1XGMA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Aminopeptidase
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgmA01
2CYYA 5L3BA 1YVMA 2A5YB 5F6FA 1R22A 2H09A 5ILVA 1ZG5A 3S2WA 2K86A 4Z7MA 5DUKA 3HRUA 5E18F 4FX4A 5DEQA 1P92A 3CUQA 2P98A 1G3SA 4HF2A 4RB1A 1IF1A 4LMYA 4RAYA 1WY2A 3GZ5A 1TLHB 2VOPA 4U6EA 1J0RA 4U6WA 2Q2EA 5KVRA 2EV5A 3WTUC 4RZZA 2XASA 3IHUA 3LA7A 4HV5A 1SFEA 2UXNA 2BYVE 2HKOA 3CLOA 5HLGA 2L01A 5JFRA 1HSJA 3F21A 3H92A 2V3ZA 2K27A 1YS6A 1P6RA 4H0EA 4IHSA 1XSDA 1F1ZA 4GXOA 3F3XA 4UNOA 3I0TA 3BROA 4UVBA 1YO5C 3MR1A 3COAC 2YX4A 5FCHA 2DW4A 4MTDA 4L9NA 1FC3A 4PNCA 5FD5A 3EETA 5L3GA 2F2EA 1HQCA 2JZYA 1MDMB 2OA4A 4AVPA 2E1NA 2GZWA 2ZMEA 1PUEE 1SAXA 4ZZLA 3CO6C 4ENMA 2RKHA 1N51A 3ULQB 1USSA 3KZZA 2XAHA 4LJZF 2J5OA 3TOBA 1ULYA 1QXYA 2QUFA 2RQPA 2M5WA 3T8RA 1KQ0A 2C6YA 3Q9SA 1B6AA 3TO6A 5LLQA 2EA2A 1WL9A 2QBYB 2EFOA 4MQVA 2EWNA 4IKRA 1XGMA 4PGHA 1IN7A 3TB5A 2E1CA 3LQRA 5FFZA 2Q0OA 2W25A 3C3WA 2LF7A 3V8LA 3WE2A 3I71A 3HTUA 5D5XB 4M6YA 3JTHA 4UVAA 2DAOA 2RVCA 3J80Z 1R1UA 5H6RA 1DUXC 4HA8A 1DDNA 2GA1A 3FF5A 1KQ9A 4M73A 3IRRA 3BY6A 2DI3A 3L00A 4MATA 3WTTC 2Z5UA 1LDJA 1ZLKA 4ZZDA 4HXXA 4YFXF 1WKMA 1XDUA 4EGYA 2VOOA 5CVUA 4A2UA 1UCRA 1BI1A 1FX7A 4FO7A 1QGPA 5AIPA 5ICCA 3WU0A 3K69A 1X3UA 4GGGA 3HIFA 2KKOA 2MA3A 2H6CA 2DT5A 2K7LA 1CGPA 4YFNF 3IWZA 2O6GE 2KJCA 4B28A 4HV6A 1HW2A 2FBIA 1G4DA 2GXBA 3N4MA 2OQRA 2DLLA 2Z33A 5ICFA 1TTYA 3KP6A 3GLXA 4DQ2A 1R1TA 1SD6A 2WV0A 3PFIA 4WK8F 3DXJF 4UHTA 1XCBA 1MJBA 1Z9CA 3MFKA 1QBJA 5DCMA 1UHWA 3DPTA 1R00A 1IZ1A 3JSPA 4S2RP 3BPXA 3HTSB 2HEOA 2ACJA 1BI2A 3QP6A 3WU1B 1YTYA 4IXAA 1W7VA 4OU0A 1K79A 1JHFA 4KDPA 3KE2A 5CNXA 1ZGAA 5A2QZ 3LA3A 3ZN0A 1EV7A 3PKBA 4R60A 4ENNA 3F8CA 1T98A 4HBLA 3EDPA 5HVQC 2QLZA 2EVCA 2EV0A 1HKQA 2CGPA 1EH6A 4A5NA 3IKVA 1WSUA 5ILUA 4S05A 1ZG3A 4IPAA 4MEXF 4U69A 1S7OA 2QM3A 4ZWUA 1JGSA 2OD5A 2VXZA 2FSWA 3N97A 1FWZA 2K02A 1XD7A 2FOKA 5J8FA 3RTRA 2XIGA 4RAZA 1RIOH 5FLXK 1ZRCA 2G7UA 4RGRA 4YIFA 1YIOA 3G73A 1O0XA 5L3FA 5CYVA 1I6XA 4P5OA 1J59A 3QU3A 2VC1A 5D4RA 4G7ZF 5D5WB 5D8KB 4JBAA 5DCFA 4LK1F 4M72A 2A07F 4L18B 3I54A 4A0ZA 1O7FA 3MWMA 4BHBA 1HW5A 2GGCA 3FXQA 1EH8A 5AONA 3ZQ7A 2IP2A 3DFGA 4G7HF 2RC4A 3H3ZA 2ETHA 5FCFA 1S3JA 1OPCA 2BHCA 5JR3A 2MLKA 4UV8A 3V4GA 5CDVA 2HQNA 3M7GA 3L09A 2JRTA 1F5TA 1BBYA 4JQFA 3CTAA 5ERIA 1DPUA 5BQTA 2FMYA 4ZH4F 2ZJ2A 1FP1D 3RDIA 1ONVA 4CHUA 4UV9A 2P9AA 3TO7A 4EMSA 3GVAA 1XB4A 2OBPA 4RB0A 3I59B 1WI9A 4KUMA 2DK5A 3KP7A 4RB3C 1R7JA 3GFLA 2D1HA 1KU3A 2GG0A 3M9AA 2GU4A 1UHMA 2HS5A 1WRJA 2KRFA 3K2ZA 1IUYA 4IJAA 3BIPA 3NQOA 2XKPA 1ZHFA 1SD4A 2ESHA 2QENA 1Q1HA 1ZN2A 1GVJA 1HKSA 2X0LA 1XGNA 6PAXA 2PJPA 3GZ6A 4IKTA 3T1BA 2VBXA 2B3LA 4GO1A 2A6HF 4U7BA 1RUNA 3AAFA 3RVAA 4RGSA 1ZAOA 1ZGJA 1ZRFA 4A0XA 5K5QA 3PKDA 2QQ9A 3SFZA 1S7AA 5HDKA 5LRSA 2IW2A 2EFPA 1MATA 2HWVA 3MZHA 1ZG1A 1W5SA 2GXGA 4U76A 3GFIA 2A69F 5JHUA 3CUQB 3RYRA 4LLNA 1HSTA 2CO5A 3E5QA 3PKCA 3K1MA 1PP8F 2EFNA 2Q92A 3LA2A 1KU7A 2HDCA 3RPQA 5J6XA 3IWFA 3F6OA 2UXXA 1F4KA 4EJVA 2STTA 1KQ8A 5LEKA 3GFJA 4G94A 3CB6A 4N9IA 2IRFG 1E2XA 3TAVA 3C18A 1B9MA 2BBYA 1C27A 2VE9A 4HX4A 5DV5A 4AD9A 2BGCA 3L7GA 4LLGF 1MGTA 4BXUA 2GG8A 2HGCA 3F8MA 3KFWX 3J80K 3HOTA 3ECHA 4WF2A 1BJAA 4L9JA 2CQKA 2CWEA 4U0WA 2P7VB 3K0LA 4ZWPA 5CE6A 4LG0A 2YPRA 1JHHA 3CTZA 3E6DA 5HLHA 1WL6A 1XCVA 3NEUA 1IXCA 1OMIA 4P9UA 1RI7A 1Z6TA 2H27A 2EJRA 3DEUA 2GG9A 3IRQA 5K5RA 2HR3A 4M74A 2ISZA 4RS8A 4A6DA 2GG5A 2PMHA 2XROA 1FNNA 3GWZA 2Y0MA 4BQAA 3PKEA 2VN2A 2PG4A 1U2WA 1XMKA 5HDGA 2PMUA 1Z6RA 3MATA 2KJBA 3P7NA 3VB2A 3Q6DA 1T0FA 1U6GA 3ABUA 1FP2A 3EYYA 2M8EA 5CVIA 1Y1NA 4IU6A 3CJNA 4OIPF 1IW7F 1W7PA 3I53A 3R4KA 1OR7A 2G7HA 2UWMA 5E5BA 5E8IA 2L4MA 1JE8A 3BJOA 4Q4ZF 2RV8A 4BAYA 2TDXA 5DDGA 3V8JA 3GXOA 2KIUA 2Z9OA 2F5EA 5DD8A 5CVRA 4F7ZA 5HS8A 2Z3YA 5L3DA 4I0AA 1YFHA 1KYWA 5FD6A 4FX0A 4IRGA 5D6FA 1QZYA 2V1UA 2NQ7A 2IA1A 1J9IA 2R7DA 4BH9A 5LHGA 4G8XA 3VODA 1Z91A 3D0SA 5A2QK 1IXSB 3C7JA 1O7LA 1XDSA 3CDHA 1U5TB 3FM3A 3GX4X 2AS5F 3GF2A 1TNSA 1WN1A 1L0OC 3NRVA 4OMZA 4OOKA 4Q47A 4FLLA 2RNJA 3WGIA 3WG9A 2O03A 3BJ6A 1K6OA 1YW9A 1FSHA 3LSTA 5KK1A 1FT9A 1C0WA 3E5XA 4I01A 2GWRA 3GYHX 4XSXF 2JPCA 1REPC 3FXUA 1WBQA 5DCMB 1OYWA 1W5TA 3HSEA 2IW5A 3P9KA 1T38A 2XUBA 2BHAA 2GZ5A 1S29A 4JK1X 2EVMA 4I02A 5BOXA 4GCVA 1O3QA 3KP2A 2GU7A 3BDDA 3F23A 3DV8A 2BV6A 2XV4S 3TDZC 3KEOA 2GQQA 5E8GA 3KCCA 2DQRA 3O6BB 1XGOA 1BN5A 2GIVA 4KICA 5LGTA 1XN7A 4PGGA 2YSRA 1FBQA 3ERED 4QWQA 3P9CA 4KT5C 3FMQA 1DP7P 1O3TA 4HLXA 3FHZA 2A68F 1R1VA 3BJAA 1RZ4A 2DPDA 3F6VA 3FZVA 3V7SA 1LDKB 3LFKA 3WGGA 3RI4A 2VT3A 5DD4A 4KMFA 1JXSA 3FXRA 2PN6A 1YW7A 4A6EA 2O3FA 5E17F 1V4RA 3SXYA 4ESJA 2O8XA 1K78B 2OKNA 1W7PD 4KA4A 3IU9A 2DTRA 1Z7UA 1SMTA 1TNTA 2RN7A 3K9TA 1WQ2A 4EGZA 2V3XA 1ON1A 2G9WA 2L54A 4O6JA 1A04A 2HYGD 4LB5A 5ILSA 2DU9A 1MDMA 3E6MA 3SHFA 4EVIA 3IU8A 4FT8A 3ECOA 3WGHA 2Q94A 2ESNA 2G6PA 2NYXA 1IRGA 1CF7A 1QZZA 3GO5A 2VC0A 5F64A 1GXPA 2LF8A 3L24A 4N0BA 5LGUA 4QR8A 1J7KA 4JUQA 1R58A 3E6BA 3RPUA 3LAPA 1T6SA 5F1RA 3WTWC 2VONA 4EM0B 2GG3A 