1XGMA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgmA01
1QZZA 2HS5A 3QPTA 1O3TA 1KU9A 3EDPA 2V6CA 3E97A 2AS5F 4YIIA 3O6BB 2F5DA 4KM3A 1YFHA 1C27A 1XCBA 2LF7A 5CLSA 3R61A 1TBXA 2L54A 4HX8A 2OU2A 4IECA 3ZMTA 4OOKA 2IT0A 2OQGA 5ILSA 1E17A 1HKSA 1R1VA 2CYYA 3B02A 1LDKB 2RN7A 1W5SA 1IZ1A 1M35A 3L7WA 1W4MA 2XKOA 1IN8A 2ZKZA 1LNWA 3I59B 3L9FA 2HWVA 1ZRDA 2CQKA 2K4JA 4WWCA 3FHZA 2MLGA 5FLXZ 4EJOA 4HBLA 3W6JB 4U0WA 5FD6A 2A68F 1G3WA 2V1DA 4G6DA 4AIKA 1T0FA 2FRHA 3J7AO 1OYWA 4JQFA 2FMLA 3SFZA 4OIQF 1QXYA 4U6ZA 2IJLA 1MGTA 1I1SA 5DEQA 1FP1D 3COAC 1ZHFA 1ZG1A 2Q0OA 3JAMK 4QWQA 3SQNA 4RZYA 3ZN1A 4ESJA 2E7XA 1STZA 2VC1A 3GXOA 1XN7A 3J81K 5H20A 2PI0A 2O0YA 1C24A 4ENKA 1BI0A 1QO0D 2KKOA 1SFUA 1P4AA 1RUOA 2A61A 2YR2A 4R60A 4LG0B 3I4PA 1UCRA 2NS0A 1FPQA 1FYMA 1ODDA 1MKMA 1DUXC 3IRQA 4LLLA 2O61A 2V1XA 5ED4A 5A2QZ 2D2WA 3NRVA 4LD5A 4FUKA 1UFMA 3D5LA 1K79A 3RKXA 4N9IA 2LNBA 4FLKA 1WY2A 2M30A 2NNNA 1G4DA 2FQ3A 4ZYGA 3IHUA 3K0LA 1BN5A 2V3XA 2M8EA 2K02A 1C23A 1T38A 4BAYA 1OYYA 2GXBA 2FA5A 5ICGA 2BE5F 4OOIA 4RZZA 1GXQA 5LGTA 4PNCA 3C18A 4MTDA 3ZMZA 3R6SA 2ETHA 1S7OA 3M9AA 4KICA 2HQNA 2C6YA 5HOOA 2FSWA 4YIFA 1F5TA 5LRRA 4GGGA 4M9ZA 2RDPA 4L9TA 3BP8A 4P55A 3KP7A 1TNSA 1Y1NA 1PV9A 1MDMA 3KLNA 1WWXA 5H6RA 1BC8C 1C22A 3OOPA 3C3WA 1BOAA 4RB3C 4IU6A 2KJBA 3V4GA 4G6QA 2WV0A 3RKWA 5HLIA 1B59A 2DFIA 4YFNF 5D5VB 4G8XA 2Q92A 1TQPA 4LGWA 4L9NA 1JE8A 4FX0A 2IPQX 4HF0A 5TJJA 3RYRA 1XGNA 5E1ZB 2QVOA 5E1XA 1CHMA 1U5TA 4YFXF 2W24A 3FMSA 2FF4A 1K7AA 1DDNA 1EV7A 3CB5A 3PFIA 1O3QA 4MATA 3TB5A 4UHTA 2CG4A 4CICA 2IW2A 2R3SA 3GW2A 3HUGA 4IKTA 2GZ5A 2EFPA 3CTZA 2HQRA 3KP2A 4BH9A 5CDEA 4KIFA 2QM3A 5IT9K 3GEZA 2XGXA 4A6DA 2M5WA 3TO7A 3FWEA 1Q1HA 1ON1A 1S7AA 3WTXC 3CB6A 3HTUA 2HYFA 1W2MA 2HTSA 3PKDA 1PUEE 1IN5A 4HLYA 3RI4A 4RB2C 4XBFA 2HOWA 2GTXA 3MATA 2WTEA 5FLXK 2QQ9A 5ILUA 3IRRA 2H6BA 2BWWA 1LEBA 1S3JA 4U6CA 4BNCA 2EB7A 4AIJA 2L3DA 5F1RA 3HRTA 2A5YB 1R22A 3GFLA 3KLOA 3IL2A 1B9MA 1QGPA 3N4MA 2EVMA 2P5KA 5ICFA 5DCMB 2ZXJA 5DD8A 3IG4A 5CDLA 3IC7A 2LKPA 2O6GE 4HLXA 5BPDA 4RGXA 2YPRA 1U2WA 2VOOA 1KU7A 2ESNA 1LDDA 5CJ9A 4LFUA 2G6PA 2QBYB 3IWFA 3TOBA 1B6AA 4ESBA 2Z3YA 2BHBA 3CUOA 1Z05A 4EJVA 3B73A 3KZZA 3T0YA 2IP2A 4HDUA 3E5QA 2FMYA 3DQVC 1LDJA 4H0EA 4M72A 3I58A 3D0SA 2GG9A 2EV5A 2QQAA 3JTHA 3WTZA 3PKEA 5A2QK 2Z99A 1BIAA 1Z9CA 4ETSA 3ZQ7A 5BQTA 5LBQA 2O3FA 3ABTA 1XGOA 5EEGA 3RDIA 1TW2A 2MLKA 1G3SA 2DPUA 4U70A 1YIOA 3Q9SA 5D6EA 2DQLA 1ZH5A 4RB1A 2ZCWA 1YS6A 3WE3A 3K2ZA 3LWFA 3QP5A 5ILVA 2W57A 2BWSA 3MWMA 4XSZF 2Z5UA 5HDKA 5JVTA 1R36A 1P4WA 2GU7A 5BS6A 3BIQA 3J81Z 4EJTA 2DQRA 2P98A 1AWCA 2NNYA 5KVRA 2EWNA 5KK1A 1B1BA 2EA2A 2YSRA 4UXNA 2IVMA 2OQRA 2EV0A 2WWYA 4CO8A 3L2CA 2FU4A 4Q47A 4EMSA 1XSVA 3MEXA 5FO5A 5DV5A 2NRAC 3TKYA 2PJPA 1ULYA 3CDHA 1D8KA 1W7PD 3LSTA 4LB6B 1C0WA 3PKAA 4P9FA 4UVAA 2P4WA 1WSUA 2QENA 3KETA 1HKQA 3F6VA 2ZBKA 1SFEA 1WL9A 3N97A 4ENNA 2ESHA 1RUNA 1IN6A 1O57A 4LJZF 1BJAA 4A6EA 5BOXA 3ZPLA 5BPIA 2BBYA 3T8TA 4AVPA 2R7FA 4ZNGA 1HKTA 4JBAA 1HSTA 2FBIA 3F8MA 2GGCA 4M6XA 4OIRF 3K9TA 2FNPA 3S2WA 2V3YA 4BHPA 4HF1A 3GFMA 3WTYC 4MEYF 4E70A 2IA2A 4CDGA 4AD9A 4WXCA 5L3CA 2KIMA 2ZNZA 4U69A 2BV6A 2DW4A 1SFXA 2YX4A 4ESFA 3MFKA 1K78B 1TW3A 2GG8A 4IHSA 3F6OA 5D8KB 4WF2A 3U1DA 2GG2A 1X3UA 1B9NA 4S2TP 1AOYA 2F5FA 3LQRA 3TOAA 5D4RA 1EH8A 5FGMA 4G7OF 1BIBA 2OZUA 1J9IA 3DFGA 4UNOA 2M87A 1IXRC 2HKXA 1HW5A 4KN4X 4OINF 2RC4A 3GZ6A 3ZN0A 5LRSA 3RPQA 1KQ0A 1IXCA 2DO7A 3O3KA 2BHDA 3PKCA 4HOBA 4P9UA 2VN2A 3LA2A 5IT9Z 4WXHA 1XGSA 3BY6A 3BOQA 4U71A 1O7FA 4G7ZF 4O6JA 2WC2A 5AONA 4Q48A 1XMKA 4S04A 2PLYA 4O5VA 3GYHX 2HTJA 4LK1F 2W85A 3BDDA 4M6YA 3TAVA 4HQMA 2BWTA 1WI9A 2XV4S 3PQKA 4KIGA 4S2RP 5IT3A 3ROUA 4EQQA 3RJPA 1XMAA 2VXZA 2K4BA 2VOPA 3F21A 3LQQA 2X4HA 3VOEA 5CDVA 3GFJA 4I01A 5D5UB 1UB9A 3LA3A 2V9VA 1G3TA 4EV0A 4A12A 1IAWA 4HA8A 4MQ9F 4U0VA 3HIFA 5FB2A 3V7SA 2OAZA 3U9GA 3TQNA 4G9YA 2OBPA 2Q8KA 1A04A 1CGPA 1XD7A 5BMZA 2JTVA 5AIQA 4B09A 1GHCA 2QLZA 1FBQA 2BWYA 1HW1A 4RGZ1 3IU9A 1SMTA 3ML6A 1T98A 3ZP5A 3DEUA 3T5XA 4LK0F 2PN6A 4U75A 4ZZLA 2RGVA 2GU5A 3I59A 3ZMSA 2XHKA 2OA4A 3GVAA 1KGSA 2BYVE 3G73A 1P2FA 2OD5A 4HYEA 4Q5SF 4M9XA 5E5BA 4HF2A 5K1YA 2E7WA 1NHAA 3BJOA 2VT3A 4A2UA 2HFHA 3FX3A 1D5VA 2D45A 4AIHA 4GYIA 5J6XA 4UUVA 3O2PE 1OPCA 1XDSA 4UV9A 5LEKA 2Q95A 3PKBA 4IRIA 1F9NA 4EM0B 3JTGA 1WRJA 4U6JA 3TO9A 1JGSA 1RNLA 3BJAA 1FYLA 1Z7UA 1KU2A 1ZGAA 1WQ2A 3I53A 4U0YA 4U76A 2VE9A 4LLGF 3TGNA 1V3FA 3VEPA 2J5PA 4IKUA 2ACJA 1R5GA 1ZG5A 3VFZA 4LG0A 5LHHA 1IF1A 2PMUA 2AXLA 2EJRA 3H3UA 1XSXA 3V7RA 5CVJA 5ICCA 3JSPA 1ZRCA 5D4SA 3P9CA 2GQQA 3WTWC 5J8CA 4RS8A 4A0XA 3M1EA 1FSHA 1USTA 2ZJ2A 2RNJA 2ZNYA 5FFXA 1S8NA 1QPMA 3FMQA 3EQLF 1ZLKA 4OMYA 4XRFA 3KP4A 1U5TC 2H27A 3WTUC 