA 2E7XA 1QO0D 1EH6A 1I1SA 4U0VA 1ODDA 2V3XA 1TQIA 4KUMA 2YPRA 3C7JA 3CUOA 3P9IA 3RKWA 2V9VA 3HSFA 2HS5A 2IW2A 4MGRA 3ECHA 2JT1A 2IRFG 2H6CA 4EM2A 3TB5A 3W6JB 4M9SA 2UZKA 3V7RA 1Y0UA 4QLCU 2BWSA 3DV8A 3VFZA 1X3UA 1QXZA 4A6EA 3CDHA 4I09A 2BWTA 1O3SA 4RZZA 3ZQ7A 1D8KA 5BPIA 3EYYA 4LLLA 1W4MA 1KQ9A 2G7HA 2O0YA 3ABTA 3WGHA 3KETA 2FNAA 4FX0A 1LVAA 5E20A 2F5EA 3M8FA 5ICEA 1KQ8A 3T5XA 2XROA 3K2ZA 5E1ZB 5HLIA 4U0YA 3ELKA 4H0EA 5ICFA 5HLHA 2B3KA 2EA4A 2CWEA 2BWXA 1SAXA 1U78A 4YIIA 2VN2A 2EJRA 2XUBA 3TO6A 1PV9A 1LJ9A 1BI2A 4L0ZB 2KJBA 2Q8KA 1FWZA 2P7VB 1IRGA 4IKSA 3ZMUA 4D0PA 3CLOA 3HSEA 3DPLC 4MQVA 4PCQA 1J59A 3I71A 1P2FA 2OAZA 2EFQA 1MDMB 5DYMA 3I58A 1YJ3A 4ZZLA 3LAJA 2XIGA 2VT2A 5KVRA 4MATA 4XRFA 4MTEA 4BYYA 5FD6A 2VBWA 1Q1HA 1DPUA 1AWCA 2K4BA 2BYVE 1YW9A 1ZREA 2WC2A 1YG2A 3WTSC 3LWFA 5CVJA 3C1DA 3WTUC 4WCGA 4CYDA 4I01A 5HVQC 4ZNGA 2YX4A 4P5OA 1CF7B 2LF8A 3T1BA 3TOBA 1KU2A 3K1PA 4EJOA 4EJVA 2BV6A 5ICCA 4PDKA 1YW8A 4LLGF 5D5UB 2W84A 1CHMA 3MZHA 3IRRA 1SMYF 2COMA 4ZZDA 1UFMA 2NNNA 3T8TA 5JVTA 1FLIA 2JSCA 2R7FA 2HDCA 2M5WA 5E18F 3HIFA 1LDDA 3ISPA 1JGSA 3P9CA 3BPVA 1MATA 4M6YA 1ZRDA 2V1DA 3H3UA 4IU6A 4HDUA 1YQAA 3JSPA 2O03A 1QZZA 3LQRA 4CGZA 2IW5A 2EWNA 2ZMEA 1SFEA 1KU9A 3B73A 1F5TA 3BJ6A 1GXPA 2FBIA 4S05A 2O6GE 2XASA 2GG7A 1WY2A 1KYWA 2Z3YA 1ON1A 2IPQX 1XCBA 2AXLA 1W2MA 2W85A 3HTUA 3VB2A 3OOPA 3FMSA 1MZBA 4LK0F 4O3MA 5F64A 2BHAA 3GUDA 3F6OA 1MKMA 3FMRA 3GYHX 3DKWA 1UHWA 2MH2A 1FYLA 1ZHFA 2IP2A 4PGHA 3WTVC 3F3XA 4UV9A 4FLKA 1HW2A 4R1HA 2EK5A 3WE3A 1LDJA 2Q94A 1HW1A 3BY6A 3I53A 5FCHA 3K9TA 1IF1A 2RNJA 6PAXA 3MCZA 3JTGA 1IN6A 4OOKA 3F21A 1U5TC 3LQQA 4EM1A 1S7AA 1SFXA 4ZH4F 4HBLA 1P92A 5AONA 2GGCA 5CDLA 2EB7A 4WF2A 3PQJA 2KKOA 3ZPLA 4I02A 3WGIA 3MWMA 2BEOA 1U2WA 1FBQA 1G3YA 1B4AA 1PP7U 1R1UA 3LA2A 2MD5A 1J7KA 1SD7A 4WXHA 5FLXZ 3BWGA 4P96A 3E5XA 4B28A 4L5JA 