2EB7A 2QBYA 2DO7A 4MEYF 4N9HA 4Y15A 2MC3A 5TRDA 1OYYA 2P8TA 1QQIA 2KIFA 3IL2A 4R79A 5IT9Z 3ROUA 4KIBA 2OZ6A 3H3UA 1D8KA 1BM9A 5EEHA 2DBBA 4EV0A 1O3SA 3HRMA 4CICA 4S2TP 4E70A 1LQ1A 3HRSA 1A16A 1H9GA 3I5UA 2GA2A 4LLLA 5FB2A 1IAWA 4EJWA 4IRIA 1P4WA 3GUDA 4YFKF 2MLGA 2XAGA 3HOSA 1Y0UA 4MHGA 3WTVC 4AWXB 4P55A 2F5FA 2ZNYA 3GW2A 2Q8KA 3WTZA 4OIRF 4PV4A 2D2WA 4NQWA 2VBZA 3LWFA 3TGNA 2CSOA 1XGSA 4PDKA 1LVAA 3R6SA 1P4AA 4ZNGA 2PBIA 1FBSA 2O61A 2OZUA 1STZA 4HX8A 5LEJA 4XSZF 1ZLJA 4L9VA 3WE3A 3VFZA 5LHHA 1KP0A 3QPHA 5BPIA 2OAZA 3RJPA 1V3FA 1S6LA 4HF0A 1D3YA 2EFQA 2BWSA 5CIKA 4O5VA 1U3EM 2RDPA 1O57A 2B0LA 4KM3A 2P5VA 2XGXA 1OKRA 3W6JB 3U2RA 4KN4X 4LFUA 3E5UA 5CDLA 3KEQA 3M1EA 4ESBA 4Q5SF 2FA5A 2BHDA 2EK5A 2YR2A 1MD0A 2QWWA 3FMSA 4U71A 4L9TA 2ELHA 4DNCA 3OV8A 2FRHA 5HLIA 3SQNA 3ZN1A 4WCGA 4OIQF 5HDNA 3Q5FA 4R1HA 2OQGA 3ZMSA 1Z1DA 2L02A 5H20A 3WTYC 4XLNF 1J5YA 3HYIA 4WXDA 2HTJA 1M35A 3V8KA 2BWYA 5LGNA 1LJ9A 3BZ6A 2FBHA 4KFCA 2BN7A 3HUGA 2HFHA 4M71A 4B09A 4GYIA 4ENJA 1I1SA 1ZARA 4O3MA 1SFUA 3L7WA 2M87A 2L4AA 3IU7A 1PP7U 1BI3A 4I7HA 1E17A 4OINF 2BHBA 1R5GA 2W24A 4CDGA 5BPDA 1C21A 3B73A 3EQLF 2P5LC 4ON0A 2IVMA 1IRFA 4BHPA 5L3CA 4KMUX 2V3YA 5D6EA 4A0YA 1C22A 2YU3A 3W6KB 1KGSA 3U9GA 4G6QA 3SZPA 4HAMA 3TO9A 1C24A 2PLYA 1KU9A 1YQAA 4HLYA 2XVCA 4FHTA 2A3SA 2BEOA 4M9XA 2W84A 3L9FA 2HYFA 1MZBA 4XLPF 1PDNC 2MBFA 3WODF 1C23A 2FEZA 4HX7A 2P6TA 1YYVA 3LQQA 5BMZA 3R0JA 3E3VA 1IXRC 2XRNA 2V1DA 2XAQA 3JSOA 3PKAA 3REOA 1FOKA 3MQ0A 4U6JA 1KA8A 4CGZA 3RORA 5BS6A 4XRFA 1JAWA 3O2PE 2NRAC 1XMAA 4OMYA 1BC8C 3M8EA 1TQIA 2VE8A 4LB6B 5LBQA 3QP5A 3R60A 4HOBA 4FLKA 3QRFF 3HSFA 2LSOA 1LB2A 2FU4A 4HW0A 2HOWA 4S01A 2ZMEB 3KP4A 1DPRA 4PCQA 2H94A 2K4JA 1IN4A 5LRRA 4PZJA 2XAFA 2ZXJA 2QZ8A 2FE3A 4I98B 1LEAA 3KP5A 1XSXA 2NNNA 2XKOA 2Q96A 4M9ZA 5DYMA 4M9SA 2AXLA 1FYLA 4U7DA 5ED4A 2GGBA 1T2KA 1LDDA 5CLSA 1TW2A 2P6SA 1FLIA 1BIAA 1AOYA 2WWYA 4FUKA 4CO8A 4KIFA 3RKWA 1RUOA 1LNWA 1HW1A 3MZYA 2PFBA 2NQ6A 3VEPA 4R8HA 2W57A 3F22A 2JT1A 2BWTA 3CUOA 1YS7A 3V7RA 4LGWA 2ZBKA 4IECA 4MGRA 2IA0A 5HS7A 1KU2A 4G9YA 4K2EA 4G6DA 2HKXA 4RGUA 5IT9K 4U6CA 2QQBA 2BWXA 3SZTA 2V6CA 3FWEA 2BE5F 3HRTA 4U1BA 1J75A 4ZYDA 3F8BA 3GFMA 3WTXC 4ZYEA 4OIOF 5HOOA 3HSRA 5D5VB 4EM1A 1HXDA 4YIIA 1GHCA 2F5CA 3B02A 1MJAA 3R61A 3JAMZ 4AIKA 2D45A 2K4BA 3RKYA 3MAJA 2M30A 3T0YA 4B8XA 4GYGA 1CF7B 3CO7C 1S8NA 3J81Z 5FGMA 2FNPA 4P96A 3KZYA 3IC7A 2H6BA 1XSVA 1W4MA 5TJJA 3E97A 4EM2A 2L3DA 2WTEA 1FYKA 4HQMA 2EFWA 1FYMA 2GG7A 1J2XA 2DPUA 4M6XA 2YX7A 1FBUA 2Z99A 5E1WA 3ZPLA 3CUQC 2QVOA 2DQLA 4S04A 1K7AA 1R36A 2R7FA 2GTXA 4RGZ1 4L5JA 1USTA 2BH3A 3QOPA 4AIJA 2V1XA 4Q48A 5J8CA 1MJ9A 1XNZA 1B4AA 1B9NA 1FSEA 5FFXA 4HDVA 4ZYHA 3JTGA 4U0VA 3IKTA 2JTVA 1R5HA 2QQAA 1HKTA 4HDUA 1CHMA 1BIBA 2VBWA 4RZYA 5E1ZB 4XBFA 3F72A 2BWVA 4MNUA 2ZFWA 3ZP5A 2MATA 4IVNA 3ML6A 2CG4A 3RKXA 1H9TA 2FBKA 3D27A 2EVOA 4BNCA 2RGVA 1H0MA 1U5TA 2VT2A 3ISPA 4LK0F 3TOAA 4ASNA 5CJ9A 2MH9A 3HHHA 2W85A 4IDYA 2JSCA 3JW4A 2QYOA 4Y13A 1U78A 4U75A 4I0BA 5K5OA 1TBXA 2BB7A 1P4XA 1FY7A 5HS9A 4IKSA 2FNAA 3EUHA 3HHGA 2XAJA 1QO0D 1P2FA 2HZTA 5L3EA 3BP8A 2STWA 1EH7A 4KIGA 3FX3A 4U73A 1LEBA 2B3KA 3C1DA 2IPQX 5E1XA 5E20A 1AWCA 2B3HA 3MEXA 1SFXA 1B59A 1TQPA 1BC7C 2D1VA 4L5IA 4EGEA 2XHKA 5D8LB 4Y17A 3VOEA 1IN8A 4U0YA 5JVTA 2BWUA 1QPMA 2HOEA 4HYEA 2PI0A 3ZMZA 3I64A 1L3LA 3T8TA 2NAZA 3DP7A 3O3KA 2E7WA 2GU5A 4WXHA 3L2CA 2ZCWA 4Z2YA 5CVVA 4IF7A 4UUVA 2ZSGA 2NS0A 4QLCU 4WWCA 2V9VA 3FM5A 1U8RA 1F9NA 2EV6A 4P9FA 2JPBA 5DUIA 1IN6A 4NHJA 4YG2F 3DKWA 4WX9A 1TQMA 4MTEA 1I27A 4KN7X 2MH2A 2MD5A 1UFMA 2FMLA 4L0YB 1GXQA 1U5TC 2ZO4A 4I2OA 4TV7A 4A6WA 1K78A 3ZMVA 1D5VA 3DF8A 1ZREA 3ABTA 2P99A 3KLOA 1QNTA 2DK8A 2WC2A 2FQ3A 5ICEA 4BYYA 5D4SA 2V79A 1ON2A 3ZMDA 2ISYA 4A6VA 1FZPB 3GEZA 1G3YA 2O0YA 4ENKA 3KP3A 2PQ8A 2EA4A 2COMA 3RIRA 1QXZA 3KETA 2F5DA 3TKYA 4CXFA 2J5PA 4FO8A 3Q9VA 3IG4A 2Q95A 4ZWOA 1D8JA 5CDEA 4FLIA 4CYDA 1B1BA 3EYIA 4ETSA 2Y48A 3OOPA 1WLRA 4ZYGA 2P7CB 5AIQA 2DFIA 5H6QA 4U6ZA 3E6CC 2ADUA 3BWGA 5CVJA 2UZKA 4FLJA 1FPQA 3T5XA 1ODDA 3U1DA 4UXNA 3F8FA 4NB5A 4BHCA 4KNYA 1QXWA 3CB5A 3FMRA 2CFXA 1SMYF 2OU2A 4HQEA 4A12A 1I1GA 1ZH5A 2GG2A 3M8FA 2KIMA 4LG0B 1G6NA 2HTSA 4AIHA 4IRHA 1W2MA 3MX6A 4U88A 3F8NA 3BPVA 2CW0F 2IJLA 2GU6A 4MQ9F 1ZYRF 1R23A 5EEGA 3J7AO 3QPTA 1BOAA 2P4WA 3V7CA 2A6EF 4RGXA 2GAUA 5K1YA 1KYZA 3PQKA 4IKUA 4HZFA 3ZMTA 2X4HA 2NNYA 1YJ3A 2ZNZA 4EJTA 2LDUA 1MKMA 4I09A 4D0PA 2IA2A 1SD5A 1G3TA 3QAHA 1G3WA 1WWXA 3ELKA 3KLNA 1TW3A 2FXAA 1W7PB 4FKCA 3D5LA 4IHTA 3JAMK 2IT0A 2HQRA 4EJOA 1SD7A 3QU6A 2LNBA 3TDUC 5D5UB 3BITA 4UVCA 3S6BA 3R0AA 1ZRDA 3I4PA 3DQVC 5FLXZ 2VBYA 2P5KA 2BWWA 3J81K 1VTNC 4G7OF 4RB2C 3PQJA 4KYWA 3I58A 1UB9A 4U70A 5FO5A 3K1PA 3P9IA 3LAJA 4S00A 3BIQA 4IF4A 4LD5A 3RYPA 3I59A 3G3ZA 5LHIA 1O3RA 1HBXG 2E7XA 5JI6A 3ZMUA 2VODA 4WXCA 2A61A 2Q93A 4EJUA 1RNLA 2R3SA 2M45A 1YG2A 1I5ZA 4A5MA 4L0ZB 1BI0A 3WTSC 2FF4A 4CZZA 2ZKZA 3BOQA 2LKPA 2M1BA 1YLFA 3K1NA 1NHAA 4HF1A 1T39A 3TQNA 3DPLC 1IN5A 1Z05A 5IT3A 1OYIA 4EQQA 2Y75A 5ICGA 2PEXA 4OOIA 1YW8A 1PV9A 4ESFA 3MCZA