2HZTA 1PP7U 3S6BA 3RYPA 4G94A 2BWVA 1J0RA 1T2KA 4OIPF 2Q93A 4MHGA 5LHIA 3E5XA 2H6CA 2KJCA 1R58A 1MJ9A 4I09A 2VBWA 1K6OA 4OU0A 1TQMA 2BWUA 2Z33A 4HQEA 5TRDA 1XNZA 1MZBA 3I71A 2YU3A 4WXDA 4ZYHA 3C1DA 2M1BA 4L9VA 2P7CB 2JZYA 3VODA 2DI3A 2FBKA 4EM2A 5J8FA 5L3DA 4MNUA 2DBBA 2D1HA 4HX7A 2JSCA 2GIVA 4FO7A 3V8JA 4KN7X 4N0BA 3DF8A 3E6DA 1E2XA 1SD4A 3CLOA 5LHGA 3ISPA 1B4AA 3KE2A 4L0YB 2FNAA 1R1UA 3U2RA 3ZMDA 3TDUC 2B3KA 2CW0F 1IW7F 1D3YA 3E6CC 1SMYF 5JI6A 4EM1A 1VTNC 1UHMA 4HW0A 1WKMA 2V79A 5CVVA 5HDGA 2QWWA 1Z6RA 3KEQA 2ISYA 1FP2A 2D1VA 2P7VB 1CF7B 2O8XA 2F5CA 2GA2A 2IW5A 1XSDA 2JT1A 2DK5A 4CGZA 4OIOF 2XAJA 2RQPA 2QZ8A 2UZKA 3HSRA 3D27A 1TLHB 2GGBA 5L3BA 1Z1DA 2FE3A 4U6WA 4ZYEA 1FBSA 4QLCU 3IKTA 1SD5A 2A3SA 2RKHA 2KRFA 3CTAA 4MQVA 1J75A 2EK5A 4BHCA 4KT5C 4HX4A 4XLPF 4FLLA 4FHTA 2EFWA 2HGCA 3TO6A 3R60A 3HHHA 1YYVA 2K86A 3FMRA 4U73A 4WK8F 3BITA 2ZFWA 1ZYRF 3LAPA 1L0OC 1I27A 2W84A 2A6HF 2XASA 5DCMA 5E8IA 2GG0A 3WTTC 2L02A 3HSFA 3HTSB 1BM9A 4Q4ZF 1U3EM 4MGRA 3NQOA 3SHFA 4ZWOA 2QBYA 1A16A 4B28A 3JSOA 2GA1A 1JAWA 3HSEA 4CXFA 3P9KA 2VC0A 3MZHA 4I7HA 3J80Z 4U6EA 2A69F 2XIGA 3CUQB 1REPC 1USSA 3I0TA 2DU9A 4EJUA 3WTSC 1YG2A 2NAZA 4KUMA 5E1WA 2JPCA 3ZMUA 4Z2YA 5E18F 3WU0A 2VE8A 3C7JA 4FLJA 1OMIA 3BPXA 3G3ZA 4IF7A 1FT9A 5JR3A 4ASNA 2LDUA 4I2OA 1MJBA 5JHUA 4EGYA 3RORA 2DTRA 2VT2A 4FO8A 1EH6A 2QYOA 2CO5A 1D8JA 3M8FA 1FNNA 2P6TA 1LJ9A 4PZJA 1JXSA 4P5OA 4EGEA 4PCQA 2CSOA 1PDNC 1R7JA 4PGHA 2EVOA 3Q5FA 3I54A 1BI2A 4NB5A 3HRSA 4A6VA 3GZ5A 1FSEA 4KDPA 3EETA 3F3XA 2ZMEB 1YLFA 2L4MA 2VODA 2FOKA 4R8HA 1W7PB 2MD5A 5K5OA 1HBXG 3DP7A 3CJNA 2Q2EA 3BWGA 4CZZA 4HV6A 4LMYA 2NYXA 2STTA 1BC7C 3SZTA 4IDYA 2EFQA 3HOTA 1OKRA 2KIUA 1I1GA 3KP5A 1XGMA 3F8CA 2DT5A 3FZVA 2PQ8A 1W5TA 1Y0UA 2MH2A 1MD0A 3WG9A 1BI3A 3GUDA 3M8EA 4Z7MA 2BHAA 3L7GA 3F22A 4IJAA 1HXDA 3QOPA 1DPUA 1TTYA 1QZYA 4Y17A 4WCGA 2EVCA 1PP8F 2B0LA 5DUIA 1P92A 2GG5A 2HR3A 3ZMVA 2XUBA 3IU8A 4UV8A 1R1TA 4WX9A 1LVAA 5LGUA 1K78A 1C21A 2QQBA 4CHUA 4HV5A 3LAJA 5K5RA 4ZWUA 2STWA 1L3LA 1EH7A 1SD7A 1YS7A 3KP6A 5CVRA 4IXAA 1WLRA 2UXXA 3R0JA 5LEJA 4BXUA 4IKRA 1DP7P 1O0XA 5FCFA 4A6WA 2ZSGA 4LLNA 6PAXA 2BHCA 1S29A 3FXUA 5LGNA 2P5VA 4FT8A 3K1NA 2MBFA 3H3ZA 3GWZA 1HSJA 3DV8A 1ZN2A 3GO5A 5HS9A 4BHBA 1OR7A 2XAQA 1SD6A 1TNTA 4F7ZA 4B8XA 4S00A 2GU4A 4ZYDA 3DKWA 2COMA 3K1PA 4G7HF 1J2XA 2Y75A 1SAXA 3CO7C 1S6LA 5F64A 4EVIA 4IPAA 2BGCA 1ZAOA 3WGGA 2XRNA 2H94A 4I0BA 3J80K 4FX4A 3WODF 4XLNF 4ZZDA 1QQIA 1KQ8A 3L09A 1QXZA 3RIRA 3HOSA 3KZYA 2GAUA 5FFZA 4KFCA 5CYVA 2Z9OA 4RGSA 3H92A 1R5HA 4IKSA 4RAYA 5D5XB 1FBUA 3GF2A 4ZH4F 2BWXA 2ELHA 3R4KA 1ON2A 3WGHA 2GXGA 1U78A 1FYKA 2M45A 4ENMA 4A0YA 2EA4A 3BROA 2P8TA 4LB5A 3V8KA 2E1CA 1MDMB 1RIOH 1YW8A 2GU6A 4RGRA 2DAOA 3P7NA 3F8NA 4NHJA 2BN7A 1JHFA 3ELKA 3FXQA 1P4XA 3NEUA 5DYMA 2G9WA 2YX7A 1IRFA 2A07F 1HW2A 3K69A 1O7LA 4KA4A 4GCVA 5L3FA 4ZWPA 1DPRA 4L5JA 2IA1A 4R79A 1FWZA 4U88A 2P99A 4I0AA 1U8RA 5EEHA 3HRUA 3E5UA 2IRFG 1U5TB 2G7UA 5D8LB 3AAFA 1YVMA 1QBJA 2UXNA 4M74A 5HLHA 4MTEA 2EFNA 1ZRFA 4U7BA 2PBIA 1RI7A 2J5OA 2PFBA 3TDZC 4UVBA 1IN4A 3GX4X 2BH3A 4IRHA 2V3ZA 4XSXF 1KYZA 3E6BA 3ECOA 1RZ4A 1U6GA 2GG7A 2KIFA 2A6EF 2P9AA 3GFIA 1R23A 1YTYA 3RTRA 2XROA 4D0PA 1F1ZA 3SZPA 3K1MA 3R0AA 4UVCA 2Y48A 1YJ3A 1BBYA 4L0ZB 4ON0A 5DCFA 2GWRA 1Z6TA 1BI1A 3DPLC 5E17F 2BEOA 5JFRA 4YFKF 1F4KA 4IHTA 2HDCA 1KU3A 1J5YA 4R1HA 5CE6A 1I5ZA 5L3GA 1TQIA 4RAZA 4TV7A 3QP6A 3MX6A 3BJ6A 1MATA 2MATA 1WL6A 3KP3A 2F5EA 1O3RA 3WE2A 1GXPA 3EYIA 4Y15A 3REOA 3FXRA 4PGGA 2Q96A 3V8LA 2MH9A 1XDUA 5DD4A 3FM3A 2HOEA 5ERIA 1XCVA 2HYGD 1KQ9A 4RGUA 4IF4A 4S05A 4M71A 4HZFA 2IA0A 1G6NA 2ZO4A 4S01A 2DPDA 4KIBA 5HS8A 1YW9A 3T8RA 4L18B 2LSOA 2ADUA 3ULQB 3EUHA 5CVUA 4ENJA 1YQAA 1J59A 2B3HA 2W25A 3P9IA 1T6SA 3IU7A 3MQ0A 1O3SA 3SXYA 1LQ1A 1WBQA 1IRGA 4A5MA 3I64A 4KMFA 1G3YA 2O03A 3KFWX 5L3EA 3F8FA 2K7LA 2V1UA 1FY7A 5K5QA 1ZREA 1XB4A 1IXSB 3F23A 3LA7A 2CGPA 3QAHA 1V4RA 3LFKA 1UHWA 3E3VA 1ZLJA 2G7HA 4A0ZA 2MC3A 5FCHA 2JRTA 4FLIA 2BB7A 2XAFA 3WTVC 1N51A 1ONVA 2NQ6A 3VB2A 3GLXA 1HQCA 2PEXA 2GG3A 4OMZA 1LEAA 4A5NA 1QXWA 4FKCA 3QU3A 2XAHA 3QPHA 5DDGA 3CO6C 1FLIA 1CF7A 2VBYA 2RV8A 1KP0A 1FZPB 2XVCA 5CIKA 5LLQA 5E8GA 4U7DA 2XKPA 3MR1A 2ISZA 2HKOA 5H6QA 3BZ6A 4I98B 3RPUA 3IKVA 4IVNA 4GYGA 3KEOA 3T1BA 3HYIA 5DUKA 3FF5A 4EGZA 3RKYA 2Y0MA 2QUFA 3WU1B 3JAMZ 2VONA 1T39A 4QR8A 2DLLA 2K27A 1KA8A 3WGIA 1FX7A 2Q94A 3JW4A 2OKNA 5HDNA 5AIPA 5FD5A 3OV8A 4M9SA 3BPVA 3L00A 3F72A 2EV6A 2GZWA 1Z91A 4NQWA 2CWEA 2B3LA 3W6KB 4YG2F 4PV4A 3Q6DA 4K2EA 3IWZA 3MAJA 5F6FA 1R00A 1KYWA 3V7CA 1H9GA 2LF8A 4JUQA 2DK8A 1YO5C 2L4AA 4KNYA 1MJAA 2MA3A 2PMHA 1P6RA 1I6XA 1J7KA 1JHHA 1FOKA 4KMUX 5CVIA 4CYDA 2UWMA 5D5WB 2X0LA 3FM5A 1GVJA 3Q9VA 1H0MA 1OYIA 3DPTA 3CUQC 4MEXF 1W7VA 3F8BA 1IUYA 2JPBA 3HHGA 3CUQA 4L9JA 4GO1A 4DNCA 3ECHA 2VBZA 4RB0A 3EYYA 1WN1A 3L24A 4GXOA 2FEZA 3ERED 2RVCA 4BYYA 2P6SA 3PQJA 1YW7A 1ZARA 3I5UA 2H09A 2P5LC 2XAGA 2L01A 3HRMA 5ICEA 5HVQC 4M73A 4O3MA 3E6MA 4L5IA 5D6FA 1H9TA 4KYWA 1ZGJA 3BIPA 2HEOA 1ZG3A 4BQAA 1IN7A 4PDKA 2PG4A 1QNTA 4HDVA 1LB2A 3DXJF 2F2EA 4HAMA 4U1BA 2NQ7A 2R7DA 3ABUA 3MCZA 4N9HA 4AWXB 2E1NA 2EFOA 2CFXA 2FBHA 2VBXA 4I02A 4EJWA 5HLGA 1FC3A 2TDXA 4P96A 3M7GA 2ZMEA 4JK1X 5CNXA 3KCCA 4HXXA 3MZYA 5HS7A 1W7PA 4Y13A 3QRFF 3RVAA 3QU6A 4IRGA 2OZ6A 2FXAA 4DQ2A 5E20A