2VBXA 5L3GA 1MGTA 2XGXA 4FO7A 3ABUA 2V6CA 1RNLA 1J5YA 3TAVA 4ESJA 1WRJA 4LG0B 3OV8A 3U1DA 2GZWA 3KEOA 1W7PB 3EUHA 4YFXF 1Z6RA 2IJLA 1I6XA 4BH9A 5FFXA 2GG3A 2QBYA 3DF8A 3ZMTA 3Q6DA 1HKSA 3KLNA 4ETSA 3I4PA 4HOBA 4RGSA 3MR1A 5LRSA 3AAFA 2HQNA 5A2QZ 3IHUA 1XSDA 2NQ6A 2MBFA 3BOQA 2EV0A 2VBZA 2GZ5A 2VOPA 2JPBA 1YYVA 1H9GA 1O7LA 3ZN0A 4KMFA 3CUQA 1SD6A 4S00A 4YFKF 2VXZA 3WTYC 2P5KA 2Y48A 4OIOF 2QYOA 4RAYA 1QXWA 2XRNA 2GU6A 4A12A 2STTA 2M45A 4CDGA 1FSHA 2RV8A 1BI0A 3CB6A 5DDGA 2QQAA 2HZTA 1USSA 5A2QK 2ISZA 1WL6A 2H09A 2W24A 4RGXA 4CICA 4KDPA 2GG8A 1IUYA 1JHHA 2M8EA 3L2CA 1XD7A 2GU7A 4U71A 3JAMK 2M30A 3S6BA 5D8KB 2OQRA 1K7AA 4ENJA 2H27A 2GG0A 4IF7A 4IVNA 5EEHA 4ESFA 4MQ9F 3EDPA 2RGVA 4OIPF 5HDKA 3U2RA 5E1WA 2BHBA 1OYYA 3GXOA 2HEOA 3LSTA 5LHHA 2A69F 5J6XA 4IRIA 2FU4A 1M35A 4GO1A 3ZMSA 3WTXC 4PZJA 1WSUA 1U5TB 4QR8A 3V7SA 2KIUA 1FP1D 3L00A 3TKYA 4Y17A 2LF7A 3KE2A 3KZZA 1H9TA 3GFMA 2DK8A 5DV5A 4A0XA 4G7OF 2QZ8A 2FBKA 1FT9A 1F1ZA 2M1BA 3VOEA 3PKBA 2V79A 1YW7A 2Q96A 4XSXF 1ZN2A 2EFNA 4JQFA 4EQQA 2DAOA 2GG9A 4NQWA 3GW2A 4XLNF 1BIBA 3PKAA 3BJAA 5H6QA 2LNBA 3MAJA 4WX9A 2EVOA 2HGCA 3EETA 3DXJF 3QOPA 3J7AO 3D27A 1Z9CA 2GXGA 4CHUA 5JR3A 3LAPA 3RPUA 4MNUA 1YO5C 4EMSA 4IPAA 2EFWA 3ZMDA 2IT0A 2VOOA 4PV4A 2Y0MA 5D6FA 1WQ2A 1MJAA 1FPQA 2IVMA 2OZ6A 1ZRCA 5CDVA 1ULYA 2J5PA 3S2WA 1T2KA 3ZMZA 4P9UA 4Q48A 4BHCA 1EH7A 2ZO4A 4MEYF 1ZLJA 1IZ1A 1XN7A 1STZA 5HS8A 2AS5F 4FX4A 3E5QA 4OIQF 4UNOA 4EGZA 1GXQA 2HOEA 2A6EF 1T98A 4HLXA 4K2EA 3IKVA 4EJTA 1ZGJA 4HF0A 1L0OC 4U76A 3C3WA 2DBBA 1YIOA 1IXSB 1ONVA 2QENA 1EH8A 3RI4A 1Z05A 5DCFA 4EM0B 4G8XA 3E3VA 1QGPA 1MJ9A 3ZN1A 2ELHA 1RIOH 5FLXK 1FNNA 1PP8F 5FFZA 4EGEA 1Z7UA 2M87A 1WWXA 1OYWA 1JE8A 2H6BA 4IDYA 3TO7A 5D5VB 4N0BA 4BAYA 3ROUA 1LQ1A 3R60A 2BB7A 2GQQA 1WKMA 1T38A 1HW5A 4G94A 2QWWA 3IWFA 4HF1A 1YS6A 2X0LA 2C6YA 3FWEA 1XMAA 4IRGA 2PG4A 