chains in the Genus database with same CATH superfamily
1PJRA 2LR8A 2CYYA 5L3BA 1YVMA 1LVKA 2A5YB 3CF5F 5F6FA 1R22A 4W1UA 2H09A 5ILVA 1ZG5A 4YRVA 3S2WA 5B1AH 2K86A 2JSPA 5DUKA 4IHXA 4Z7MA 3FBIB 3HRUA 5E18F 1VQ7I 3HEFA 4FX4A 2DA3A 5DEQA 1P92A 3CUQA 2P98A 2YU9J 1G3SA 4HF2A 2KDZA 1TWGJ 4RB1A 1IF1A 4LMYA 4OAZA 4E7IA 4AIDA 1RETA 5GTIC 4II3A 2K3PA 4RAYA 2R7QA 1WY2A 1QVTA 1TLHB 3GZ5A 2VOPA 3DCFA 4U6EA 3EUAA 1J0RA 4B1RA 1NH3A 1BR1A 4U6WA 4ZYAA 2OJED 2Q2EA 5KVRA 3AG4H 4CSWA 1K83J 2EV5A 4RA2A 3WTUC 4RZZA 2XASA 2H1KA 2P81A 3HOUJ 3N05A 3IHUA 3LA7A 4HV5A 3BG5A 1SFEA 2UXNA 3PO2J 5FKMA 2BYVE 2IEKA 2HKOA 5K7ZA 3CLOA 3FHNA 5HLGA 2L01A 3BG7A 5JFRA 1HSJA 1MBFA 1XG1A 3FBNB 4B43A 3F21A 3H92A 2V3ZA 2K27A 2W00A 1YS6A 4GDFA 1P6RA 4DJAA 4YIRX 1W5CC 2WAEA 4H0EA 1B72A 2NVUB 4IHSA 1QHHD 1XSDA 1F1ZA 1TWCJ 3QPLA 4GXOA 3F3XA 1U8BA 4UNOA 2BOLA 3I0TA 3BROA 4UVBA 1YO5C 3MR1A 2DMTA 4JYKA 3COAC 2NVQJ 2YX4A 5FCHA 2DW4A 3WG7H 4MTDA 4I76A 2R92J 2COBA 4L9NA 1YIJI 1FC3A 1QRYA 5FD5A 4PNCA 3EETA 2VJ5A 5L3GA 2OUMA 1HQCA 2F2EA 2JZYA 3OYAA 1WJBA 1MDMB 2ELJA 3ZGKA 2OA4A 4AVPA 1TWHJ 2E1NA 4QSHA 4FE4A 3OS0A 2DYSH 1NK3P 2GZWA 2ZMEA 5F27A 1PUEE 1SAXA 2HQ5A 1RESA 4ZZLA 1JTXA 4M3GA 3CO6C 2RKHA 4ENMA 3S2HJ 2ZFUA 1N51A 3ULQB 5E3OA 3KYLA 1USSA 3KZZA 2XAHA 4LJZF 2J5OA 3TOBA 2ZJPF 3EPZA 1ULYA 5J4VA 1QXYA 5JLXA 2QUFA 2RQPA 3BG6A 1ZR2A 1MBKA 2M5WA 3T8RA 2LY2A 2R7SA 1KQ0A 2C6YA 3Q9SA 1B6AA 1IV8A 1A31A 3TO6A 2HOAA 4BGDA 5LLQA 2EA2A 1WL9A 2QBYB 5M5YJ 4XKBA 2EFOA 4MQVA 2HZDA 2EWNA 1JI8A 1PYVA 4YELA 4IKRA 1XGMA 1MNDA 3F0CA 4PGHA 1IN7A 3TB5A 2E1CA 2GOMA 3LQRA 5FFZA 2R7TA 2Q0OA 1AKHB 4NBQA 2LVSA 2W25A 3C3WA 2LF7A 2PMZN 3V8LA 3WE2A 3I71A 3H9QA 5IP7J 3HTUA 5D5XB 1OR7C 4M6YA 3PJRA 3JTHA 4UVAA 3CCMI 2DAOA 3DEEA 3OMYA 2RVCA 3LFUA 3J80Z 1R1UA 3VYRB 4XLCA 2W7NA 4RLQA 5H6RA 3KYDB 4NC7A 3A01A 1DUXC 2IS1A 3HZJA 2K9NA 2L9SA 2DJNA 4HA8A 1R71A 4BDYA 1DDNA 3OSFA 3MD2A 3S1QJ 1F36A 2GA1A 3FF5A 3ZQGA 1KQ9A 4M73A 3K6GA 3IRRA 3BY6A 3NAUA 3LNQA 4J01A 2DI3A 4IKFA 1P7JA 1PUFA 3L00A 4MATA 3WTTC 2XGEA 4X1EA 2O5RA 2Z5UA 1BW6A 1LDJA 4ZZDA 1ZLKA 4HXXA 4E7KA 2DMUA 3AFHA 4F55A 1ETWA 2XPVA 4YFXF 2HQAA 2PMZA 2KRCA 1WKMA 1T95A 1XDUA 4EGYA 2VOOA 5CVUA 4A2UA 1UCRA 1BI1A 1FX7A 3HBLA 1OCOH 5J1RA 4FO7A 1QGPA 1ZGWA 5AIPA 5ICCA 2XPWA 3WU0A 3K69A 1X3UA 3S3NA 4V2FA 4GGGA 4A3GJ 3HIFA 2KKOA 2MA3A 2YS9A 2H6CA 2DT5A 1ETQA 2K7LA 4UB8C 4BJTA 1J09A 4YFNF 1CGPA 3IWZA 2O6GE 2E1MB 3I3LA 2KJCA 2BXYA 4B28A 2CQXA 4HV6A 1HW2A 3WHCA 2LP0A 2FBIA 1G4DA 3LSIA 2GXBA 3N4MA 2OV7A 1HF0A 2OQRA 4XLEA 2DLLA 2VKHA 2Z33A 5ICFA 1TTYA 3K2AA 3KP6A 3CJRB 3GLXA 4DQ2A 2IBDA 4DYRA 5IP6A 1R1TA 1SD6A 2WV0A 3PFIA 4D5CA 4E7ZA 4WK8F 1GDTA 3DXJF 4C2MJ 4UHTA 3S1MJ 1XCBA 1MJBA 1RR7A 4NC8A 1Z9CA 2DJIA 2ID3A 3MFKA 1QBJA 5DCMA 1UHWA 3DPTA 1R00A 4BEHB 2MFZA 1IZ1A 3BR6A 3H5NA 3JSPA 1UAAA 4S2RP 3FK7A 4XMYA 1JUSA 3BPXA 3HTSB 2KP6A 2HEOA 2ACJA 1WGXA 2HPMA 1BI2A 3QP6A 3WU1B 1YTYA 3OYHA 4BL0B 2DOEA 4IXAA 3RZDJ 4IEJA 4OU0A 1K79A 1W7VA 1JHFA 4KDPA 2HYJA 3KE2A 3ZQQA 1VQMI 3CESA 5CNXA 1E3HA 4E7SA 1ZGAA 3TW6A 2XF5A 3WU2C 5A2QZ 3LA3A 3PIOF 3ZN0A 1EV7A 3ASNH 3PKBA 4R60A 5HLTA 2WY8Q 5IYCJ 4ENNA 3ONQA 2DODA 4D5FA 2E19A 3DU6A 4II2A 4AM3A 2VKDA 3F8CA 1T98A 2L7ZA 4HBLA 3EDPA 5HVQC 1MNEA 4XRSG 4KITB 2QLZA 2EVCA 1FJLA 3CMYA 2EV0A 1HKQA 2CGPA 1EH6A 4A5NA 3IKVA 1WSUA 2DFFA 3A1YA 2XF6A 2HNHA 3K7AJ 1BA5A 5ILUA 1ZKGA 4I6ZA 1X58A 4S05A 1ZG3A 4IPAA 4MEXF 4BE2A 4U69A 1S7OA 2QM3A 4BJ6C 4ZWUA 1JGSA 2OD5A 2VXZA 2FSWA 3N97A 1FWZA 2K02A 1XD7A 5FKLA 1VZ0A 2FOKA 5J8FA 3RTRA 2XIGA 4RAZA 1MMGA 1RIOH 3BZCA 5FLXK 2Q94A 1ZRCA 2G7UA 4RGRA 3PUFA 3V42A 3ZQFA 5FKKA 2XSDC 2G0EA 4YIFA 1YIOA 1LKXA 2LH9A 2LC2A 3LL7A 3G73A 1O0XA 2M3AA 5L3FA 3UKGA 2E2IJ 3E0JB 5CYVA 2WBMA 1I6XA 4A3JJ 4P5OA 1S7EA 1J59A 3QU3A 2Y9YA 2VC1A 4HRIA 5D4RA 4G7ZF 3CC4I 1W0TA 4F3QA 5D8KB 5D5WB 4JBAA 5DCFA 4LK1F 4M72A 2A07F 4L18B 3PNYA 3I54A 4A0ZA 1XMXA 4BU2A 2Z2SB 1O7FA 3MWMA 4BHBA 3JRHA 1HW5A 3MKZA 2GGCA 3FXQA 1EH8A 4NC6A 4Y3OA 5AONA 3ZQ7A 2IP2A 3A03A 3DFGA 2VQLA 4G7HF 2RC4A 3LSJA 4BDZA 5DM7F 2EILH 4RMNA 1G8XA 4DBQA 3H3ZA 3H5RA 3BTIA 2ETHA 5FCFA 4IHVA 1OCZH 1OCRH 2EH3A 1S3JA 3W3CA 3CCLI 1OPCA 3OYDA 5J3LA 2R7OA 2BHCA 5JR3A 2MLKA 2E36A 4UV8A 3V4GA 3CD6I 3JRIA 4A3DJ 2OTJI 1IG7A 3FIWA 2XGCA 5CDVA 2HQNA 3M7GA 3L09A 5LFAA 2JRTA 1F5TA 1BBYA 2VJ4A 3CTAA 3CQZJ 4JQFA 5ERIA 2F4IA 5E3MA 1X3ZB 3W2AA 1DPUA 1UJ8A 5BQTA 4IOCF 2FMYA 4ZH4F 2ZJ2A 1FP1D 3RDIA 3BCAA 4IQ4A 1ONVA 1SANA 3IAM2 4CHUA 4DZPA 3O8GA 4IX7A 1IRZA 4UV9A 2P0WA 2P9AA 3TO7A 4EMSA 3GVAA 1XB4A 2OBPA 2RNGA 4RB0A 1DU6A 2M9HA 1WI9A 3I59B 2DK5A 3KP7A 4KUMA 4XN3A 4RB3C 1R7JA 2OF7A 3GFLA 2D1HA 2JJ7A 2JA7J 9ANTA 4ZDPA 4F52A 1KU3A 1R49A 3HOZJ 3M9AA 2GG0A 2WAQN 1NK2P 4P1WA 2GU4A 3DLAA 1UHMA 2TCTA 2HS5A 1WRJA 2KRFA 3K2ZA 1IUYA 4IJAA 2R4GA 3G2BA 1RKWA 3BIPA 3NQOA 2XKPA 4ZC3A 1ZHFA 1SD4A 3A0HC 2ESHA 2QENA 1Q1HA 3S15J 3BG3A 1FIPA 1ZN2A 1GVJA 1HKSA 2X0LA 1XGNA 2QF7A 6PAXA 3FISA 1SFKA 2LYCA 3OWTA 3DTKA 2PJPA 3GZ6A 4IKTA 4FISA 3T1BA 2VBXA 3RPUD 4Y4RA 5EG0A 