chains in the Genus database with same CATH superfamily
1QZZA 4ZTJA 2HS5A 3NWSA 3GTJJ 3QPTA 1O3TA 1KU9A 3EDPA 2V6CA 3E97A 1NK3P 2AS5F 4YIIA 2WBMA 3O6BB 1SVMA 2F5DA 2ZJRF 4KM3A 1G59A 5FKKA 3BLYA 2VJ4A 3QQAA 1YFHA 1G2HA 1C27A 4HNVA 4RBOA 1XCBA 2LF7A 1W0UA 5CLSA 4XMYA 4B3XA 2HI3A 3R61A 5M5YJ 1TBXA 2L54A 3F0CA 1JUMA 4HX8A 2OU2A 4IECA 3AG1H 3ZMTA 4OOKA 1JGGA 1XPXA 2IT0A 2R7SA 2OQGA 3VPRA 2XF7A 4IX7A 2I5UA 3TP0A 3OMYA 1HC8A 5ILSA 1E17A 1HKSA 1R1VA 1XC5A 2CYYA 1ZR2A 1LE8B 1VQ5I 3B02A 2X51A 1LDKB 1Y39A 1V5EA 2RN7A 1W5SA 1IZ1A 3L2VA 3PSFA 3L7WA 1M35A 2MYSA 4FE4A 1W4MA 4XL9A 2XKOA 1IN8A 2ZKZA 4CYCB 1LNWA 3I59B 3L9FA 2HWVA 3VYTB 2ECBA 1ZRDA 2CQKA 2L2OA 4XRSG 1ENHA 2K4JA 2WAEA 1IUFA 4WWCA 2X85A 3DEEA 2R7UA 2ZXWH 2YUSA 5F27A 3GTPJ 3FHZA 2JA2A 2MLGA 3SDBA 1K4SA 5FLXZ 4BGDA 4EJOA 5LFAA 4HBLA 3W6JB 2DXIA 4U0WA 5FD6A 1G8XA 1T0FC 1G3WA 2A68F 2V1DA 2IS6A 2CQNA 2RNGA 4G6DA 2CUFA 4AIKA 1T0FA 2FRHA 2NVUB 5KNLA 1IRZA 3A1YA 3J7AO 1M1EB 1OYWA 4JQFA 2FMLA 9ANTA 3SFZA 4OIQF 3FBIB 5GADJ 4BL0B 1LFPA 2R5ZB 3G71I 1QXYA 4U6ZA 3MZ8A 1VFCA 2IJLA 1MGTA 4PJLA 5DEQA 3LSRA 5E3LA 5IOZA 1I1SA 5EG0A 1FP1D 3COAC 1ZHFA 4RMNA 1ZG1A 3K4NA 2KZGA 3KX2A 2Q0OA 3JAMK 4QWQA 3SQNA 4RZYA 1TWAJ 3S2HJ 3BTIA 3ZN1A 4NBQA 4ESJA 2HOTA 5E79C 4A3EJ 2E7XA 1YHQI 1STZA 2VC1A 4ZDLA 3GXOA 1XN7A 3W2AA 3J81K 5H20A 3HOXJ 2PI0A 2O0YA 1YI2I 1BW5A 2LG4A 1C24A 4ENKA 1BI0A 1BR2A 1QO0D 5F08A 2KKOA 1SFUA 1P4AA 3WHCA 1RUOA 2A61A 1N77A 2YU9J 2YR2A 4N4NB 1MSFC 4R60A 4LIVA 4LG0B 3I4PA 2W7NA 1UCRA 2NS0A 1FPQA 3S3OA 2BW3B 1R71A 3RKQA 3OYGA 1FYMA 1ODDA 1MKMA 2LOOA 5GAGJ 1DUXC 4IHVA 4EEFG 3IRQA 5EZHA 5HNHA 4LLLA 2O61A 1UAAA 2V1XA 2LR8A 4RM2A 5ED4A 5A2QZ 2D2WA 3NRVA 4LD5A 3CF2A 4FUKA 4UUSA 3UR3C 1RC9A 1XG1A 1UFMA 3D5LA 1K79A 4E7SA 3RKXA 4N9IA 2LNBA 4FLKA 1WY2A 1D1AA 2M30A 2NNNA 5EF6A 1G4DA 3CMYA 1MH4A 2FQ3A 5BNGA 2K3FA 1JI8A 2E2JJ 3HPHA 4ZYGA 4M3GA 3IHUA 3K0LA 1BN5A 4GRIA 2WB1A 3I9V2 2V3XA 2M8EA 2K02A 1C23A 1DU0A 2BXYA 1ZR4A 1T38A 2QSHX 1OCRH 4BAYA 3LSHA 1OYYA 2DOAA 1N75A 2DT7B 2GXBA 2FA5A 2MC4A 5ICGA 3CCLI 2BE5F 4OOIA 4RZZA 1GXQA 5LGTA 1VQ7I 4PNCA 4C2TA 2XPVA 3C18A 4MTDA 3ZMZA 3R6SA 3DTKA 4JX5A 3FKIJ 2ETHA 3BTCA 1S7OA 3M9AA 4KICA 1K6YA 2HQNA 3U21A 2C6YA 1ETXA 2M34A 1QU3A 5HOOA 2ELJA 2FSWA 4YIFA 1F5TA 5LRRA 4GGGA 4M9ZA 2RDPA 1X3WB 4L9TA 3BP8A 4P55A 3KP7A 2CV2A 1MMAA 1TNSA 1Y1NA 3OWTA 1PV9A 4YEJA 1MDMA 3KLNA 2LRDA 4CSWA 1PJRA 1WWXA 5H6RA 1BC8C 1C22A 3MN2A 2KT0A 1I50J 3OOPA 3C3WA 2R7TA 3MMYB 4S0HB 4BJ6C 2KHMA 2EPFA 2HPIA 4ITVA 1BOAA 4RB3C 4IU6A 4FISA 2KJBA 3V4GA 2CH0A 4G6QA 3BQZA 2WV0A 3RKWA 1R4NB 5HLIA 2DOEA 1B59A 3WHBA 4M6VA 2DFIA 3IAS2 4YFNF 1YX3A 5D5VB 2RREA 1MMSA 2PMZN 4G8XA 1VQKI 2Q92A 1TQPA 4RM3A 4LGWA 4L9NA 4XR6A 1JE8A 4FX0A 2IPQX 3JRCA 2CFOA 4HF0A 5TJJA 3RYRA 4A3BJ 1XGNA 3QYFA 2QVOA 5E1ZB 3BR3A 5GP9A 2Y30A 3CP8A 5E1XA 2DA6A 3FBNB 2H1KA 1CHMA 2L9VA 1U5TA 4YFXF 3JCUC 2W24A 3FMSA 5CPRB 2FF4A 1K7AA 1DDNA 1EV7A 1S5LC 3CB5A 5J4VA 2BVLA 3PFIA 1O3QA 4MATA 3TB5A 4UHTA 2CG4A 4CICA 2IW2A 2R3SA 3GW2A 3HUGA 4IKTA 3LMMA 2F5VA 3OYAA 5EDNA 2GZ5A 2EFPA 3CTZA 1H88C 4Y52J 2ID3A 3OIOA 3L2RA 2HQRA 2M9HA 3ABLH 3KP2A 4BH9A 5CDEA 4KIFA 2QM3A 4IQ4A 4M3BA 5KAFC 5IT9K 3GEZA 2XGXA 4XN0A 4A6DA 2M5WA 3BR5A 2PX9A 3TO7A 2O9LA 3FWEA 1Q1HA 3SYTA 3GTGJ 1ON1A 1D1BA 2E1OA 3DTIA 5JHFA 1S7AA 3WTXC 3P5JA 5K7HA 3CB6A 2UUZA 3HTUA 2R5YA 2R7XA 5KCMA 1Z7LA 3CCMI 2HYFA 1W2MA 2HTSA 2WA0A 3PKDA 4E7LA 3G1MA 1PUEE 1WJFA 3AG2H 3W2WA 1H89C 1X1AA 3CCEI 3RPUD 3FDYA 3OR2C 1IN5A 2LY1A 4HLYA 3RI4A 4RB2C 1AKHB 3HL2A 2LKSA 4XBFA 3C2GA 2HOWA 3H1CA 3QWLA 4II2A 2GTXA 3K4CA 3MATA 2WTEA 5KHDA 1WVRA 2QQ9A 5ILUA 1MMNA 3CP2A 5J1UA 4A3DJ 5FLXK 2MD0A 1MMGA 3IRRA 2H6BA 2BWWA 1WJBA 1LEBA 1S3JA 3CJQB 1VQOI 4X0GA 4U6CA 4UB6C 4BNCA 3G4SI 2EB7A 5IP6A 5FKLA 3MKWB 1FIAA 2IBDA 1XTAA 4A3IJ 4AIJA 2L3DA 3HOZJ 5F1RA 3HRTA 2DMTA 3M4OJ 2A5YB 3H5RA 1R22A 3GFLA 1AA7A 2LY9A 3HXLA 3KLOA 2K5CA 3IL2A 5M5WJ 1B9MA 2XAUA 1QGPA 5FJ8J 3N4MA 2E1MB 2EVMA 2P5KA 5ICFA 5DCMB 2ZXJA 5DD8A 4HSRA 3IG4A 5CDLA 3IC7A 2LKPA 2E2IJ 2GLOA 2O6GE 4HLXA 4MFEA 5BPDA 2Z2SB 2OV7A 4RGXA 2LH9A 1U2WA 2V7FA 2YPRA 3I3LA 4UUTA 1KU7A 2VOOA 1HA8A 2ESNA 5J3LA 