5HS9A 2OZUA 3IKTA 5K1YA 3SHFA 4U7BA 3KP4A 1J2XA 1UHMA 2P98A 4B8XA 5ILVA 1G4DA 3R0JA 2QQBA 3WTZA 2XV4S 3CTZA 2P4WA 2VT3A 3MEXA 2KRFA 3ERED 2E7WA 2QLZA 3HRTA 4G6QA 1S7OA 2GU4A 3F23A 5TJJA 1OR7A 4I0AA 2HKOA 1I5ZA 4YIFA 4LK1F 3GVAA 1K78A 4Y13A 3J80K 2FOKA 3F22A 1Z91A 2CFXA 3KP7A 1FOKA 2K27A 2KIMA 2ZKZA 5ILSA 4EV0A 2DW4A 2HOWA 1UB9A 2MATA 2OA4A 4N9IA 1R22A 5LEJA 4UVBA 3J81Z 4IRHA 1MJBA 4RB1A 3F6VA 1XGOA 2HTJA 4Q4ZF 4GYGA 2PI0A 1H0MA 3J80Z 2IA0A 3K1MA 1L3LA 4MHGA 4A6VA 2R7DA 3H92A 3MQ0A 2LKPA 3KP5A 2X4HA 3WTWC 3RKXA 5LGTA 1ZRFA 4HYEA 2UWMA 5HDNA 4GCVA 4R79A 2FMYA 4FHTA 3HTSB 4KNYA 3FM5A 2K02A 4KFCA 3HRSA 1E2XA 3R6SA 3HHGA 1IAWA 1JAWA 5E5BA 2JPCA 3BIQA 5D6EA 5FD5A 1RZ4A 1JXSA 1KU3A 2RN7A 4L5IA 1RUOA 2R3SA 4U1BA 5K5RA 4HX8A 3LFKA 4HV6A 5E17F 1B6AA 2K86A 3VEPA 3BIPA 1R00A 3QU6A 4U88A 1ZARA 2OU2A 3HOSA 4RGUA 2G9WA 1P4AA 3C18A 3WGGA 5HDGA 2GA2A 1TW3A 3I59A 3REOA 4M9ZA 4O5VA 4LD5A 1A04A 2B3LA 1I27A 3HRUA 1J75A 2ESHA 3L7WA 3K0LA 4LMYA 4ZYGA 5ED4A 1QZYA 3RTRA 2VE8A 3QAHA 5LGUA 2BGCA 4QWQA 5LGNA 2A6HF 4U73A 1Z6TA 1XDSA 2JZYA 1LNWA 3RKYA 4A6WA 2XAQA 4FLJA 4AIJA 1TNSA 4RGRA 2VBYA 4FLLA 4AVPA 2G7UA 1S6LA 4A6DA 4IKUA 3SZPA 3M7GA 4PGGA 5DEQA 1ZYRF 3CJNA 4FO8A 4UUVA 2FXAA 1KGSA 4IKTA 4OOIA 1R1VA 3ZMVA 3GFJA 1GVJA 4IF4A 1LB2A 1BJAA 5LLQA 3HYIA 4HF2A 1V3FA 4E70A 3HOTA 3EYIA 2PEXA 3KZYA 1P4WA 1IRFA 2FF4A 4KN7X 3L9FA 3W6KB 2PLYA 1W5TA 2MC3A 2RC4A 2P6SA 3TDZC 3WU0A 4A0YA 3G73A 4HLYA 1HKQA 5CNXA 2EFOA 2GG2A 1O3TA 2B3HA 2IA1A 2K4JA 2ADUA 1GHCA 2ACJA 2BWWA 3P9KA 2PMUA 4HV5A 2E1NA 3FMQA 3F8FA 4AIHA 2Z99A 4OU0A 2XHKA 2MLGA 3KFWX 1D3YA 1R1TA 5FO5A 3O3KA 4HX4A 4Z7MA 4IXAA 1B59A 2L4MA 3I0TA 3RPQA 2P6TA 4G7HF 3FXRA 3G3ZA 3Q9SA 4HXXA 2Z33A 3IRQA 2YR2A 1ZGAA 3GLXA 4M73A 4ZYEA 4AD9A 1HSTA 3V7CA 3IU7A 4GYIA 1C21A 3U9GA 4AWXB 5IT9K 5E8IA 3TQNA 3QPHA 2BHDA 1XGSA 1B9MA 2QUFA 1T39A 