4GO1A 2B3LA 3VYUB 4XR6A 1UMQA 2HU9A 2A6HF 4U7BA 1RUNA 3AAFA 3RVAA 4RGSA 4Y33A 2XPUA 1ZAOA 2ECCA 4PJNA 1ETYA 1MMAA 4W97A 1LUJB 5K7FA 1Y56A 2K3FA 1ZGJA 3SYTA 1MH4A 3LSPA 1ZRFA 3ZR8X 1ETOA 2LD5A 4PUSA 4A0XA 1XS9A 4KJZA 1Y8RB 5K5QA 2QQ8A 3PKDA 2QQ9A 3S93A 5JHFA 3SFZA 1S7AA 1YI2I 2M7BA 5HDKA 4A3MJ 3HXLA 3H9GA 5LRSA 2IW2A 3B6CA 2EFPA 1T56A 3HGYA 4ABZA 2UV1A 1MATA 1WI3A 2HWVA 3MZHA 4B4CA 1ZG1A 1W5SA 2JA8J 2GXGA 4U76A 3GFIA 3HOWJ 2A69F 5JHUA 3CUQB 3RYRA 1X4OA 3KPHA 4LITA 3MVPA 1V5GA 4DYCA 1VQOI 4LLNA 3RZOJ 4PFOA 1UG0A 1HSTA 2CO5A 3E5QA 1WJAA 1JJ6C 1H8AC 3PKCA 3K1MA 1PP8F 1P9QC 3G4SI 3OYLA 2LG4A 1K4TA 4U87A 2EFNA 4FASD 2Q92A 3LA2A 4UUSA 2K9QA 2JUGA 1Z0XA 1KU7A 1OQYA 2MW8A 2Q2EB 2HDCA 3RPQA 1IDZA 2EPFA 1X1DA 3AL0B 4XQFA 3IWFA 3F6OA 2VKVA 5J6XA 2R7UA 2UXXA 1F4KA 4EJVA 2STTA 1KQ8A 1UELB 5LEKA 3GFJA 4G94A 2WAFA 3CB6A 4LIVA 4N9IA 2ZJRF 3CLQA 2IRFG 1FEXA 2JMWA 2DA2A 1E2XA 4FETA 5GAGJ 3TAVA 2A6TA 3A4CA 1UHSA 3C18A 4CUGA 3I56I 1X3WB 3OYJA 3PO3J 1B9MA 2BBYA 1QU3A 5C3EJ 1C27A 2VE9A 3CP2A 1BJZA 2X1CA 1MBEA 3FKIJ 1R4NB 4HX4A 2LKSA 5DV5A 1JKOC 4BUPA 2GXAA 4AD9A 3QOEA 1N77A 4QTRA 4X0GA 3CCUI 2BGCA 3L7GA 4LLGF 1MGTA 3ZOBA 3MKWB 4BXUA 3OYFA 2GG8A 2PJRA 2DA4A 2HGCA 4D1QA 3GTMJ 3F8MA 3KFWX 3J80K 3HOTA 3ECHA 4BBSJ 4WF2A 1BJAA 4L9JA 2CQKA 2R5YA 2CWEA 1MNMC 4U0WA 2P7VB 1QVUA 3K0LA 4ZWPA 5CE6A 3CMMA 5F0CA 4LG0A 2YPRA 1JHHA 3CTZA 3E6DA 5HLHA 1WL6A 1XCVA 3NEUA 1IXCA 1OMIA 3M07A 1RI7A 1Z6TA 4P9UA 2H27A 2EJRA 2FQ4A 3DEUA 5FKNA 2GG9A 3IRQA 5K5RA 2HR3A 4IQJA 4M74A 2ISZA 2RREA 2FX0A 1D0XA 4RS8A 4A6DA 2R7WA 4G6TB 2GG5A 2PMHA 2XROA 1FNNA 2PX9A 5IOZA 3Q0WA 2JQ7A 4KISA 3GWZA 2Y0MA 4BQAA 3PKEA 2VN2A 3QPSA 3GTLJ 2PG4A 3GBGA 1XX5A 1U2WA 4E4HA 1XMKA 1Y6IA 5HDGA 2PMUA 1WZ2A 1Z6RA 1OJLA 2CW7A 2KZGA 3MATA 1T8IA 2KJBA 3P7NA 3VB2A 1F43A 3Q6DA 1T0FA 3C2GA 4A3EJ 2HXIA 1U6GA 2AQFA 3ABUA 1FP2A 3EYYA 3S2DJ 3PUBA 3S16J 4XK4A 2M8EA 5CVIA 3VSKA 2NS7A 1Y1NA 2E2JJ 4IU6A 4C9YA 4IO9F 3C2HA 5EJCA 4CYCA 3CJNA 1ETKA 1E3OC 1I6HJ 3P5JA 4A3FJ 4OIPF 1IW7F 4B44A 3K4MA 1W7PA 3I53A 2M34A 3R4KA 1OR7A 5LD2C 2G7HA 3CCQI 2UWMA 4AYBN 5E5BA 4JP0A 5E8IA 2L4MA 3E7LA 3KZIC 1JE8A 1YRNA 3BJOA 1K6YA 1QA6A 4Q4ZF 2OCCH 2RV8A 4BAYA 2TDXA 5DDGA 1LFUP 3V8JA 3GXOA 2KIUA 2Z9OA 1VNDA 2F5EA 5DD8A 5CVRA 4F7ZA 2CS3A 3H3VK 5HS8A 2VPRA 2Z3YA 5L3DA 4I0AA 1YFHA 1KYWA 4B48A 5FD6A 4FX0A 4IRGA 5D6FA 3K4BA 3I4NJ 2EZLA 4XOPA 4A3KJ 1QZYA 2V1UA 2NQ7A 4DW6A 2IA1A 2R7VA 1TWFJ 1V5FA 1J9IA 4CCOA 5GP9A 1MSEC 2R7DA 3PNTA 1DGRM 1V54H 4BH9A 1PUFB 5LHGA 2ZXWH 5JVGF 4G8XA 4AYBA 2R93J 3VODA 1Z91A 3D0SA 5A2QK 4DZJA 2M0CA 1IXSB 3BZKA 3FXJA 4KT6A 3C7JA 2L9RA 2KISA 4A3CJ 1O7LA 1XDSA 4DGWB 3CCYA 3CDHA 3BTLA 2HDDA 1U5TB 3FM3A 3GX4X 2AS5F 1YHQI 3UNGC 3GTJJ 1Y39A 3GF2A 1TNSA 4XLHA 3OYMA 4A3LJ 1X1PA 2KL4A 2H1LA 4JX4A 2IS6A 1I3QJ 1JTYA 4Y52J 4FCYA 1WN1A 2K85A 1L0OC 2VB6A 3NRVA 4OMZA 4XKCA 4OOKA 4Q47A 3S1RJ 2RNJA 3WGIA 4FLLA 2ID6A 1RKTA 2BVLA 3D1NI 3WG9A 4DOZA 5M5WJ 1G2HA 2O03A 3OIPA 3L1PA 3CF2A 3BJ6A 1I39A 1K6OA 2XAUA 3SEQA 5EEAA 5DS9A 1RPWA 4IOAF 1X1BA 4PJMA 1YW9A 1FSHA 3LSTA 5KK1A 1FT9A 1C0WA 3E5XA 4I01A 2GWRA 3GYHX 4XSXF 2JPCA 1IJWC 1REPC 5J1YA 3FXUA 1WBQA 5DCMB 1OYWA 1W5TA 2R7XA 1IDYA 3HSEA 1SFOJ 2IW5A 3NARA 3P9KA 4MFEA 1T38A 3GTOJ 1ZELA 2XUBA 4RAGA 2BHAA 1T0FC 2K9LA 1GV2A 2GZ5A 1LFBA 1S29A 4JK1X 2EVMA 4I02A 5BOXA 1YX5A 4GCVA 1O3QA 3KP2A 1RR8C 3OYBA 2GU7A 3BDDA 2V4JC 3F23A 3DV8A 3JRAA 2ZJQF 2BV6A 4XN0A 2XV4S 3L2UA 4C3IJ 3TDZC 3KEOA 3GMEA 2GQQA 5E8GA 2OC6A 3Q3SA 5EGOA 3KCCA 1LE8B 2DQRA 3SZGA 5F0HA 3O6BB 1XGOA 1BN5A 2GIVA 2EINH 4KICA 1BL0A 3OYCA 5LGTA 1XN7A 3CJTB 2DMPA 1VQPI 2V9PA 3M1CA 4CA0A 2GM4A 4PGGA 2YSRA 1FBQA 2X6YA 4QWQA 3ERED 3P9CA 4KT5C 3OIQA 1KZHA 3FMQA 1DP7P 2XSJC 1O3TA 2LBFB 4HLXA 1ZR4A 3FHZA 2CMPA 3JRBA 2A68F 4A3IJ 3M4OJ 1R1VA 3BJAA 1RZ4A 3OL4A 2DPDA 3F6VA 3FZVA 1A6IA 3V7SA 1LDKB 2M7AA 3LFKA 2IGOA 3WGGA 2H8RA 2VT3A 5DD4A 2E34A 3RI4A 4KMFA 1ITYA 1AA7A 2LRDA 3E1SA 2GOXB 2LLKA 5C4JJ 3H0DA 1MMNA 1JXSA 3FXRA 2PN6A 3DPUA 3G71I 1YW7A 2Y69H 2IXSA 4A6EA 2O3FA 5E17F 2QEXI 4JX6A 2QSHX 3BR0A 2QCOA 3HOXJ 1YE9A 1V4RA 3SXYA 1P7IA 4ESJA 2X85A 2O8XA 2X1EA 2IS2A 1K78B 2OKNA 1W7PD 4KA4A 3IU9A 2DTRA 1Z7UA 1SMTA 1TNTA 2RN7A 3K9TA 1WQ2A 1ENHA 1OCCH 2FUG2 4EGZA 1A35A 2VPLA 2V3XA 5GTHC 1ON1A 2G9WA 5GPAA 1ETVA 2L54A 4PSXA 2ZSHB 4O6JA 1A04A 2HYGD 4LB5A 3UR3C 5ILSA 4FQGA 2DU9A 5EYRA 1MDMA 3E6MA 3SHFA 4HNTA 4BY1J 2JUCA 1FTTA 4EVIA 1TC3C 3IU8A 2VIXA 4FT8A 5J47A 3ECOA 5E79C 3WGHA 2ESNA 3PL8A 3OIOA 2CV0A 2E60A 3MKLA 4PK4A 2G6PA 1D1CA 1VI0A 2RQQA 2NYXA 3ZQIA 4GFBA 1IRGA 1CF7A 1QZZA 3GO5A 2VC0A 2XGDA 1XTAA 3HDDA 5F64A 1A6QA 1GXPA 2LF8A 3WHBA 3L24A 4NNJA 4N0BA 5LGUA 2HOSA 4QR8A 1B8IB 1J7KA 3OYIA 1R58A 3E6BA 4JUQA 1MSFC 3RPUA 3LAPA 1T6SA 5F1RA 3I55I 3CDLA 2WY7Q 3WTWC 2VONA 3JRDA 4EM0B 5IYDJ 1E3PA 4CCMA 5FLVA 3VYSB 2GG3A 2EB7A 2DDBA 1WCMJ 2JRMA 2L9NA 2DOAA 2QBYA 2DO7A 1S72I 2L5QA 4MEYF 4N9HA 4EEFG 3BQZA 3TP3A 4Y15A 2MC3A 2X51A 1VQ6I 5TRDA 1OYYA 2P8TA 1QQIA 2KIFA 3IL2A 4R79A 4CZCA 2R5ZB 5IT9Z 1EF4A 3ROUA 1GUUA 4KIBA 2OZ6A 3K70C 