3ZQQA 1W5CC 1LDDA 5CJ9A 4XLHA 1CQTA 3BG6A 3BT9A 4LFUA 2G6PA 2QBYB 2NVQJ 3IV5A 3IWFA 1S9HA 2HNHA 3TOBA 3CMAI 1B6AA 4ESBA 2Z3YA 2BHBA 3CUOA 1Z05A 4EJVA 3B73A 3KZZA 3T0YA 2IP2A 4HDUA 1MBKA 3K4MA 1MIJA 3E5QA 1VNDA 4XOTA 1O4XA 2DCEA 3FIWA 3HOWJ 1HF0A 2FMYA 3DQVC 3OS0A 1LDJA 4H0EA 4M72A 4BE2A 3I58A 3HDDA 3D0SA 2XDVA 3PM1A 5FKOA 3OYCA 4A3MJ 2GG9A 2EV5A 2QQAA 3JTHA 3WTZA 1UMQA 3PKEA 5A2QK 2Z99A 1BIAA 1Z9CA 4XKVA 4ETSA 4UY8I 3S1QJ 3ZQ7A 5BQTA 5LBQA 2HQAA 2JA6J 1T08B 2CUJA 2O3FA 4CCOA 2GXAA 3ABTA 1XGOA 2DODA 5EEGA 2OPTA 3RDIA 2OTJI 1TW2A 3HGGA 2MLKA 2A6TA 1G3SA 1Y6IA 2E5NA 2DPUA 4U70A 1V5FA 1YIOA 2VJ5A 3Q9SA 3ZOBA 1VQMI 5D6EA 2DQLA 3RSNA 5K7ZA 1GDTA 4NDLA 5M5XJ 1ZH5A 2PMZA 4RB1A 2DA1A 4XRSA 1ITYA 2ZCWA 1YS6A 3WE3A 2MGQA 4Y4RA 4BDZA 3AG3H 3S8PA 3K2ZA 3LWFA 4Y7NJ 3QP5A 2M2EA 5ILVA 2W57A 2E71A 4D5CA 3MWMA 4IOAF 2BWSA 3DEWA 4XSZF 2Z5UA 2A05A 3CLQA 4OAYA 5HDKA 5JVTA 1OCPA 1R36A 3IUOA 1P4WA 2GU7A 2M4KA 5BS6A 3BIQA 3J81Z 2VI6A 4EJTA 2V4JC 2DQRA 1QVTA 4CCKA 1WGXA 2P98A 2NOGA 4PJNA 1TT0A 1AWCA 4XKCA 2NNYA 5KVRA 2EWNA 5KK1A 2VL8A 1B1BA 4G6TB 2EA2A 2YSRA 2EZLA 2ZXIA 3JRBA 4BY7J 4UXNA 1DU6A 3ZXSA 2IVMA 2E19A 2OQRA 1LKXA 2EV0A 2WWYA 4CO8A 3GTKJ 3L2CA 2FU4A 4Q47A 2F4MB 2ZXHA 3J7ZI 4EMSA 1XSVA 3MEXA 2LLKA 5FO5A 5DV5A 2NRAC 2CRGA 3TKYA 4IOCF 1IO2A 2PJPA 2B63J 1ULYA 3CDHA 1D8KA 1F43A 4H4KC 1W7PD 3K4LA 3LSTA 4LB6B 1C0WA 1UELB 2Q2EB 1I6HJ 4F93B 3PKAA 4P9FA 4UVAA 1YJNI 2DFHA 3CMMA 2P4WA 1WSUA 1A31A 2DA4A 2EBIA 2QENA 3KETA 1HKQA 3F6VA 3ZQHA 2ZBKA 1SFEA 1WL9A 3N97A 3S3NA 4ENNA 3TBIA 4HEA2 3GBGA 5B5EC 2ESHA 1RUNA 4BJTA 3GCMA 3QPSA 1IDYA 3ZR8X 3IH4A 1IN6A 2E60A 4RDUA 1O57A 4LJZF 1BJAA 4A6EA 3MD2A 5BOXA 2XB5A 3ZPLA 3HM5A 5BPIA 1VQ8I 2BBYA 2KRCA 3T8TA 2XF5A 4AVPA 2R7FA 4ZNGA 4ANJA 1HKTA 4JBAA 1HSTA 2FBIA 4ZYAA 4B3AA 3F8MA 2GGCA 2H8WA 4M6XA 4OIRF 3K9TA 3GLLA 1W0TA 1I3AA 2FNPA 3S2WA 3IH2A 4E7ZA 2V3YA 2JK3A 4BHPA 5EJCA 3ONQA 1WH7A 4HF1A 2CQQA 3GFMA 4BE0A 1E3PA 4X1EA 3WTYC 4D5FA 1B8IB 2LBFA 4MEYF 4E70A 2IA2A 4CDGA 4AD9A 2JA8J 4WXCA 1V54H 5L3CA 3K70C 2KIMA 2ZNZA 3A01B 1W36C 3DLAA 1VQ9I 4U69A 2BV6A 2DW4A 3OIPA 1SFXA 2YX4A 4ESFA 3MFKA 1K78B 1TW3A 3H5NA 2NVYJ 2HOAA 4CA0A 1X3ZB 3UNGC 2GG8A 1PUFB 4IHSA 2X48A 3F6OA 5D8KB 4U87A 2M8GX 4WF2A 2XB0X 5FRNA 2CQ7A 3U1DA 1X3UA 2ZSHB 4MO7A 2GG2A 2VQGA 4MIMA 1B9NA 2BHZA 3G2BA 4PJMA 1AOYA 2F5FA 4S2TP 3LQRA 1X2NA 3TOAA 5D4RA 2ZMEC 1EH8A 2LY2A 3CCYA 5FGMA 3PFYA 3LSMA 1LVKA 4G7OF 1BIBA 3JRHA 2HDWA 2OZUA 2NVTJ 1J9IA 3ASNH 3BTLA 3AL0C 3DFGA 2R7VA 4UNOA 1IC8A 2Z16A 2M87A 3HJEA 1IXRC 1TWHJ 1VZ0A 4KT6A 2LP0A 2HKXA 2ECCA 3F9KA 4BU2A 1HW5A 4KN4X 4CCJA 4OINF 2R7WA 2RC4A 3GZ6A 2MFZA 3ZN0A 5LRSA 3RPQA 1HCRA 3Q3SA 1D0XA 3IAM2 2RQQA 3OYDA 3DCFA 4PJ0C 1KQ0A 1IXCA 2DO7A 3O3KA 2OTLI 1RR8C 4OWRB 4FETA 1JTXA 2BHDA 3PKCA 4B43A 4A69C 4HOBA 4P9UA 3PNTA 2OUMA 4W97A 2VN2A 3LA2A 5IT9Z 1OISA 1Z67A 4WXHA 2R4GA 3M1CA 3CC7I 4NC7A 2CV1A 2ZC2A 1XGSA 3BY6A 3BOQA 4U71A 1O7FA 4G7ZF 1S72I 4DJAA 3SEQA 1VF9A 3H5AA 4O6JA 5GPAA 2WC2A 5AONA 4Q48A 1XMKA 3LSJA 4S04A 2PLYA 2DMPA 3OYKA 3OYIA 4O5VA 2NVXJ 2AQEA 4M3DA 5C4JJ 3GYHX 3JRAA 4YELA 2HTJA 1IG7A 4LK1F 3BG5A 2W85A 3BDDA 2VUMJ 4M6YA 3PJRA 3TAVA 1OJLA 4HQMA 2BWTA 1WI9A 2Y9ZA 2XV4S 1W1WE 2XRLA 3CZ6A 3PQKA 1YE9A 2ICWG 2M7AA 4KIGA 4ZDOA 4S2RP 2K9NA 2HXOA 4LG3A 3ROUA 4EQQA 5IT3A 3RJPA 1XMAA 2VXZA 2K4BA 2VOPA 3F21A 3RZDJ 3LQQA 2X4HA 3VOEA 5CDVA 2JA5J 3BR1A 3GFJA 4I01A 1ZQ3P 4LITA 5D5UB 1UB9A 2DN0A 3LA3A 2Y9YA 2V9VA 1G3TA 4EV0A 4A12A 4Y3OA 3CCUI 1IAWA 4HA8A 4MQ9F 1MBEA 3SJMA 4U0VA 1OCZH 2NS7A 3HIFA 2OAZA 3V7SA 5FB2A 2V6EA 3U9GA 3TQNA 3MKLA 5J4YA 3ABMH 4G9YA 5E3OA 2OBPA 2Q8KA 3L2QA 2JUCA 4A3CJ 2DFFA 1RKTA 1A04A 1CGPA 1XD7A 1YIJI 5BMZA 2JTVA 1HDDC 5AIQA 3H9GA 1LE8A 4B09A 1GHCA 2QLZA 1FBQA 4QPOA 2BWYA 2Q1ZB 1HW1A 1IJWC 4RGZ1 3IU9A 1SMTA 1Y56A 3ML6A 3QODA 1T98A 3A0HC 2R92J 3ZP5A 3DEUA 1MW7A 2EQRA 3T5XA 4LK0F 3DTEA 5IP7J 3J7YJ 2PN6A 3BC8A 4U75A 4J01A 1HDPA 2KLOA 5B3SH 4HSTA 4A3JJ 2IGMA 4ZZLA 2RGVA 3H9JA 4CYCA 2GU5A 3I59A 3ZMSA 2XHKA 4XLCA 4Z6YA 2OA4A 3GVAA 3OR1C 2VLAA 1TC3C 1ORKA 1KGSA 2BYVE 3G73A 1P2FA 4DIQA 2OD5A 1V5GA 3DU6A 4HYEA 4Q5SF 4M9XA 1RESA 2NS8A 5E5BA 4HF2A 5K1YA 4IQJA 2E7WA 3BJOA 1NHAA 2CJJA 2VT3A 3VSKA 4A2UA 3H36A 2DT6A 3CDIA 3KZIC 2HFHA 3PUBA 2LREA 4F91B 3FX3A 4F55A 4QTRA 5F1JA 2N8GA 5FLMJ 3S16J 1QHHD 1TWGJ 3BTJA 4C3IJ 1D5VA 2R5ZA 2D45A 1U9OA 2B7EA 3C2BA 4AIHA 3CD6I 4GYIA 4D7MA 5J6XA 5M3FJ 4UUVA 3O2PE 1OPCA 2E34A 1XDSA 4UV9A 5LEKA 2Q95A 2VB6A 3OOUA 3PKBA 2X9DA 4IRIA 1F9NA 2F4IA 3JRIA 1B72B 4EM0B 3DWLE 3JTGA 1WRJA 4U6JA 3TO9A 1JGSA 1RNLA 3BJAA 1FYLA 1Z7UA 4A3GJ 1KU2A 1ZGAA 1WQ2A 3I53A 3BR6A 4U0YA 4U76A 1U0JA 2VE9A 2TCTA 3L1PA 4M3FA 4LLGF 1Z77A 2E35A 3TGNA 2BXZA 5FLVA 1IV8A 1V3FA 1WPKA 2H8RA 