1USTA 1W7VA 2JRTA 3RYPA 4CXFA 2WWYA 5ERIA 1FC3A 1W7PA 3PKDA 1DP7P 3BROA 1FZPB 2FRHA 3COAC 3KLOA 3B02A 3BDDA 4MEXF 1FBUA 2HWVA 4KIGA 1XNZA 1XCVA 1WL9A 4FKCA 2Q92A 1FBSA 4DNCA 2OBPA 2FQ3A 4OMYA 5F1RA 1ZH5A 2DU9A 4M9XA 1C22A 2H94A 2V1UA 2RDPA 3TOAA 4LFUA 3O2PE 2VC1A 4S2TP 3VODA 1R7JA 2KIFA 3SFZA 1FX7A 4UV8A 1T0FA 1TLHB 1FYMA 5HS7A 4S04A 1D8JA 2BH3A 4EJUA 3I59B 3RJPA 5H6RA 3PKCA 2GA1A 1W7PD 4ZYHA 2XAJA 2V3YA 5EEGA 1WLRA 2ZCWA 3BJOA 3H3ZA 3NRVA 2Q2EA 2LDUA 4ASNA 1REPC 2PFBA 4I7HA 5JI6A 3P7NA 5L3DA 4WK8F 3QP5A 2BE5F 2XKPA 5E1XA 4XLPF 5DCMA 2P9AA 2GIVA 3D5LA 1ZG3A 1LEBA 4KA4A 4YG2F 4P9FA 2FSWA 1B9NA 3HSRA 3BITA 3L09A 1R58A 3KCCA 4A0ZA 1G3TA 5E8GA 3Q9VA 1CGPA 1XB4A 3R61A 4EJWA 5DUKA 1S8NA 2MLKA 3E6MA 3CUQC 3FXQA 2ZFWA 2UXNA 3E6CC 4BQAA 4G9YA 5D4SA 2BWVA 2L4AA 3F8CA 4B09A 3TO9A 3F8NA 5ILUA 3BP8A 1C27A 2PN6A 4IJAA 2BWUA 5CJ9A 3KP6A 4HX7A 5F6FA 2L01A 4A5MA 4JUQA 4TV7A 4S2RP 2FBHA 2VE9A 2HQRA 5J8FA 1BOAA 4ENNA 4Q5SF 4KT5C 1BI1A 1LDKB 1FY7A 4UHTA 1FP2A 1BC7C 3FZVA 1K78B 2EA2A 4U75A 3GEZA 1G3SA 1FSEA 3PQKA 1K6OA 2O8XA 2ZMEB 4UVCA 2HR3A 4R60A 1BI3A 4YFNF 1N51A 5L3EA 1C0WA 2MH9A 4KN4X 5JFRA 4NHJA 5DCMB 2Q93A 3QPTA 3CO6C 1QPMA 4ENKA 2NQ7A 5AIQA 1G3WA 3E6DA 4ZWPA 5H20A 3EQLF 4F7ZA 5CVIA 3BPXA 4O6JA 3GWZA 4CO8A 5TRDA 1R23A 4RZYA 4CZZA 4NB5A 2FEZA 3WODF 1IXCA 3GFLA 3RVAA 3JSOA 4L9TA 3I5UA 4RB0A 4Z2YA 2P8TA 3IU9A 2BBYA 4ENMA 1HQCA 3M8EA 1QBJA 2DO7A 2QM3A 2STWA 1D5VA 3SXYA 2NAZA 2CO5A 4UVAA 4I98B 1S29A 1IN7A 3CO7C 5CDEA 5LRRA 4U6ZA 4AIKA 2E1CA 3IG4A 5K5QA 4HDVA 4LGWA 2FMLA 4U6CA 1IXRC 5HOOA 2B0LA 3IL2A 3SZTA 3PFIA 3NEUA 3DQVC 4LB5A 1AOYA 3HRMA 4HQEA 4GGGA 1KU7A 2J5OA 2ZJ2A 3ECOA 4BNCA 4KM3A 1MD0A 2A61A 5D5XB 2CW0F 2MA3A 2D1HA 5L3BA 1YVMA 3MATA 4DQ2A 1YTYA 1R5HA 2W57A 3IC7A 4A2UA 2PBIA 1S3JA 1V4RA 1YLFA 2A5YB 3TGNA 1O7FA 2KJCA 2WTEA 5D4RA 5BQTA 2O61A 5CE6A 4G7ZF 