4M3DA 2CV1A 1MBGA 3H3UA 1D8KA 1BM9A 5EEHA 2DBBA 4EV0A 3KIOA 1O3SA 2CQNA 3HRMA 4CICA 2DA1A 2QSGX 2W48A 4S2TP 3GZNB 4UY8I 3VPRA 1U9NA 4E70A 2JVHA 1R5ID 1LQ1A 2D5VA 1FOWA 3K4KA 3HRSA 1ZK8A 1A16A 1H9GA 3GTGJ 3I5UA 2GA2A 3S32A 2OCEA 4LLLA 3MN2A 4BACA 5FB2A 4XRMA 1IAWA 4EJWA 3FDYA 5B66C 4IRIA 4JX5A 1P4WA 3ZQCA 3GUDA 4ZTJA 5GAEJ 4YFKF 1LPQA 2MLGA 2FD5A 4PSWA 2XAGA 3HOSA 2E2HJ 3X2QH 4AC0A 1TT0A 1YJWI 1Y0UA 4MHGA 4C3HJ 3WTVC 3DLLF 1Z3YA 4AWXB 1H89C 3HPGA 2F5FA 4P55A 3L2VA 2ZNYA 2EQRA 3GW2A 4G12A 2Q8KA 3WTZA 4XNFA 4LOCA 4UB6C 2AHQA 4OIRF 1JKPC 5EG0B 4CH7A 2D2WA 4PV4A 2R7ZJ 1AHDP 1ZQ3P 2CW8A 2DT7B 1EA3A 4NQWA 5HNFA 2VBZA 2Y31A 2V26A 3LWFA 3TGNA 2CSOA 1XGSA 3BTJA 2IAIA 2LY1A 4PDKA 4BKXA 4A3BJ 1LVAA 2NS8A 3R6SA 1GT0C 2NVTJ 3QQAA 1P4AA 3ZRGA 3PSFA 3K70D 4ZNGA 2PBIA 4PJ0C 4XOTA 1FBSA 4BQNA 2O61A 2OZUA 1STZA 1U9OA 1WFXA 3HGGA 3W6VA 2E35A 4HX8A 3BTCA 5LEJA 2HOTA 1MIJA 4XSZF 4D9JA 1HDDC 1ZLJA 4L9VA 3WE3A 2Y0SN 1UZCA 2YUSA 3HL2A 3VFZA 2VL8A 5LHHA 1X19A 2L9VA 2ZXHA 1KP0A 1D5YA 3QPHA 3EUHC 5BPIA 2OAZA 3RJPA 3CCSI 1V3FA 1AU7A 3BT9A 1S6LA 1DQUA 4HF0A 1D3YA 2EFQA 5FLMJ 2HVRA 2BWSA 5CIKA 4O5VA 4XKWA 1U3EM 1RRJA 2RDPA 1O57A 2B0LA 4KM3A 2P5VA 2V1NA 1OKRA 2XGXA 3W6JB 3U2RA 3J7ZI 4KN4X 4B47A 2X9DA 3A02A 1Z67A 4LFUA 3E5UA 1OCPA 5CDLA 4BE1A 3KEQA 4AU7A 3B6AA 3BG9A 4UUSB 1NG7A 1W36C 2Y0SA 3M1EA 4ESBA 4Q5SF 2FA5A 2BHDA 5KHDA 3S17J 2EK5A 2YR2A 2VQHA 4E7HA 2QKMB 1MD0A 2QWWA 2ZB9A 3FMSA 4B3AA 1FTZA 4QIWN 4L9TA 4U71A 3DBRB 3ZCOA 1U0JA 3TW7A 1SVMA 2LY9A 2ELHA 4DNCA 3OV8A 5KCMA 2DCEA 2FRHA 5HLIA 1SVOA 3SQNA 3ZN1A 4CCNA 1HDPA 4WCGA 4OIQF 5HDNA 2VI6A 2DT6A 4R1HA 3Q5FA 2OQGA 3FXOA 3ZMSA 1Z1DA 2L02A 2LREA 5H20A 3AG3H 2X1DA 3WTYC 2O9LA 4XLNF 1J5YA 3HYIA 4XM3A 4WXDA 2HTJA 2B9SA 3V8KA 1M35A 1POGA 3DTIA 2BWYA 5LGNA 1LJ9A 3BZ6A 1JUMA 2FBHA 4KFCA 3SFIA 2PJRB 2BN7A 3HUGA 2HFHA 4M71A 4B09A 1WJCA 4GYIA 4F92B 3ASOH 2R5YB 4ENJA 1I1SA 1ZARA 3JCUC 4O3MA 3DEWA 1SFUA 2AQEA 1Z77A 4N4NB 3L7WA 2M87A 3OYNA 2L4AA 3IU7A 1PP7U 1BI3A 1VQLI 5GPCA 1G59A 1BR4A 3K4NA 4XIDA 2NXNB 1ACIA 1Y1WJ 1W36D 4I7HA 1QZEA 4C2UA 2L7KA 4DIQA 1E17A 4OINF 2BHBA 1R5GA 3OS1A 2W24A 2VASA 3K4JA 4CDGA 2XC7A 2KRHA 3HM5A 5BPDA 4A69C 2MSYA 1C21A 3B73A 3EQLF 2E1MC 2QSFX 2P5LC 3GLLA 1YX3A 4ON0A 2KQRA 2IVMA 1IRFA 4NDLA 4BHPA 5L3CA 4KMUX 4GRIA 3GTQJ 2V3YA 2Y9ZA 5D6EA 4A0YA 1C22A 2YU3A 3W6KB 4S0HB 3FXLA 4CCLA 1KGSA 1WHUA 3U9GA 4G6QA 4BJ5C 3SZPA 4HAMA 1N78A 2LOOA 3TO9A 3OYGA 1C24A 3L2QA 2BW3A 2PLYA 2DN0A 1KU9A 1YQAA 4HLYA 1V5EA 2XVCA 1VQNI 4FHTA 2A3SA 2BEOA 2WADA 4M9XA 1BW5A 1UG2A 2W84A 3L9FA 2HYFA 4CCJA 4J19A 4QPOA 5CQEA 1MZBA 3NWTA 4XLPF 1ORKA 2EZHA 1PDNC 2MBFA 2DFHA 3WODF 1YRNB 1C23A 2FEZA 1DU0A 1HOMA 4HX7A 1GVDA 2P6TA 1K4SA 1YYVA 3BC8A 3LQQA 3CC2I 2Y30A 4AUXA 4BQQA 3QYEA 5BMZA 2DFEA 3R0JA 3E3VA 2X6XA 1IXRC 2XRNA 1W1WE 2V1DA 1I50J 2KPMA 2E1OA 2XAQA 3JSOA 2W4SA 2NVYJ 2XB5A 4HG2A 2NOJB 3REOA 1FOKA 1Y8QB 3PKAA 3D5SC 3MQ0A 4U6JA 2LFBA 1KA8A 4X6AJ 4CGZA 2VJIA 1DGWY 1BOBA 1B72B 2BXZA 4ZDOA 3RORA 2XDVA 1K61A 4ANJA 4C2TA 2JA6J 2GBYA 2M4KA 5BS6A 4XRFA 4RBOA 1JAWA 5DM6F 4J00A 3O2PE 5F0FA 4XKVA 3RQ4A 2NRAC 1XMAA 1IO2A 5EZHA 4OMYA 1BC8C 3L2WA 3M8EA 1TQIA 2VE8A 4LB6B 5LBQA 3QP5A 5J40A 3R60A 3IH2A 4HOBA 4BS9A 2CU7A 2OTLI 2RAEA 2VQCA 4FLKA 3QRFF 1V55H 3HSFA 2MG4A 1ETXA 2LSOA 3DKXA 2JWTA 1LB2A 2FU4A 3CJQB 4HW0A 5GAHJ 3QWLA 4ZJZA 2ZMEB 1OFCX 3OSGA 2HOWA 4S01A 3HOYJ 3KP4A 1DPRA 4PCQA 2H94A 2K4JA 1IN4A 3Q0VA 4E6KG 3H5AA 5LRRA 3TBIA 3HC7A 1JT6A 4PZJA 2XAFA 4IZZA 2VXDA 2ZXJA 2QZ8A 4BXFA 4D7MA 3AKZA 1N75A 2FE3A 4F91B 5JLWA 4I98B 1WPKA 4E7JA 2F6CA 1LEAA 5F1JA 3KP5A 1XSXA 5EDNA 1KONA 1MBHA 2NNNA 4XLFA 2XKOA 2ME0A 2Q96A 4M9ZA 2ECBA 3W2WA 2AO9A 2BY2A 5DYMA 4M9SA 2AXLA 3U21A 1FYLA 4U7DA 5ED4A 3VYTB 2GGBA 4YEJA 3BR5A 1T2KA 1LDDA 4ZDLA 1MMDA 5CLSA 1TW2A 5KAFC 2ZSIB 3GCMA 2P6SA 5E3LA 3BR1A 5H2FC 1FLIA 1BIAA 3M8JA 1ERDA 5FKOA 1AOYA 2HVSA 3G1MA 2WWYA 2DMQA 1FMVA 4FUKA 4CO8A 5EGOB 4KIFA 3RKWA 2O7OA 1HCRA 4XICA 1LNWA 1HW1A 3MZYA 4BQOA 1RUOA 2O8KA 3A01B 2PFBA 2NQ6A 3VEPA 4M3FA 4RM2A 4R8HA 3CCRI 2W57A 3F22A 2CJJA 2JT1A 4MIMA 4D7NA 5FROA 2BWTA 3CUOA 3MKYB 1YS7A 3V7RA 4LGWA 1D0ZA 1XC5A 2ZBKA 3RCOA 4MGRA 4IECA 2IA0A 2JVGA 2ZC2A 5HS7A 1KU2A 1YJNI 1IGNA 1WJEA 2BHZA 4G9YA 2EZKA 2QGUA 3HKZN 4K2EA 4G6DA 2HKXA 2M8GX 4RGUA 4M3BA 2V7FA 2CH0A 3MZ8A 5KNLA 5IT9K 2LTPA 4U6CA 2QQBA 2BWXA 3SZTA 5C44J 2V6CA 3A0BC 3FWEA 4MO7A 2V6EA 2BE5F 2W1OA 3HRTA 4U1BA 1J75A 2VLAA 4LIUA 3HPHA 3F8BA 3GFMA 4ZYDA 1S5LC 2BY1A 3PM1A 3WTXC 3GTPJ 3RKQA 2VKEA 4ZYEA 3QYFA 4PJLA 5HOOA 2BVMA 4OIOF 3HSRA 5D5VB 4EM1A 1HXDA 4YIIA 1GHCA 2I10A 2F5CA 3B02A 1JGGA 2TRTA 2EIMH 3HKZA 1MJAA 3LMMA 3R61A 3JAMZ 1VQ4I 4AIKA 2D45A 2K4BA 3RKYA 2WA0A 3CCJI 3MAJA 2M30A 2ELKA 2I5UA 3T0YA 5GADJ 3PFYA 4B8XA 4GYGA 1ZTRA 1H88C 3OOUA 1A36A 1CF7B 3CO7C 1SEUA 3H1CA 3ESWB 1S8NA 3J81Z 5FGMA 2H8WA 2FJ1A 2FNPA 4P96A 3KZYA 3IC7A 2H6BA 3NWSA 3TMOA 1XSVA 1W4MA 1WVRA 2L2OA 1X4PA 2DA5A 3KEYA 5TJJA 1NG6A 3E97A 4EM2A 2L3DA 2WTEA 1TZLA 4HQMA 1FYKA 2EFWA 2IS4A 1FYMA 2GG7A 1J2XA 1JUPA 2DPUA 4M6XA 