3VEPA 1A6QA 2J5PA 3DKXA 4IKUA 5HODA 1R5GA 1ZG5A 2ACJA 3VFZA 4LG0A 5LHHA 2VQLA 2P0WA 1IF1A 4BE1A 1IDZA 2BW3A 2PMUA 2AXLA 2EJRA 3H3UA 2M4GA 1JUPA 2L7FP 1ZTRA 1XSXA 3TW6A 1D0YA 1ZKGA 2M0MA 2A5WA 1POGA 2EZIA 5CQEA 1WJCA 3V7RA 1T8IA 5CVJA 5ICCA 3JSPA 5M3MJ 2IS1A 1ZRCA 4UB8C 2V9KA 5D4SA 3P9CA 2GQQA 4NC8A 3WTWC 1WHUA 4D1QA 5J8CA 4RS8A 4A0XA 3HOUJ 1OFCX 1WJ5A 4ZC3A 3M1EA 2X6XA 1FSHA 1USTA 2ZJ2A 2X1CA 5IYBJ 2QA4I 5C3EJ 3ZGKA 2HZDA 3ABKH 2RNJA 3EPZA 2ZNYA 5FFXA 2OCEA 1S8NA 2LK2A 2R7QA 2PJRB 3TEDA 1I39A 1QPMA 3FMQA 4QIWN 3EQLF 1OLTA 2K9LA 3L2UA 1ZLKA 4OMYA 4PSXA 1WZ2A 4XRFA 2F48A 4AIDA 3KP4A 1U5TC 2H27A 3WTUC 3IH3A 1QRYA 2HZTA 1PP7U 3S6BA 3RYPA 4G94A 2BWVA 1Z0XA 3S1MJ 5EZGA 3B6AA 1J0RA 1T2KA 4XRMA 4OIPF 3KIOA 4MHGA 2I10A 2Q93A 1IV6A 5LHIA 3OYLA 3E5XA 4G12A 3A03A 1P9QC 2H6CA 2FUG2 2K3PA 2KJCA 1R58A 2E5ZA 1XS9A 1MJ9A 4AVZA 4I09A 2VBWA 1K6OA 4OU0A 2FD5A 1TQMA 3MKYB 2BY2A 1UHSA 2BWUA 3CQZJ 2Z33A 4HQEA 5TRDA 1HLVA 1RRJA 1XNZA 4B47A 1MZBA 3I71A 2YU3A 4WXDA 4MLOA 4ZYHA 3C1DA 3PNYA 3MKZA 2K40A 2M1BA 1MNEA 2V9PA 3W2VA 3FXLA 3CMEI 1X1CA 2GIZA 3DU5A 4L9VA 4RAGA 2P7CB 2JZYA 2LVSA 3VODA 4E7HA 2DI3A 2FBKA 4EM2A 4JOMA 1GVDA 2X1EA 5J8FA 5L3DA 4MNUA 3TMOA 4AYBA 2K9MA 2JN6A 2JVGA 4I6ZA 2DBBA 2D1HA 2KIQA 2QGUA 4HX7A 1BR4A 2JSCA 2GIVA 4FO7A 3HKZA 3V8JA 4KN7X 5EGOB 4N0BA 2VKDA 3S3MA 2OF7A 3DF8A 3E6DA 1E2XA 1SD4A 1WFXA 3FKJA 3CLOA 5LHGA 3S93A 4FCYA 3ISPA 1B4AA 3KE2A 4L0YB 1WCMJ 2FNAA 1R1UA 3U2RA 4YRVA 3ZMDA 4E7JA 2DMUA 3KEYA 3D5RC 3TDUC 4IZZA 1JKQC 3OYHA 2EIJH 1A6IA 1E3HA 5J47A 2CU7A 2B3KA 2CW0F 2XC7A 1IW7F 4B1RA 1D3YA 3KPHA 3LSPA 1SMYF 3E6CC 4FTHA 3U1KA 4EM1A 5JI6A 4DW6A 1VTNC 2IAIA 4B48A 1UHMA 4HW0A 2CMPA 1WKMA 2V79A 5CVVA 2XF6A 2DJIA 5HDGA 2QWWA 1Z6RA 1ETOA 2GOMA 3KEQA 3OYBA 2ISYA 1FP2A 2D1VA 2P7VB 1CF7B 2O8XA 1SAUA 2F5CA 2GA2A 3SEZA 2IW5A 1YRNB 3DBRB 1XSDA 3BQYA 2JT1A 2DK5A 4RAFA 4V19K 4CGZA 4QPQA 4OIOF 1D0ZA 2XAJA 2RQPA 2QZ8A 2UZKA 3OYJA 3HSRA 2DA2A 4XICA 1TLHB 2GGBA 3D27A 1S7EA 5L3BA 1Z1DA 1BJZA 2FE3A 2VASA 1NH3A 5J1YA 1UG2A 3HB9A 1AKHA 4U6WA 4ZYEA 1FBSA 4QLCU 4FE7A 3IKTA 1SD5A 5K7FA 2A3SA 2RKHA 2W48A 2KRFA 2KQRA 3FK7A 3CTAA 4MQVA 1J75A 5IOYA 2EK5A 2R7RA 4BHCA 4XLAA 4KT5C 4HX4A 3VYUB 4XLPF 1Z3YA 3A4CA 1BA5A 3VSLA 3QYBA 4FLLA 4FHTA 1RETA 2EFWA 4DYQA 2HGCA 3TO6A 3R60A 3HHHA 5IP9J 1YYVA 2K86A 2Y0SA 3FMRA 4XNFA 4U73A 2FJ1A 4NQWB 2E1MC 3G6EI 4WK8F 1BL0A 3BITA 1R49A 2ZFWA 1ZYRF 3LAPA 3TW7A 1L0OC 4V2FA 1I27A 1K83J 2W84A 2A6HF 2BHYA 2XASA 1UZCA 5DCMA 5E8IA 3KYLA 4BQQA 2D5VA 1ACIA 2GG0A 3K4BA 3WTTC 3S17J 2AO9A 3K4KA 3AG4H 1OCCH 1XMXA 2L02A 3HSFA 1BM9A 1Z3XA 4Q4ZF 3HTSB 2XPWA 5E3MA 5E3NA 3VYRB 1WJDA 1U3EM 4BEHB 4MGRA 3CCRI 3NQOA 1TWCJ 3SHFA 4ZWOA 1PYVA 2I8DA 2QBYA 1A16A 1E3OC 3BG3A 3JSOA 4B28A 2GA1A 3HEFA 1P7JA 4XLFA 1EKEA 2DA3A 3HSEA 4CXFA 1JAWA 3P9KA 2VC0A 3MZHA 4I7HA 3J80Z 3K70D 2IGKA 1N25A 2VIXA 4B44A 1W36D 4U6EA 1KONA 2A69F 2BOLA 2XIGA 3CUQB 1TWFJ 1ETYA 3S15J 4HG2A 3ZRGA 1USSA 1YJ9I 1REPC 3S32A 1SEUA 4J00A 2WAQA 2DU9A 3I0TA 4EJUA 3WTSC 4RLFA 2Y69H 1YG2A 2NAZA 2EIMH 4KUMA 5E1WA 3BZCA 2Y31A 2JPCA 3ZMUA 5GAEJ 5GTIC 1OCOH 1EJ9A 4Z2YA 5FKNA 5E18F 2JJ7A 3WU0A 1YJWI 1X19A 2VE8A 5LD2C 3PIPF 5DM7F 3LNQA 3I56I 3M3YJ 4BY1J 3C7JA 4FLJA 1OMIA 2ZFUA 1JKOC 2GM4A 3OL4A 1VQ6I 2CUZA 3BPXA 3G3ZA 4MFDA 4QSHA 4IF7A 3I4NJ 1FT9A 2XSJC 5B66C 5JR3A 2DTZA 4ASNA 2LDUA 4I2OA 4FASD 3PO2J 4EATA 2ZB9A 1MJBA 5JHUA 3G1OA 1NK2P 3HC7A 4EGYA 1Y8QB 2F4OB 3RORA 2DTRA 5HLTA 3OYMA 2VT2A 3OS2A 4FO8A 1EH6A 2QYOA 2CO5A 4NUBA 3GTMJ 1D8JA 3M8FA 3OL3A 3OY9A 1FNNA 2P6TA 1LJ9A 1K4TA 4PZJA 1JXSA 4P5OA 4EGEA 4PCQA 2CSOA 3CJRB 5FKMA 4BKXA 1PDNC 1R7JA 4PGHA 2BZTA 2EVOA 1FTZA 1R4MB 3CCVI 5J40A 5JLXA 3Q5FA 3ZQGA 1NG6A 1BI2A 2DYSH 3I54A 4NB5A 3HRSA 4A6VA 4XN3A 3B6CA 2EZHA 3KYCB 3GZ5A 1FSEA 1I3QJ 4KDPA 3EETA 3F3XA 1FOWA 1XX5A 2ZMEB 1YLFA 2L4MA 2VODA 2FOKA 4R8HA 3PIOF 1W7PB 3SFIA 2MD5A 5K5OA 2X6OA 1HBXG 1OQYA 5F0HA 3DP7A 4JX4A 3CJNA 2Q2EA 3BWGA 3MVPA 2BVMA 4CZZA 1U8BA 2B9SA 1EF4A 4HV6A 1VQPI 3E0JB 4D7NA 4LMYA 3CCJI 1T56A 2NYXA 1FOXA 2ZSIB 2STTA 1BC7C 3SZTA 4IDYA 3A2KA 3DPUA 4A3LJ 1K61A 2EFQA 1TZLA 4CUGA 3HOTA 1WJEA 2KP6A 2VQHA 3LSKA 4XKBA 2QQ8A 2VPRA 1OKRA 2KIUA 2M7BA 2XSDC 1I1GA 1PVEA 4M3EA 3FXKA 3KP5A 1J09A 3NARA 1XGMA 4CCMA 2FQ4A 3F8CA 3H9QA 2DT5A 3FZVA 1KZHA 2PQ8A 1W5TA 1Y0UA 2MH2A 1MD0A 3VDXA 3WG9A 1F36A 1BI3A 3GUDA 3M8EA 1MBFA 4Z7MA 1JT0A 2BHAA 3L7GA 3F22A 4IJAA 1ETVA 1HXDA 3QOPA 2BY1A 2M0CA 5TGTA 2KZVA 4BQNA 2QKMB 3UKGA 1DPUA 1TTYA 1X2MA 2W00A 1QZYA 3PO3J 2EZKA 4A93J 4Y33A 4Y17A 4WCGA 1VI0A 1B8IA 2EVCA 4C2MJ 1PP8F 2B0LA 2RAEA 5DUIA 1P92A 2GG5A 2HPMA 4JYKA 2HR3A 3ZMVA 3A01A 3PSIA 2XUBA 3IU8A 2JVHA 4UV8A 2IGOA 1R1TA 2VKVA 1LVAA 5LGUA 4WX9A 1K78A 1C21A 3LOCA 2P81A 2QQBA 1PUFA 