2Q0OA 3F8MA 2GGBA 4M6XA 4KIBA 2ESNA 1BBYA 2L54A 4L9NA 2EVCA 2BN7A 4FUKA 3D0SA 5JHUA 5CIKA 2VODA 4BXUA 1OPCA 3V4GA 1SD4A 5DD4A 2DPUA 5DUIA 1F4KA 4HZFA 1IW7F 1QQIA 3FM3A 4EGYA 2YSRA 2F5FA 5LHGA 4R8HA 1KP0A 1BM9A 2UXXA 3KEQA 4JBAA 5CVRA 1A16A 3JW4A 2HYFA 3T0YA 3WG9A 1HSJA 4U6WA 4IHSA 4KIFA 2HKXA 3WU1B 3K69A 2DQRA 2VONA 3DFGA 3FXUA 3V8JA 2PJPA 1Y1NA 2DQLA 2LSOA 5LHIA 2BHCA 3N4MA 1EV7A 1YFHA 1O57A 5BOXA 2D2WA 3R4KA 3I54A 3M1EA 3DPTA 4EVIA 1U6GA 3O6BB 2FE3A 2EV6A 4WXDA 1W5SA 2QBYB 3HHHA 1U5TA 1B1BA 2D1VA 2DI3A 5DD8A 1OMIA 3R0AA 3PKEA 2EV5A 3NQOA 1R36A 4N9HA 2ZSGA 2GG5A 1NHAA 1O3RA 3DP7A 3I64A 4RB2C 4LG0A 4ZYDA 4LLNA 4IKRA 5D5WB 2HTSA 5BS6A 5L3CA 3F72A 3T8RA 3M9AA 4L9VA 5LBQA 2XAGA 4ZWUA 4WXCA 1XSVA 3JTHA 5L3FA 2FNPA 4KICA 3L24A 2IA2A 1TQPA 3MFKA 2NRAC 3J81K 1O3QA 1G6NA 3JAMZ 4XSZF 4KYWA 2W25A 4L18B 2Q95A 4L9JA 3LA3A 3HUGA 1ZAOA 2V3ZA 2P5VA 3L7GA 1VTNC 1OKRA 3MZYA 4M71A 1UCRA 5BPDA 4A5NA 1U3EM 1XMKA 2Z5UA 3E97A 4FLIA 1F9NA 3TDUC 2GXBA 2PMHA 3CUQB 3V8KA 3Q5FA 1OYIA 4OINF 2Y75A 1RUNA 4RS8A 1QXYA 3GO5A 1PDNC 4OIRF 1WBQA 2FA5A 4U6EA 2OQGA 4MTDA 2HFHA 3QU3A 4L0YB 2YX7A 4BHBA 2RKHA 1FYKA 1XGMA 5K5OA 2D45A 1TBXA 1ZG1A 4U6JA 3WE2A 2JTVA 3SQNA 4IECA 4U69A 2F2EA 1HBXG 2PQ8A 1WN1A 2GTXA 1KA8A 2P5LC 2Z9OA 2DPDA 1T6SA 4S01A 2TDXA 3E5UA 5BMZA 3KP3A 4ESBA 3E6BA 3RORA 2ZXJA 1KQ0A 3RIRA 4HA8A 5AIPA 2F5DA 4UXNA 5KK1A 1TQMA 3GX4X 2O3FA 3LA7A 1C24A 1QNTA 1C23A 1SFUA 4M72A 4Y15A 1O0XA 5CVUA 4HQMA 3DEUA 1Z1DA 4U0WA 3RDIA 5J8CA 3GFIA 1RI7A 4XBFA 1TNTA 4KMUX 4RGZ1 1KYZA 1K79A 3MX6A 4GXOA 5IT3A 4ZWOA 5ICGA 1HKTA 1DDNA 4JK1X 1IN4A 1JHFA 2NYXA 2G6PA 2DK5A 4IHTA 2QQ9A 2ZNYA 3N97A 5FGMA 2CG4A 2GU5A 4RAZA 2YU3A 2V1XA 2L3DA 2A68F 3GF2A 3WTTC 2DLLA 2F5CA 1BC8C 1J9IA 4HW0A 1SD5A 1CF7A 3QRFF 1TW2A 4ON0A 3GZ6A 1DUXC 1IN8A 4HAMA 2NNYA 2CGPA 4Q47A 4I0BA 5FCFA 2DFIA 4U70A 2A3SA 1WI9A 1HXDA