2YX7A 1FBUA 2Z1DA 1MW7A 5M3FJ 2Z99A 1Z3XA 5E1WA 3ZPLA 4ZTFA 4V19K 3MMYB 1JKRC 3CUQC 2QVOA 2LMDA 2DQLA 4S04A 1WH7A 4HNVA 1QPIA 2UUZA 1K7AA 2V9KA 1R36A 1X1AA 2R7FA 2GTXA 4RGZ1 3AG2H 4L5JA 4HSTA 1USTA 3W2VA 2BH3A 3QOPA 4AIJA 2V1XA 4Q48A 5EF6A 3IUOA 5J8CA 1MJ9A 3LSKA 3SJMA 5K7HA 1XNZA 3AL0C 1B4AA 2LK2A 1B9NA 1FSEA 2BY3A 5FFXA 1CQTA 4HDVA 1DP3A 2KFDA 3TL4X 4F93B 4ZYHA 1R6RA 3JTGA 4U0VA 3VDXA 3IKTA 1IRXA 2JTVA 1R5HA 2AXTC 2JK3A 2QQAA 2B63J 1HKTA 4HDUA 1FIAA 1BIBA 2VBWA 3ERMA 1A5JA 1CHMA 4RZYA 5E1ZB 4XBFA 3F72A 5M3MJ 2BWVA 3DKYA 4MNUA 2ZFWA 3ZP5A 2MATA 4IVNA 1D1AA 3ML6A 2CG4A 4XORA 3RKXA 1H9TA 2FBKA 4A93J 2CUFA 4HSRA 1MMSA 1R9TJ 3KYCB 3D27A 2EVOA 4BNCA 3QODA 2RGVA 3G1LA 1IV6A 4V2GA 1H0MA 5IPAA 1NTCA 5IY5H 4NQWB 1WJ5A 1U5TA 2VT2A 3ISPA 4BBRJ 3FK6A 4LK0F 5F04A 2Z16A 3TOAA 5DTDA 4ASNA 5CJ9A 2ICWG 2MH9A 3HHHA 2W85A 3OR2C 2K5CA 4IDYA 2JSCA 1LFPA 3JW4A 3DTEA 2QYOA 4Y13A 1U78A 4U75A 2VQGA 4I0BA 4EATA 5K5OA 1TBXA 2BB7A 1P4XA 1FY7A 5HS9A 3ZXSA 2QA4I 2FNAA 2EIKH 3HOVJ 4IKSA 2F4MB 2ZMEC 3EUHA 5HNHA 2KDOA 3JREA 3HHGA 2XAJA 4L5EA 1QO0D 3H36A 1P2FA 5CKTA 1GV5A 2HZTA 5L3EA 3BP8A 2STWA 1EH7A 4KIGA 1JKQC 1TL8A 3FX3A 5B3SH 4U73A 1HLVA 1LEBA 2Q1ZB 2B3KA 3C1DA 5F08A 2IPQX 5E1XA 3RSNA 2WV1A 5E20A 2IGNA 1AWCA 2F4OB 3CDIA 1YJ9I 3MEXA 4B3XA 2B3HA 1SFXA 2X6WA 3U1KA 2Y2ZA 1B59A 1TQPA 4HPQA 1BC7C 2D1VA 3OYEA 1JJ8C 2WB1N 3AG1H 4L5IA 4EGEA 3IAS2 2XHKA 4JOMA 2F5VA 5D8LB 4Y17A 3IH4A 3VOEA 1AKHA 1APLC 1IN8A 4U0YA 2EBIA 5JVTA 3OY9A 2BWUA 2BHYA 1QPMA 3Q0UA 2HOEA 5CQGA 4HYEA 2PI0A 4MLOA 4MFDA 3RQIA 3ZMZA 3I64A 3FKJA 1Y1VJ 1L3LA 3T8TA 2NAZA 3DP7A 5KAIC 1LE8A 3O3KA 2E7WA 2GU5A 4WXHA 3L2CA 3H35A 2ZCWA 3L2RA 4Z2YA 5CVVA 4M6VA 5TISC 4IF7A 2WB1A 4XLAA 4UUVA 2ZSGA 2GLOA 1N25A 2NOGA 2NS0A 3CZ6A 1GLNA 2LBFA 4QLCU 2DXIA 2CUEA 4QPQA 4WWCA 2ZXIA 3K10A 2V9VA 3FM5A 1U8RA 1F9NA 1S9HA 2JA2A 3S3MA 3TEDA 2VUMJ 2EV6A 1TWAJ 2DMNA 2JPBA 4P9FA 5DUIA 3HUGB 1IN6A 4NHJA 4YG2F 3I4MJ 3DKWA 4WX9A 2KMUA 5E3NA 1M1EB 1TQMA 2X6OA 3H0GJ 4MTEA 1I27A 3LSMA 1T33A 3S3OA 4KN7X 1IC8A 4H4KC 2M2EA 2MH2A 3JR9A 2MD5A 1UFMA 1PVEA 2FMLA 2X48A 3OS2A 4L0YB 5C4XJ 1BR2A 1GXQA 1U5TC 3S8PA 4DYQA 2ZO4A 4I2OA 4TV7A 4A6WA 5IOYA 4HEA2 1K78A 3ZMVA 1D5VA 3ABMH 2CUJA 1QHGA 3DF8A 1XPXA 2JA5J 1ZREA 3ABTA 2P99A 2HDWA 3KLOA 1QNTA 2DK8A 2WC2A 5J4YA 2FQ3A 4BYYA 5ICEA 5D4SA 2V79A 3BCBA 1ON2A 3ZMDA 2DA6A 4IHWA 2ISYA 4A6VA 2ME6A 4NUBA 2LKXA 1FZPB 3GEZA 1G3YA 4XL9A 2O0YA 4ENKA 3KP3A 4M3EA 2EIJH 2PQ8A 4C30A 3K4LA 1OISA 2EA4A 2COMA 2CV2A 2KZVA 3RIRA 1QXZA 3KETA 4RDUA 2F5DA 3OR1C 4BEHA 3IH3A 2W82A 5EZGA 3G6EI 1X1CA 3TKYA 3CCVI 4CXFA 1Z21A 2J5PA 4FO8A 2BW3B 3S1NJ 3CC7I 3Q9VA 3IG4A 2M4GA 2Q95A 5B5EC 4ZWOA 1D8JA 1TP4A 5CPRB 5CDEA 3KX2A 1B8IA 3GTKJ 1R4MB 4FLIA 4CYDA 1B1BA 3BR3A 3IP4B 3EYIA 2EZIA 3G1OA 2K9SA 2L0KA 4AVZA 4ETSA 3HG9A 2Y48A 3OOPA 3LOCA 4ZYGA 1WLRA 1FOYA 3HB9A 2P7CB 5AIQA 2K9MA 2DFIA 2R0QC 3VSLA 3ABKH 5H6QA 1VQ8I 4U6ZA 1Y0NA 4HNUA 3E6CC 2ADUA 3I9V2 3BWGA 5CVJA 2UZKA 2R5ZA 4FLJA 1FPQA 3T5XA 1OCTC 4IHYA 3SDGA 4E7LA 1ODDA 3LSHA 3U1DA 1SVLA 4UXNA 4LG3A 3F8FA 3OYKA 3PNVA 4NB5A 4BHCA 4KNYA 1QXWA 5BNGA 1T08B 3CB5A 1I3AA 3FMRA 2CUZA 1D0YA 2XRLA 1IUFA 3K4CA 3BQYA 2A05A 2CFXA 3O8HA 1MH3A 4FE7A 1SMYF 2OU2A 4HQEA 4BE0A 1VFCA 2CRGA 4A12A 1I1GA 2E5NA 1ZH5A 2KIQA 3CCEI 4IL6C 1JT0A 3J7AY 2GG2A 3M8FA 2KIMA 3SDBA 2GIZA 4LG0B 3DWLE 2DTZA 1G6NA 2M0MA 2FOWA 2MC4A 3EUKL 1MBJA 2HTSA 4RM3A 4AIHA 3CMEI 4IRHA 1W2MA 3MX6A 4U88A 2DA7A 3F8NA 5TGTA 3BPVA 3PIPF 3J7YJ 1TT5B 2CW0F 4RLFA 3JRCA 2IJLA 2GU6A 1YOVB 2MYSA 4MQ9F 1ZYRF 1R23A 5EEGA 2L7FP 3VWBA 1VQ5I 3J7AO 3QPTA 1BOAA 1Q1VA 2P4WA 3V7CA 5M5XJ 3S14J 1RC9A 2CQ7A 2WAQA 2OPTA 2A6EF 4RGXA 2GAUA 5K1YA 1KYZA 3PQKA 3JRGA 4IKUA 3FXMA 4HZFA 3ZMTA 1SAUA 4BXXJ 2X4HA 3D5RC 3H9JA 2NNYA 1YJ3A 2MGQA 2DDAA 2ZNZA 4PJJA 4EJTA 2DOFA 3F9KA 5J1UA 1EKEA 2LDUA 2E5ZA 3M3YJ 1MKMA 1Z7LA 4Z6YA 4I09A 4OWRB 1EJ9A 4ITVA 1VQ9I 4D0PA 2IA2A 1SD5A 2F48A 1G3TA 4CYCB 3QAHA 1G3WA 1WWXA 3ELKA 3KLNA 1VF9A 1TW3A 5B1BH 2FXAA 5FRMA 5IYBJ 1W7PB 3ZQLA 4DBRA 2A5WA 4FKCA 3D5LA 5FRNA 2DYRH 2K40A 4IHTA 2I8DA 3HJEA 2KLOA 3JAMK 3OL3A 2IT0A 1FMWA 2HQRA 3ABLH 1WH5A 4EJOA 1SD7A 3QU6A 2LNBA 2VJJA 3TDUC 5D5UB 3BITA 3ZQHA 4UVCA 3S6BA 4I99C 3R0AA 1WJDA 1ZRDA 3I4PA 3DQVC 3DBHB 5FLXZ 2VBYA 2P5KA 1X2MA 1VQKI 2BWWA 2IGMA 3J81K 1VTNC 2R7RA 4BY7J 4G7OF 2XB0X 3PQJA 3C2BA 4RB2C 4KYWA 3I58A 4N4OB 1UB9A 4FTHA 4U70A 5FO5A 3K1PA 3P9IA 3LAJA 4S00A 4OAYA 3BIQA 4XONA 5FJ8J 4IF4A 4LD5A 3RYPA 3CP8A 2JN6A 3I59A 4Y7NJ 1D1BA 1E0EA 1X2NA 3G3ZA 2N8GA 2CQQA 2B7EA 1O4XA 5LHIA 1O3RA 1HBXG 2E7XA 5JI6A 3ZMUA 2VODA 4WXCA 2A61A 4UUTA 2Q93A 3BR2A 4EJUA 2NVXJ 2E71A 1RNLA 2R3SA 2M45A 2HXOA 4RAFA 2IGKA 1W0UA 2L7MP 3LSRA 1YG2A 1I5ZA 2KT0A 1OLTA 1YITI 4A5MA 4L0ZB 1BI0A 2CFOA 1WJFA 3TP0A 3WTSC 2FF4A 4CZZA 2ZKZA 3BOQA 2BZTA 2LKPA 5IP9J 2XF7A 4XRSA 3DBLB 3CMAI 2M1BA 1YLFA 3K1NA 1NHAA 2HVQA 2QKLB 2HI3A 4HF1A 3JRFA 3BLYA 4PFPA 3TQNA 1T39A 2HPIA 4C3JJ 3DPLC 1IN5A 3LSGA 1FOXA 3QYBA 3SEZA 1Z05A 2KHMA 5IT3A 1OYIA 5HODA 4EQQA 3A2KA 1HA8A 2Y75A 2MABA 1SC7A 5ICGA 2PEXA 4OOIA 1YW8A 3FXKA 2MD0A 4CCKA 2BY0A 3IV5A 1PV9A 3PSIA 4ESFA 3DU5A 3MCZA 1HC8A