4CHUA 2EILH 2VJJA 4HV5A 2DOFA 1SVOA 3LAJA 4IHYA 5K5RA 4ZWUA 2HXIA 5DTDA 3DBHB 2STWA 2NXNB 1L3LA 1EH7A 1SD7A 1YS7A 1Z21A 3KP6A 1JKRC 5CVRA 2ELKA 4IXAA 1WLRA 2HYJA 2UXXA 3BCBA 5B1AH 3R0JA 3WU2C 5LEJA 3AKZA 4BXUA 5EG0B 4IKRA 1DP7P 1O0XA 4C3JJ 3BR0A 4C30A 5FCFA 2X6YA 4A6WA 2ZSGA 3LL7A 2DYRH 3A02A 4F92B 2L9SA 4LLNA 4CCNA 6PAXA 1MNMC 3ASOH 4F3QA 4IL6C 2BHCA 1S29A 3FXUA 5C44J 5LGNA 2K9SA 3E7LA 2P5VA 4KISA 4FT8A 3K1NA 2MBFA 3H3ZA 3GWZA 1QPIA 1HSJA 3DV8A 3I4MJ 1ZN2A 4XKWA 3GO5A 1OR7C 1R9TJ 5HS9A 2OCCH 3VYSB 4BHBA 3OIQA 1OR7A 2XAQA 1SD6A 3QYEA 1D5YA 1TNTA 4F7ZA 1MBGA 2XPUA 1JT6A 1WI3A 2QSFX 3Q0VA 4B8XA 4S00A 2GU4A 1GLNA 4ZYDA 3DKWA 2COMA 3K1PA 4G7HF 3ESWB 1J2XA 3K7AJ 2Y75A 2DA7A 1SAXA 5F0CA 4BXFA 4AYBN 3C2HA 1OCTC 3CO7C 2HU9A 1S6LA 3CDLA 1BOBA 4UUSB 1E0EA 4I76A 5F64A 5J1RA 3FXJA 3HKZN 4LOCA 4EVIA 4IPAA 2Z1DA 2VKHA 2BGCA 1ZAOA 3OSGA 1MBHA 3WGGA 2XRNA 4PUSA 2H94A 4I0BA 4XM3A 3J80K 3HOVJ 4FX4A 2DJNA 3WODF 4XLNF 4ZZDA 1QQIA 2EIKH 1T95A 4PK4A 1KQ8A 4W1UA 2CV0A 3L09A 1QXZA 3K4JA 3RIRA 3GTOJ 3HOSA 3KZYA 2GAUA 5FFZA 1A35A 4KFCA 5CYVA 2Z9OA 4RGSA 3H92A 1R5HA 4IKSA 2LYCA 3JRDA 3J7AY 4RAYA 5D5XB 1BR1A 1FBUA 3M8JA 3S1NJ 3GF2A 4JP0A 4CH7A 4ZH4F 2BWXA 2ELHA 3R4KA 1ON2A 3WGHA 3E1SA 2GXGA 1U78A 1FYKA 2M45A 1QVUA 4ENMA 4A0YA 4KITB 2DDAA 3AFHA 3RQIA 4BDYA 2QF7A 2EA4A 3BROA 1X1DA 3H0GJ 2VJIA 3D1NI 1LFUP 2P8TA 1R5ID 2H1LA 4LB5A 1FMWA 3V8KA 2DA5A 2K85A 4DYRA 3D5SC 3ZCOA 2E1CA 4IHXA 1BW6A 2O7OA 1MDMB 1RIOH 2W4SA 4C2UA 1YW8A 3Q0UA 2GU6A 4RGRA 2DAOA 1LUJB 1SANA 3P7NA 3CESA 3F8NA 2DFEA 4NHJA 2BN7A 1JHFA 2QKLB 3ELKA 3FXQA 4A3KJ 2IEKA 3LSIA 2L7ZA 1P4XA 3NWTA 1FIPA 3SZGA 3NEUA 3FXOA 4A3FJ 5IY5H 4BBSJ 3H3VK 4DBQA 1MNDA 2OJED 5DYMA 2M3AA 2G9WA 2YX7A 1IRFA 2JA7J 1FEXA 2A07F 1HW2A 2HOSA 2GBYA 3K69A 4IKFA 2L5QA 1O7LA 1MSEC 1JKPC 4KA4A 4GCVA 5L3FA 2FX0A 3CC4I 2XGEA 4ZWPA 3H35A 1DPRA 3X2QH 4L5JA 2W1OA 3QPLA 2IA1A 4R79A 1FWZA 2KRHA 4U88A 2P99A 4I0AA 1U8RA 5EEHA 3HRUA 3E5UA 2ID6A 2IRFG 1U5TB 3JREA 1QA6A 2G7UA 5D8LB 3AAFA 5F04A 1YVMA 1QBJA 2Y0SN 4C3HJ 2UXNA 4M74A 2LFBA 3HPGA 5HLHA 2WY8Q 4BQOA 2DDBA 3EUKL 4MTEA 1B72A 1YITI 2EFNA 1ZRFA 4U7BA 2PBIA 1RI7A 3HUGB 2J5OA 5GAHJ 2HVSA 2PFBA 3A0BC 2VPLA 5DS9A 3TDZC 4UVBA 4AM3A 1IN4A 3GX4X 3LSGA 3OSFA 2BH3A 4IRHA 3ERMA 2IGNA 3K2AA 2V3ZA 5GTHC 4XSXF 1KYZA 3E6BA 4DZJA 3ECOA 2R0QC 1RZ4A 2CS3A 1V55H 2ME6A 4BS9A 1U6GA 2GG7A 4DBRA 4E4HA 3GMEA 3TL4X 2JWTA 1ETWA 1TP4A 2G0EA 4II3A 2KIFA 2ZJPF 2A6EF 2P9AA 1MH3A 3GFIA 1R23A 2TRTA 1YTYA 3RTRA 2XROA 3OYNA 2HDDA 2R93J 4D0PA 1JUSA 1F1ZA 3SZPA 2R5YB 3K1MA 3R0AA 4UVCA 2Y48A 3BZKA 1YJ3A 1BBYA 4OAZA 4L0ZB 2WAQN 4HNUA 4ON0A 5DCFA 2GWRA 3OYFA 1Z6TA 3O8GA 1BI1A 4PJJA 3DPLC 5E17F 3N05A 2XGDA 2BEOA 5JFRA 4YFKF 1A5JA 5JLWA 1NG7A 3ZQFA 1T33A 1F4KA 4IHTA 2HDCA 2L9RA 1KU3A 1J5YA 3BG9A 2Y2ZA 4R1HA 3RQ4A 5CE6A 5JVGF 1I5ZA 3BCAA 4GDFA 5L3GA 1YOVB 1TQIA 1DQUA 2KFDA 4RAZA 3CC2I 2PJRA 4TV7A 3QP6A 3MX6A 5KAIC 1ZGWA 2WADA 3BJ6A 1DGRM 1MATA 2MATA 4HNTA 1WL6A 3KP3A 2F5EA 1O3RA 3WE2A 3L2WA 4RA2A 1GXPA 3WG7H 3EYIA 4Y15A 3REOA 3GTQJ 4XORA 3FXRA 1FOYA 4ABZA 4PGGA 2LTPA 1SFKA 5H2FC 2Q96A 3V8LA 1IGNA 2MH9A 1XDUA 5DD4A 3FM3A 2HOEA 3H0DA 2HQ5A 2L9NA 5ERIA 1XCVA 5EYRA 1FJLA 1Y1VJ 2HYGD 2YS9A 2UV1A 3K10A 3JRFA 1KQ9A 4DGWB 4RGUA 4IF4A 4KJZA 4XLEA 4DOZA 4B4CA 4M71A 4S05A 2CQXA 4HZFA 2IA0A 1G6NA 2ZO4A 4S01A 2DPDA 3EUHC 4KIBA 5HS8A 1YW9A 3T8RA 4L18B 2LSOA 5C4XJ 2R7OA 2ADUA 2R7ZJ 4BJ5C 3ULQB 2KMUA 3EUHA 5CVUA 1ERDA 4ENJA 1YX5A 1ETQA 1YQAA 1J59A 2B3HA 3JRGA 2W25A 3P9IA 1JTYA 1T6SA 3IU7A 3MQ0A 1SFOJ 1SC7A 1O3SA 3SXYA 1AHDP 3Q0WA 1LQ1A 5FRMA 2ME0A 5IYDJ 3FISA 1WBQA 4LIUA 2DMQA 1IRGA 4A5MA 5CQGA 1VQNI 1N78A 3I64A 4KMFA 2F6CA 1QHGA 5CKTA 1G3YA 2O03A 3KFWX 4IEJA 5L3EA 5EGOA 3FK6A 3IP4B 3F8FA 2L7MP 2K7LA 4XK4A 2V1UA 1FY7A 5K5QA 2ZJQF 1GV5A 4J19A 1ZREA 1XB4A 4ZJZA 1IXSB 1ZELA 3HGYA 3F23A 3LA7A 2CGPA 3QAHA 3FXMA 1V4RA 3LFKA 1UHWA 1GUUA 3E3VA 1ZLJA 4AC0A 2G7HA 4A0ZA 2MC3A 5FCHA 4NC6A 2JRTA 2VQCA 3I55I 3CF5F 4N4OB 2E2HJ 4FLIA 3FHNA 2BB7A 2XAFA 3WTVC 4ZDPA 1N51A 1ONVA 2NQ6A 1RR7A 4GFBA 3VB2A 2O8KA 2VXDA 1EA3A 1JJ8C 1X4PA 2IXSA 3GLXA 1HQCA 1FTTA 2CW7A 2PEXA 4AU7A 1R6RA 3VWBA 4OMZA 2GG3A 5TISC 1LEAA 4P1WA 4A5NA 2QEXI 1QXWA 4FKCA 3SDGA 1Y1WJ 3QU3A 2XAHA 3QPHA 5DDGA 4AUXA 2LC2A 2MW8A 3CO6C 1ZK8A 1FLIA 1CF7A 2VBYA 2RV8A 3ZQCA 1KP0A 1FZPB 2XVCA 4XIDA 5CIKA 1LFBA 5LLQA 2O5RA 5E8GA 1YRNA 2AQFA 1ETKA 1UG0A 2JUGA 3PUFA 2AHQA 1DP3A 3KYDB 4U7DA 2XKPA 3MR1A 2DMNA 2ISZA 2HKOA 3V42A 2K9QA 2HVQA 5H6QA 3BZ6A 4I99C 1WH5A 4I98B 3RPUA 3IKVA 4IVNA 3TP3A 5DM6F 5F0FA 2KISA 1H8AC 1Y8RB 1X58A 2L0KA 4GYGA 3KEOA 2WV1A 3EUAA 4V2GA 1WJAA 3T1BA 3HYIA 4FQGA 3FF5A 5DUKA 4EGZA 3RKYA 2Y0MA 2JRMA 3S2DJ 2QUFA 3WU1B 3JAMZ 2VONA 2LD5A 3JR9A 1T39A 4QR8A 2DLLA 2K27A 1KA8A 3WGIA 1FX7A 1TT5B 3OS1A 1LPQA 1JJ6C 3JW4A 2OKNA 2Q94A 5HDNA 4CCLA 4XOPA 1A36A 2HVRA 2QCOA 3S1RJ 5AIPA 4X6AJ 5FD5A 3W6VA 2BY3A 3OV8A 4HPQA 4M9SA 3BPVA 3L00A 4PSWA 3F72A 3HOYJ 2EV6A 2GZWA 3M07A 2CW8A 1NTCA 2MG4A 1Z91A 4NQWA 4RLQA 2CWEA 2B3LA 3LFUA 3W6KB 4YG2F 1TL8A 3QOEA 4PV4A 3DLLF 3Q6DA 4K2EA 1HOMA 3IWZA 1Y0NA 3MAJA 3O8HA 5F6FA 2V26A 1R00A 1KYWA 3RCOA 3V7CA 2GOXB 1H9GA 1X1BA 2LF8A 4CZCA 2DK8A 4JUQA 3OYEA 1YO5C 4F52A 2L4AA 2X6WA 1U9NA 4KNYA 2AXTC 2EINH 1MJAA 3ZQIA 2MA3A 2MSYA 3K6GA 2COBA 2L7KA 4BEHA 2LBFB 2PMHA 4IO9F 3CJTB 1GT0C 1P6RA 4XONA 2XGCA 1VQLI 2KDOA 1I6XA 3G1LA 3CCQI 1J7KA 1JHHA 1FOKA 2KPMA 4KMUX 5CVIA 4CYDA 2LKXA 2UWMA 4E7KA 5D5WB 2X0LA 3FM5A 1GVJA 3Q9VA 1FMVA 1OYIA 3DPTA 3CUQC 4YIRX 4BACA 1H0MA 4MEXF 1W7VA 3F8BA 1IUYA 2JPBA 3HHGA 2V1NA 2W82A 2WAFA 2KDZA 1RPWA 4L5EA 1APLC 3W3CA 3CUQA 4L9JA 4GO1A 4DNCA 3ECHA 2VBZA 4RB0A 1QZEA 3EYYA 4E6KG 1WN1A 3L24A 1AU7A 4GXOA 4JX6A 3BR2A 4PFOA 2FEZA 2KL4A 3HBLA 3ERED 3CCSI 2JMWA 2RVCA 4BYYA 2P6SA 1X4OA 3PQJA 1YW7A 2X1DA 1ZARA 2OC6A 3I5UA 2H09A 1VQ4I 4HRIA 1SVLA 2P5LC 2LMDA 5IPAA 2EH3A 2XAGA 2L01A 3HRMA 1MMDA 3AL0B 4DZPA 2FOWA 4E7IA 1GV2A 2E36A 4BUPA 2BY0A 5ICEA 5HVQC 2QSGX 4M73A 4O3MA 3E6MA 4L5IA 3PNVA 5D6FA 1RKWA 1H9TA 4KYWA 3PL8A 1ZGJA 3ZQLA 2JSPA 2HEOA 3BIPA 4PFPA 1ZG3A 4BQAA 4IHWA 1IN7A 4PDKA 1D1CA 2PG4A 1QNTA 3GZNB 4HDVA 1LB2A 5IYCJ 3DXJF 2F2EA 4HAMA 3DKYA 1X1PA 5FROA 2JQ7A 4U1BA 2MABA 2NQ7A 5HNFA 2R7DA 4NNJA 4DYCA 5GPCA 3ABUA 3BG7A 3MCZA 4N9HA 1P7IA 2VKEA 4AWXB 2E1NA 2EFOA 2WB1N 2CFXA 2FBHA 2VBXA 4C9YA 4ZTFA 1MBJA 4I02A 3RZOJ 1IRXA 4EJWA 3NAUA 5EEAA 5HLGA 1FC3A 2TDXA 4P96A 4XQFA 2WY7Q 5B1BH 3M7GA 2ZMEA 3HG9A 4JK1X 4BBRJ 5CNXA 3KCCA 4HXXA 2IS2A 3MZYA 5HS7A 1DGWY 1W7PA 2NOJB 4Y13A 3S14J 3QRFF 3RVAA 3HZJA 3GTLJ 2CUEA 3QU6A 4IRGA 1Q1VA 2OZ6A 2FXAA 4DQ2A 2IS4A 3DBLB 4BXXJ 1UJ8A 4D9JA 5E20A
chains in the Genus database with same CATH topology
1QZZA 2HS5A 3QPTA 1O3TA 1KU9A 3EDPA 2V6CA 3E97A 2AS5F 4YIIA 3O6BB 2F5DA 4KM3A 1YFHA 1C27A 1XCBA 2LF7A 5CLSA 3R61A 1TBXA 2L54A 4HX8A 2OU2A 4IECA 3ZMTA 4OOKA 2IT0A 2OQGA 5ILSA 1E17A 1HKSA 1R1VA 2CYYA 3B02A 1LDKB 2RN7A 1W5SA 1IZ1A 1M35A 3L7WA 1W4MA 2XKOA 1IN8A 2ZKZA 1LNWA 3I59B 3L9FA 2HWVA 1ZRDA 2CQKA 2K4JA 4WWCA 3FHZA 2MLGA 5FLXZ 4EJOA 4HBLA 3W6JB 4U0WA 5FD6A 2A68F 1G3WA 2V1DA 4G6DA 4AIKA 1T0FA 2FRHA 3J7AO 1OYWA 4JQFA 2FMLA 3SFZA 4OIQF 1QXYA 4U6ZA 2IJLA 1MGTA 1I1SA 5DEQA 1FP1D 3COAC 1ZHFA 1ZG1A 2Q0OA 3JAMK 4QWQA 3SQNA 4RZYA 3ZN1A 4ESJA 2E7XA 1STZA 2VC1A 3GXOA 1XN7A 3J81K 5H20A 2PI0A 2O0YA 1C24A 4ENKA 1BI0A 1QO0D 2KKOA 1SFUA 1P4AA 1RUOA 2A61A 2YR2A 4R60A 4LG0B 3I4PA 1UCRA 2NS0A 1FPQA 1FYMA 1ODDA 1MKMA 1DUXC 3IRQA 4LLLA 2O61A 2V1XA 5ED4A 5A2QZ 2D2WA 3NRVA 4LD5A 4FUKA 1UFMA 3D5LA 1K79A 3RKXA 4N9IA 2LNBA 4FLKA 1WY2A 2M30A 2NNNA 1G4DA 2FQ3A 4ZYGA 3IHUA 3K0LA 1BN5A 2V3XA 2M8EA 2K02A 1C23A 1T38A 4BAYA 1OYYA 2GXBA 2FA5A 5ICGA 2BE5F 4OOIA 4RZZA 1GXQA 5LGTA 4PNCA 3C18A 4MTDA 3ZMZA 3R6SA 2ETHA 1S7OA 3M9AA 4KICA 2HQNA 2C6YA 5HOOA 2FSWA 4YIFA 1F5TA 5LRRA 4GGGA 4M9ZA 2RDPA 4L9TA 3BP8A 4P55A 3KP7A 1TNSA 1Y1NA 1PV9A 1MDMA 3KLNA 1WWXA 5H6RA 1BC8C 1C22A 3OOPA 3C3WA 1BOAA 4RB3C 4IU6A 2KJBA 3V4GA 4G6QA 2WV0A 3RKWA 5HLIA 1B59A 2DFIA 4YFNF 5D5VB 4G8XA 2Q92A 1TQPA 4LGWA 4L9NA 1JE8A 4FX0A 2IPQX 4HF0A 5TJJA 3RYRA 1XGNA 5E1ZB 2QVOA 5E1XA 1CHMA 1U5TA 4YFXF 2W24A 3FMSA 2FF4A 1K7AA 1DDNA 1EV7A 3CB5A 3PFIA 1O3QA 4MATA 3TB5A 4UHTA 2CG4A 4CICA 2IW2A 2R3SA 3GW2A 3HUGA 4IKTA 2GZ5A 2EFPA 3CTZA 2HQRA 3KP2A 4BH9A 5CDEA 4KIFA 2QM3A 5IT9K 3GEZA 2XGXA 4A6DA 2M5WA 3TO7A 3FWEA 1Q1HA 1ON1A 1S7AA 3WTXC 3CB6A 3HTUA 2HYFA 1W2MA 2HTSA 3PKDA 1PUEE 1IN5A 4HLYA 3RI4A 4RB2C 4XBFA 2HOWA 2GTXA 3MATA 2WTEA 5FLXK 2QQ9A 5ILUA 3IRRA 2H6BA 2BWWA 1LEBA 1S3JA 4U6CA 4BNCA 2EB7A 4AIJA 2L3DA 5F1RA 3HRTA 2A5YB 1R22A 3GFLA 3KLOA 3IL2A 1B9MA 1QGPA 3N4MA 2EVMA 2P5KA 5ICFA 5DCMB 2ZXJA 5DD8A 3IG4A 5CDLA 3IC7A 2LKPA 2O6GE 4HLXA 5BPDA 4RGXA 2YPRA 1U2WA 2VOOA 1KU7A 2ESNA 1LDDA 5CJ9A 4LFUA 2G6PA 2QBYB 3IWFA 3TOBA 1B6AA 4ESBA 2Z3YA 2BHBA 3CUOA 1Z05A 4EJVA 3B73A 3KZZA 3T0YA 2IP2A 4HDUA 3E5QA 2FMYA 3DQVC 1LDJA 4H0EA 4M72A 3I58A 3D0SA 2GG9A 2EV5A 2QQAA 3JTHA 3WTZA 3PKEA 5A2QK 2Z99A 1BIAA 1Z9CA 4ETSA 3ZQ7A 5BQTA 5LBQA 2O3FA 3ABTA 1XGOA 5EEGA 3RDIA 1TW2A 2MLKA 1G3SA 2DPUA 4U70A 1YIOA 3Q9SA 5D6EA 2DQLA 1ZH5A 4RB1A 2ZCWA 1YS6A 3WE3A 3K2ZA 3LWFA 3QP5A 5ILVA 2W57A 2BWSA 3MWMA 4XSZF 2Z5UA 5HDKA 5JVTA 1R36A 1P4WA 2GU7A 5BS6A 3BIQA 3J81Z 4EJTA 2DQRA 2P98A 1AWCA 2NNYA 5KVRA 2EWNA 5KK1A 1B1BA 2EA2A 2YSRA 4UXNA 2IVMA 2OQRA 2EV0A 2WWYA 4CO8A 3L2CA 2FU4A 4Q47A 4EMSA 1XSVA 3MEXA 5FO5A 5DV5A 2NRAC 3TKYA 2PJPA 1ULYA 3CDHA 1D8KA 1W7PD 3LSTA 4LB6B 1C0WA 3PKAA 4P9FA 4UVAA 2P4WA 1WSUA 2QENA 