chains in the Genus database with same CATH topology
2CYYA 5L3BA 1YVMA 2A5YB 5F6FA 1R22A 2H09A 5ILVA 1ZG5A 3S2WA 2K86A 4Z7MA 5DUKA 3HRUA 5E18F 4FX4A 5DEQA 1P92A 3CUQA 2P98A 1G3SA 4HF2A 4RB1A 1IF1A 4LMYA 4RAYA 1WY2A 3GZ5A 1TLHB 2VOPA 4U6EA 1J0RA 4U6WA 2Q2EA 5KVRA 2EV5A 3WTUC 4RZZA 2XASA 3IHUA 3LA7A 4HV5A 1SFEA 2UXNA 2BYVE 2HKOA 3CLOA 5HLGA 2L01A 5JFRA 1HSJA 3F21A 3H92A 2V3ZA 2K27A 1YS6A 1P6RA 4H0EA 4IHSA 1XSDA 1F1ZA 4GXOA 3F3XA 4UNOA 3I0TA 3BROA 4UVBA 1YO5C 3MR1A 3COAC 2YX4A 5FCHA 2DW4A 4MTDA 4L9NA 1FC3A 4PNCA 5FD5A 3EETA 5L3GA 2F2EA 1HQCA 2JZYA 1MDMB 2OA4A 4AVPA 2E1NA 2GZWA 2ZMEA 1PUEE 1SAXA 4ZZLA 3CO6C 4ENMA 2RKHA 1N51A 3ULQB 1USSA 3KZZA 2XAHA 4LJZF 2J5OA 3TOBA 1ULYA 1QXYA 2QUFA 2RQPA 2M5WA 3T8RA 1KQ0A 2C6YA 3Q9SA 1B6AA 3TO6A 5LLQA 2EA2A 1WL9A 2QBYB 2EFOA 4MQVA 2EWNA 4IKRA 1XGMA 4PGHA 1IN7A 3TB5A 2E1CA 3LQRA 5FFZA 2Q0OA 2W25A 3C3WA 2LF7A 3V8LA 3WE2A 3I71A 3HTUA 5D5XB 4M6YA 3JTHA 4UVAA 2DAOA 2RVCA 3J80Z 1R1UA 5H6RA 1DUXC 4HA8A 1DDNA 2GA1A 3FF5A 1KQ9A 4M73A 3IRRA 3BY6A 2DI3A 3L00A 4MATA 3WTTC 2Z5UA 1LDJA 1ZLKA 4ZZDA 4HXXA 4YFXF 1WKMA 1XDUA 4EGYA 2VOOA 5CVUA 4A2UA 1UCRA 1BI1A 1FX7A 4FO7A 1QGPA 5AIPA 5ICCA 3WU0A 3K69A 1X3UA 4GGGA 3HIFA 2KKOA 2MA3A 2H6CA 2DT5A 2K7LA 1CGPA 4YFNF 3IWZA 2O6GE 2KJCA 4B28A 4HV6A 1HW2A 2FBIA 1G4DA 2GXBA 3N4MA 2OQRA 2DLLA 2Z33A 5ICFA 1TTYA 3KP6A 3GLXA 4DQ2A 1R1TA 1SD6A 2WV0A 3PFIA 4WK8F 3DXJF 4UHTA 1XCBA 1MJBA 1Z9CA 3MFKA 1QBJA 5DCMA 1UHWA 3DPTA 1R00A 1IZ1A 3JSPA 4S2RP 3BPXA 3HTSB 2HEOA 2ACJA 1BI2A 3QP6A 3WU1B 1YTYA 4IXAA 1W7VA 4OU0A 1K79A 1JHFA 4KDPA 3KE2A 5CNXA 1ZGAA 5A2QZ 3LA3A 3ZN0A 1EV7A 3PKBA 4R60A 4ENNA 3F8CA 1T98A 4HBLA 3EDPA 5HVQC 2QLZA 2EVCA 2EV0A 1HKQA 2CGPA 1EH6A 4A5NA 3IKVA 1WSUA 5ILUA 4S05A 1ZG3A 4IPAA 4MEXF 4U69A 1S7OA 2QM3A 4ZWUA 1JGSA 2OD5A 2VXZA 2FSWA 3N97A 1FWZA 2K02A 1XD7A 2FOKA 5J8FA 3RTRA 2XIGA 4RAZA 1RIOH 5FLXK 1ZRCA 2G7UA 4RGRA 4YIFA 1YIOA 3G73A 1O0XA 5L3FA 5CYVA 1I6XA 4P5OA 1J59A 3QU3A 2VC1A 5D4RA 4G7ZF 5D5WB 5D8KB 4JBAA 5DCFA 4LK1F 4M72A 2A07F 4L18B 3I54A 4A0ZA 1O7FA 3MWMA 4BHBA 1HW5A 2GGCA 3FXQA 1EH8A 5AONA 3ZQ7A 2IP2A 3DFGA 4G7HF 2RC4A 3H3ZA 2ETHA 5FCFA 1S3JA 1OPCA 2BHCA 5JR3A 2MLKA 4UV8A 3V4GA 5CDVA 2HQNA 3M7GA 3L09A 2JRTA 1F5TA 1BBYA 4JQFA 3CTAA 5ERIA 1DPUA 5BQTA 2FMYA 4ZH4F 2ZJ2A 1FP1D 3RDIA 1ONVA 4CHUA 4UV9A 2P9AA 3TO7A 4EMSA 3GVAA 1XB4A 2OBPA 4RB0A 3I59B 1WI9A 4KUMA 2DK5A 3KP7A 4RB3C 1R7JA 3GFLA 2D1HA 1KU3A 2GG0A 3M9AA 2GU4A 1UHMA 2HS5A 1WRJA 2KRFA 3K2ZA 1IUYA 4IJAA 3BIPA 3NQOA 2XKPA 1ZHFA 1SD4A 2ESHA 2QENA 1Q1HA 1ZN2A 1GVJA 1HKSA 2X0LA 1XGNA 6PAXA 2PJPA 3GZ6A 4IKTA 3T1BA 2VBXA 2B3LA 4GO1A 2A6HF 4U7BA 1RUNA 3AAFA 3RVAA 4RGSA 1ZAOA 1ZGJA 1ZRFA 4A0XA 5K5QA 3PKDA 2QQ9A 3SFZA 1S7AA 5HDKA 5LRSA 2IW2A 2EFPA 1MATA 2HWVA 3MZHA 1ZG1A 1W5SA 2GXGA 4U76A 3GFIA 2A69F 5JHUA 3CUQB 3RYRA 4LLNA 1HSTA 2CO5A 3E5QA 3PKCA 3K1MA 1PP8F 2EFNA 2Q92A 3LA2A 1KU7A 2HDCA 3RPQA 5J6XA 3IWFA 3F6OA 2UXXA 1F4KA 4EJVA 2STTA 1KQ8A 5LEKA 3GFJA 4G94A 3CB6A 4N9IA 2IRFG 1E2XA 3TAVA 3C18A 1B9MA 2BBYA 1C27A 2VE9A 4HX4A 5DV5A 4AD9A 2BGCA 3L7GA 4LLGF 1MGTA 4BXUA 2GG8A 2HGCA 3F8MA 3KFWX 3J80K 3HOTA 3ECHA 4WF2A 1BJAA 4L9JA 2CQKA 2CWEA 4U0WA 2P7VB 3K0LA 4ZWPA 5CE6A 4LG0A 2YPRA 1JHHA 3CTZA 3E6DA 5HLHA 1WL6A 1XCVA 3NEUA 1IXCA 1OMIA 4P9UA 1RI7A 1Z6TA 2H27A 2EJRA 3DEUA 2GG9A 3IRQA 5K5RA 2HR3A 4M74A 2ISZA 4RS8A 4A6DA 2GG5A 2PMHA 2XROA 1FNNA 3GWZA 2Y0MA 4BQAA 3PKEA 2VN2A 2PG4A 1U2WA 1XMKA 5HDGA 2PMUA 1Z6RA 3MATA 2KJBA 3P7NA 3VB2A 3Q6DA 1T0FA 1U6GA 3ABUA 1FP2A 3EYYA 2M8EA 5CVIA 1Y1NA 4IU6A 3CJNA 4OIPF 1IW7F 1W7PA 3I53A 3R4KA 1OR7A 2G7HA 2UWMA 5E5BA 5E8IA 2L4MA 1JE8A 3BJOA 4Q4ZF 2RV8A 4BAYA 2TDXA 5DDGA 3V8JA 3GXOA 2KIUA 2Z9OA 2F5EA 5DD8A 5CVRA 4F7ZA 5HS8A 2Z3YA 5L3DA 4I0AA 1YFHA 1KYWA 5FD6A 4FX0A 4IRGA 5D6FA 1QZYA 2V1UA 2NQ7A 2IA1A 1J9IA 2R7DA 4BH9A 5LHGA 4G8XA 3VODA 1Z91A 3D0SA 5A2QK 1IXSB 3C7JA 1O7LA 1XDSA 3CDHA 1U5TB 3FM3A 3GX4X 2AS5F 3GF2A 1TNSA 1WN1A 1L0OC 3NRVA 4OMZA 4OOKA 4Q47A 4FLLA 2RNJA 3WGIA 3WG9A 2O03A 3BJ6A 1K6OA 1YW9A 1FSHA 3LSTA 5KK1A 1FT9A 1C0WA 3E5XA 4I01A 2GWRA 3GYHX 4XSXF 2JPCA 1REPC 3FXUA 1WBQA 5DCMB 1OYWA 1W5TA 3HSEA 2IW5A 3P9KA 1T38A 2XUBA 2BHAA 2GZ5A 1S29A 4JK1X 2EVMA 4I02A 5BOXA 4GCVA 1O3QA 3KP2A 2GU7A 3BDDA 3F23A 3DV8A 2BV6A 2XV4S 3TDZC 3KEOA 2GQQA 5E8GA 3KCCA 2DQRA 3O6BB 1XGOA 1BN5A 2GIVA 4KICA 5LGTA 1XN7A 4PGGA 2YSRA 1FBQA 3ERED 4QWQA 3P9CA 4KT5C 3FMQA 1DP7P 1O3TA 4HLXA 3FHZA 2A68F 1R1VA 3BJAA 1RZ4A 2DPDA 3F6VA 3FZVA 3V7SA 1LDKB 3LFKA 3WGGA 3RI4A 2VT3A 5DD4A 4KMFA 1JXSA 3FXRA 2PN6A 1YW7A 4A6EA 2O3FA 5E17F 1V4RA 3SXYA 4ESJA 2O8XA 1K78B 2OKNA 1W7PD 4KA4A 3IU9A 2DTRA 1Z7UA 1SMTA 1TNTA 2RN7A 3K9TA 1WQ2A 4EGZA 2V3XA 1ON1A 2G9WA 2L54A 4O6JA 1A04A 2HYGD 4LB5A 5ILSA 2DU9A 1MDMA 3E6MA 3SHFA 4EVIA 3IU8A 4FT8A 3ECOA 3WGHA 2Q94A 2ESNA 2G6PA 2NYXA 1IRGA 1CF7A 1QZZA 3GO5A 2VC0A 5F64A 1GXPA 2LF8A 3L24A 4N0BA 5LGUA 4QR8A 1J7KA 4JUQA 1R58A 3E6BA 3RPUA 3LAPA 1T6SA 5F1RA 3WTWC 2VONA 4EM0B 2GG3A 2EB7A 2QBYA 2DO7A 4MEYF 4N9HA 4Y15A 2MC3A 5TRDA 1OYYA 2P8TA 1QQIA 2KIFA 3IL2A 4R79A 5IT9Z 3ROUA 4KIBA 2OZ6A 3H3UA 1D8KA 1BM9A 5EEHA 2DBBA 4EV0A 1O3SA 3HRMA 4CICA 4S2TP 4E70A 1LQ1A 3HRSA 1A16A 1H9GA 3I5UA 2GA2A 4LLLA 5FB2A 1IAWA 4EJWA 4IRIA 1P4WA 3GUDA 4YFKF 2MLGA 2XAGA 3HOSA 1Y0UA 4MHGA 3WTVC 4AWXB 4P55A 2F5FA 2ZNYA 3GW2A 2Q8KA 3WTZA 4OIRF 4PV4A 2D2WA 4NQWA 2VBZA 3LWFA 3TGNA 2CSOA 1XGSA 4PDKA 1LVAA 3R6SA 1P4AA 4ZNGA 2PBIA 1FBSA 2O61A 2OZUA 1STZA 4HX8A 5LEJA 4XSZF 1ZLJA 4L9VA 3WE3A 3VFZA 5LHHA 1KP0A 3QPHA 5BPIA 2OAZA 3RJPA 1V3FA 1S6LA 4HF0A 1D3YA 2EFQA 2BWSA 5CIKA 4O5VA 1U3EM 2RDPA 1O57A 2B0LA 4KM3A 2P5VA 2XGXA 1OKRA 3W6JB 3U2RA 4KN4X 4LFUA 3E5UA 5CDLA 3KEQA 3M1EA 4ESBA 4Q5SF 2FA5A 2BHDA 2EK5A 2YR2A 1MD0A 2QWWA 3FMSA 4U71A 4L9TA 2ELHA 4DNCA 3OV8A 2FRHA 5HLIA 3SQNA 3ZN1A 4WCGA 4OIQF 5HDNA 3Q5FA 4R1HA 2OQGA 3ZMSA 1Z1DA 2L02A 5H20A 3WTYC 4XLNF 1J5YA 3HYIA 4WXDA 2HTJA 1M35A 3V8KA 2BWYA 5LGNA 1LJ9A 3BZ6A 2FBHA 4KFCA 2BN7A 3HUGA 2HFHA 4M71A 4B09A 4GYIA 4ENJA 1I1SA 1ZARA 4O3MA 1SFUA 3L7WA 2M87A 2L4AA 3IU7A 1PP7U 1BI3A 4I7HA 1E17A 4OINF 2BHBA 1R5GA 2W24A 4CDGA 5BPDA 1C21A 3B73A 3EQLF 2P5LC 4ON0A 2IVMA 1IRFA 4BHPA 5L3CA 4KMUX 2V3YA 5D6EA 4A0YA 1C22A 2YU3A 3W6KB 1KGSA 3U9GA 4G6QA 3SZPA 4HAMA 3TO9A 1C24A 2PLYA 1KU9A 1YQAA 4HLYA 2XVCA 4FHTA 2A3SA 2BEOA 4M9XA 2W84A 3L9FA 2HYFA 1MZBA 4XLPF 1PDNC 2MBFA 3WODF 1C23A 2FEZA 4HX7A 2P6TA 1YYVA 3LQQA 5BMZA 3R0JA 3E3VA 1IXRC 2XRNA 2V1DA 2XAQA 3JSOA 3PKAA 3REOA 1FOKA 3MQ0A 4U6JA 1KA8A 4CGZA 3RORA 5BS6A 4XRFA 1JAWA 3O2PE 2NRAC 1XMAA 4OMYA 1BC8C 3M8EA 1TQIA 2VE8A 4LB6B 5LBQA 3QP5A 3R60A 4HOBA 4FLKA 3QRFF 3HSFA 2LSOA 1LB2A 2FU4A 4HW0A 2HOWA 4S01A 2ZMEB 3KP4A 1DPRA 4PCQA 2H94A 2K4JA 1IN4A 5LRRA 4PZJA 2XAFA 2ZXJA 2QZ8A 2FE3A 4I98B 1LEAA 3KP5A 1XSXA 2NNNA 2XKOA 2Q96A 4M9ZA 5DYMA 4M9SA 2AXLA 1FYLA 4U7DA 5ED4A 2GGBA 1T2KA 1LDDA 5CLSA 1TW2A 2P6SA 1FLIA 1BIAA 1AOYA 2WWYA 4FUKA 4CO8A 4KIFA 3RKWA 1RUOA 1LNWA 1HW1A 3MZYA 2PFBA 2NQ6A 3VEPA 4R8HA 2W57A 3F22A 2JT1A 2BWTA 3CUOA 1YS7A 3V7RA 4LGWA 2ZBKA 4IECA 4MGRA 2IA0A 5HS7A 1KU2A 4G9YA 4K2EA 4G6DA 2HKXA 4RGUA 5IT9K 4U6CA 2QQBA 2BWXA 3SZTA 2V6CA 3FWEA 2BE5F 3HRTA 4U1BA 1J75A 4ZYDA 3F8BA 3GFMA 3WTXC 4ZYEA 4OIOF 5HOOA 3HSRA 5D5VB 4EM1A 1HXDA 4YIIA 1GHCA 2F5CA 3B02A 1MJAA 3R61A 3JAMZ 4AIKA 2D45A 2K4BA 3RKYA 3MAJA 2M30A 3T0YA 4B8XA 4GYGA 1CF7B 3CO7C 1S8NA 3J81Z 5FGMA 2FNPA 4P96A 3KZYA 3IC7A 2H6BA 1XSVA 1W4MA 5TJJA 3E97A 4EM2A 2L3DA 2WTEA 1FYKA 4HQMA 2EFWA 1FYMA 2GG7A 1J2XA 2DPUA 4M6XA 2YX7A 1FBUA 2Z99A 5E1WA 3ZPLA 3CUQC 2QVOA 2DQLA 4S04A 1K7AA 1R36A 2R7FA 2GTXA 4RGZ1 4L5JA 1USTA 2BH3A 3QOPA 4AIJA 2V1XA 4Q48A 5J8CA 1MJ9A 1XNZA 1B4AA 1B9NA 1FSEA 5FFXA 4HDVA 4ZYHA 3JTGA 4U0VA 3IKTA 2JTVA 1R5HA 2QQAA 1HKTA 4HDUA 1CHMA 1BIBA 2VBWA 4RZYA 5E1ZB 4XBFA 3F72A 2BWVA 4MNUA 2ZFWA 3ZP5A 2MATA 4IVNA 3ML6A 2CG4A 3RKXA 1H9TA 2FBKA 3D27A 2EVOA 4BNCA 2RGVA 1H0MA 1U5TA 2VT2A 3ISPA 4LK0F 3TOAA 4ASNA 5CJ9A 2MH9A 3HHHA 2W85A 4IDYA 2JSCA 3JW4A 2QYOA 4Y13A 1U78A 4U75A 4I0BA 5K5OA 1TBXA 2BB7A 1P4XA 1FY7A 5HS9A 4IKSA 2FNAA 3EUHA 3HHGA 2XAJA 1QO0D 1P2FA 2HZTA 5L3EA 3BP8A 2STWA 1EH7A 4KIGA 3FX3A 4U73A 1LEBA 2B3KA 3C1DA 2IPQX 5E1XA 5E20A 1AWCA 2B3HA 3MEXA 1SFXA 1B59A 1TQPA 1BC7C 2D1VA 4L5IA 4EGEA 2XHKA 5D8LB 4Y17A 3VOEA 1IN8A 4U0YA 5JVTA 2BWUA 1QPMA 2HOEA 4HYEA 2PI0A 3ZMZA 3I64A 1L3LA 3T8TA 2NAZA 3DP7A 3O3KA 2E7WA 2GU5A 4WXHA 3L2CA 2ZCWA 4Z2YA 5CVVA 4IF7A 4UUVA 2ZSGA 2NS0A 4QLCU 4WWCA 2V9VA 3FM5A 1U8RA 1F9NA 2EV6A 4P9FA 2JPBA 5DUIA 1IN6A 4NHJA 4YG2F 3DKWA 4WX9A 1TQMA 4MTEA 1I27A 4KN7X 2MH2A 2MD5A 1UFMA 2FMLA 4L0YB 1GXQA 1U5TC 2ZO4A 4I2OA 4TV7A 4A6WA 1K78A 3ZMVA 1D5VA 3DF8A 1ZREA 3ABTA 2P99A 3KLOA 1QNTA 2DK8A 2WC2A 2FQ3A 5ICEA 4BYYA 5D4SA 2V79A 1ON2A 3ZMDA 2ISYA 4A6VA 1FZPB 3GEZA 1G3YA 2O0YA 4ENKA 3KP3A 2PQ8A 2EA4A 2COMA 3RIRA 1QXZA 3KETA 2F5DA 3TKYA 4CXFA 2J5PA 4FO8A 3Q9VA 3IG4A 2Q95A 4ZWOA 1D8JA 5CDEA 4FLIA 4CYDA 1B1BA 3EYIA 4ETSA 2Y48A 3OOPA 1WLRA 4ZYGA 2P7CB 5AIQA 2DFIA 5H6QA 4U6ZA 3E6CC 2ADUA 3BWGA 5CVJA 2UZKA 4FLJA 1FPQA 3T5XA 1ODDA 3U1DA 4UXNA 3F8FA 4NB5A 4BHCA 4KNYA 1QXWA 3CB5A 3FMRA 2CFXA 1SMYF 2OU2A 4HQEA 4A12A 1I1GA 1ZH5A 2GG2A 3M8FA 2KIMA 4LG0B 1G6NA 2HTSA 4AIHA 4IRHA 1W2MA 3MX6A 4U88A 3F8NA 3BPVA 2CW0F 2IJLA 2GU6A 4MQ9F 1ZYRF 1R23A 5EEGA 3J7AO 3QPTA 1BOAA 2P4WA 3V7CA 2A6EF 4RGXA 2GAUA 5K1YA 1KYZA 3PQKA 4IKUA 4HZFA 3ZMTA 2X4HA 2NNYA 1YJ3A 2ZNZA 4EJTA 2LDUA 1MKMA 4I09A 4D0PA 2IA2A 1SD5A 1G3TA 3QAHA 1G3WA 1WWXA 3ELKA 3KLNA 1TW3A 2FXAA 1W7PB 4FKCA 3D5LA 4IHTA 3JAMK 2IT0A 2HQRA 4EJOA 1SD7A 3QU6A 2LNBA 3TDUC 5D5UB 3BITA 4UVCA 3S6BA 3R0AA 1ZRDA 3I4PA 3DQVC 5FLXZ 2VBYA 2P5KA 2BWWA 3J81K 1VTNC 4G7OF 4RB2C 3PQJA 4KYWA 3I58A 1UB9A 4U70A 5FO5A 3K1PA 3P9IA 3LAJA 4S00A 3BIQA 4IF4A 4LD5A 3RYPA 3I59A 3G3ZA 5LHIA 1O3RA 1HBXG 2E7XA 5JI6A 3ZMUA 2VODA 4WXCA 2A61A 2Q93A 4EJUA 1RNLA 2R3SA 2M45A 1YG2A 1I5ZA 4A5MA 4L0ZB 1BI0A 3WTSC 2FF4A 4CZZA 2ZKZA 3BOQA 2LKPA 2M1BA 1YLFA 3K1NA 1NHAA 4HF1A 1T39A 3TQNA 3DPLC 1IN5A 1Z05A 5IT3A 1OYIA 4EQQA 2Y75A 5ICGA 2PEXA 4OOIA