3KETA 1HKQA 3F6VA 2ZBKA 1SFEA 1WL9A 3N97A 4ENNA 2ESHA 1RUNA 1IN6A 1O57A 4LJZF 1BJAA 4A6EA 5BOXA 3ZPLA 5BPIA 2BBYA 3T8TA 4AVPA 2R7FA 4ZNGA 1HKTA 4JBAA 1HSTA 2FBIA 3F8MA 2GGCA 4M6XA 4OIRF 3K9TA 2FNPA 3S2WA 2V3YA 4BHPA 4HF1A 3GFMA 3WTYC 4MEYF 4E70A 2IA2A 4CDGA 4AD9A 4WXCA 5L3CA 2KIMA 2ZNZA 4U69A 2BV6A 2DW4A 1SFXA 2YX4A 4ESFA 3MFKA 1K78B 1TW3A 2GG8A 4IHSA 3F6OA 5D8KB 4WF2A 3U1DA 2GG2A 1X3UA 1B9NA 4S2TP 1AOYA 2F5FA 3LQRA 3TOAA 5D4RA 1EH8A 5FGMA 4G7OF 1BIBA 2OZUA 1J9IA 3DFGA 4UNOA 2M87A 1IXRC 2HKXA 1HW5A 4KN4X 4OINF 2RC4A 3GZ6A 3ZN0A 5LRSA 3RPQA 1KQ0A 1IXCA 2DO7A 3O3KA 2BHDA 3PKCA 4HOBA 4P9UA 2VN2A 3LA2A 5IT9Z 4WXHA 1XGSA 3BY6A 3BOQA 4U71A 1O7FA 4G7ZF 4O6JA 2WC2A 5AONA 4Q48A 1XMKA 4S04A 2PLYA 4O5VA 3GYHX 2HTJA 4LK1F 2W85A 3BDDA 4M6YA 3TAVA 4HQMA 2BWTA 1WI9A 2XV4S 3PQKA 4KIGA 4S2RP 5IT3A 3ROUA 4EQQA 3RJPA 1XMAA 2VXZA 2K4BA 2VOPA 3F21A 3LQQA 2X4HA 3VOEA 5CDVA 3GFJA 4I01A 5D5UB 1UB9A 3LA3A 2V9VA 1G3TA 4EV0A 4A12A 1IAWA 4HA8A 4MQ9F 4U0VA 3HIFA 5FB2A 3V7SA 2OAZA 3U9GA 3TQNA 4G9YA 2OBPA 2Q8KA 1A04A 1CGPA 1XD7A 5BMZA 2JTVA 5AIQA 4B09A 1GHCA 2QLZA 1FBQA 2BWYA 1HW1A 4RGZ1 3IU9A 1SMTA 3ML6A 1T98A 3ZP5A 3DEUA 3T5XA 4LK0F 2PN6A 4U75A 4ZZLA 2RGVA 2GU5A 3I59A 3ZMSA 2XHKA 2OA4A 3GVAA 1KGSA 2BYVE 3G73A 1P2FA 2OD5A 4HYEA 4Q5SF 4M9XA 5E5BA 4HF2A 5K1YA 2E7WA 1NHAA 3BJOA 2VT3A 4A2UA 2HFHA 3FX3A 1D5VA 2D45A 4AIHA 4GYIA 5J6XA 4UUVA 3O2PE 1OPCA 1XDSA 4UV9A 5LEKA 2Q95A 3PKBA 4IRIA 1F9NA 4EM0B 3JTGA 1WRJA 4U6JA 3TO9A 1JGSA 1RNLA 3BJAA 1FYLA 1Z7UA 1KU2A 1ZGAA 1WQ2A 3I53A 4U0YA 4U76A 2VE9A 4LLGF 3TGNA 1V3FA 3VEPA 2J5PA 4IKUA 2ACJA 1R5GA 1ZG5A 3VFZA 4LG0A 5LHHA 1IF1A 2PMUA 2AXLA 2EJRA 3H3UA 1XSXA 3V7RA 5CVJA 5ICCA 3JSPA 1ZRCA 5D4SA 3P9CA 2GQQA 3WTWC 5J8CA 4RS8A 4A0XA 3M1EA 1FSHA 1USTA 2ZJ2A 2RNJA 2ZNYA 5FFXA 1S8NA 1QPMA 3FMQA 3EQLF 1ZLKA 4OMYA 4XRFA 3KP4A 1U5TC 2H27A 3WTUC 2HZTA 1PP7U 3S6BA 3RYPA 4G94A 2BWVA 1J0RA 1T2KA 4OIPF 2Q93A 4MHGA 5LHIA 3E5XA 2H6CA 2KJCA 1R58A 1MJ9A 4I09A 2VBWA 1K6OA 4OU0A 1TQMA 2BWUA 2Z33A 4HQEA 5TRDA 1XNZA 1MZBA 3I71A 2YU3A 4WXDA 4ZYHA 3C1DA 2M1BA 4L9VA 2P7CB 2JZYA 3VODA 2DI3A 2FBKA 4EM2A 5J8FA 5L3DA 4MNUA 2DBBA 2D1HA 4HX7A 2JSCA 2GIVA 4FO7A 3V8JA 4KN7X 4N0BA 3DF8A 3E6DA 1E2XA 1SD4A 3CLOA 5LHGA 3ISPA 1B4AA 3KE2A 4L0YB 2FNAA 1R1UA 3U2RA 3ZMDA 3TDUC 2B3KA 2CW0F 1IW7F 1D3YA 3E6CC 1SMYF 5JI6A 4EM1A 1VTNC 1UHMA 4HW0A 1WKMA 2V79A 5CVVA 5HDGA 2QWWA 1Z6RA 3KEQA 2ISYA 1FP2A 2D1VA 2P7VB 1CF7B 2O8XA 2F5CA 2GA2A 2IW5A 1XSDA 2JT1A 2DK5A 4CGZA 4OIOF 2XAJA 2RQPA 2QZ8A 2UZKA 3HSRA 3D27A 1TLHB 2GGBA 5L3BA 1Z1DA 2FE3A 4U6WA 4ZYEA 1FBSA 4QLCU 3IKTA 1SD5A 2A3SA 2RKHA 2KRFA 3CTAA 4MQVA 1J75A 2EK5A 4BHCA 4KT5C 4HX4A 4XLPF 4FLLA 4FHTA 2EFWA 2HGCA 3TO6A 3R60A 3HHHA 1YYVA 2K86A 3FMRA 4U73A 4WK8F 3BITA 2ZFWA 1ZYRF 3LAPA 1L0OC 1I27A 2W84A 2A6HF 2XASA 5DCMA 5E8IA 2GG0A 3WTTC 2L02A 3HSFA 3HTSB 1BM9A 4Q4ZF 1U3EM 4MGRA 3NQOA 3SHFA 4ZWOA 2QBYA 1A16A 4B28A 3JSOA 2GA1A 1JAWA 3HSEA 4CXFA 3P9KA 2VC0A 3MZHA 4I7HA 3J80Z 4U6EA 2A69F 2XIGA 3CUQB 1REPC 1USSA 3I0TA 2DU9A 4EJUA 3WTSC 1YG2A 2NAZA 4KUMA 5E1WA 2JPCA 3ZMUA 4Z2YA 5E18F 3WU0A 2VE8A 3C7JA 4FLJA 1OMIA 3BPXA 3G3ZA 4IF7A 1FT9A 5JR3A 4ASNA 2LDUA 4I2OA 1MJBA 5JHUA 4EGYA 3RORA 2DTRA 2VT2A 4FO8A 1EH6A 2QYOA 2CO5A 1D8JA 3M8FA 1FNNA 2P6TA 1LJ9A 4PZJA 1JXSA 4P5OA 4EGEA 4PCQA 2CSOA 1PDNC 1R7JA 4PGHA 2EVOA 3Q5FA 3I54A 1BI2A 4NB5A 3HRSA 4A6VA 3GZ5A 1FSEA 4KDPA 3EETA 3F3XA 2ZMEB 1YLFA 2L4MA 2VODA 2FOKA 4R8HA 1W7PB 2MD5A 5K5OA 1HBXG 3DP7A 3CJNA 2Q2EA 3BWGA 4CZZA 4HV6A 4LMYA 2NYXA 2STTA 1BC7C 3SZTA 4IDYA 2EFQA 3HOTA 1OKRA 2KIUA 1I1GA 3KP5A 1XGMA 3F8CA 2DT5A 3FZVA 2PQ8A 1W5TA 1Y0UA 2MH2A 1MD0A 3WG9A 1BI3A 3GUDA 3M8EA 4Z7MA 2BHAA 3L7GA 3F22A 4IJAA 1HXDA 3QOPA 1DPUA 1TTYA 1QZYA 4Y17A 4WCGA 2EVCA 1PP8F 2B0LA 5DUIA 1P92A 2GG5A 2HR3A 3ZMVA 2XUBA 3IU8A 4UV8A 1R1TA 4WX9A 1LVAA 5LGUA 1K78A 1C21A 2QQBA 4CHUA 4HV5A 3LAJA 5K5RA 4ZWUA 2STWA 1L3LA 1EH7A 1SD7A 1YS7A 3KP6A 5CVRA 4IXAA 1WLRA 2UXXA 3R0JA 5LEJA 4BXUA 4IKRA 1DP7P 1O0XA 5FCFA 4A6WA 2ZSGA 4LLNA 6PAXA 2BHCA 1S29A 3FXUA 5LGNA 2P5VA 4FT8A 3K1NA 2MBFA 3H3ZA 3GWZA 1HSJA 3DV8A 1ZN2A 3GO5A 5HS9A 4BHBA 1OR7A 2XAQA 1SD6A 1TNTA 4F7ZA 4B8XA 4S00A 2GU4A 4ZYDA 3DKWA 2COMA 3K1PA 4G7HF 1J2XA 2Y75A 1SAXA 3CO7C 1S6LA 5F64A 4EVIA 4IPAA 2BGCA 1ZAOA 3WGGA 2XRNA 2H94A 4I0BA 3J80K 4FX4A 3WODF 4XLNF 4ZZDA 1QQIA 1KQ8A 3L09A 1QXZA 3RIRA 3HOSA 3KZYA 2GAUA 5FFZA 4KFCA 5CYVA 2Z9OA 4RGSA 3H92A 1R5HA 4IKSA 4RAYA 5D5XB 1FBUA 3GF2A 4ZH4F 2BWXA 2ELHA 3R4KA 1ON2A 3WGHA 2GXGA 1U78A 1FYKA 2M45A 4ENMA 4A0YA 2EA4A 3BROA 2P8TA 4LB5A 3V8KA 2E1CA 1MDMB 1RIOH 1YW8A 2GU6A 4RGRA 2DAOA 3P7NA 3F8NA 4NHJA 2BN7A 1JHFA 3ELKA 3FXQA 1P4XA 3NEUA 5DYMA 2G9WA 2YX7A 1IRFA 2A07F 1HW2A 3K69A 1O7LA 4KA4A 4GCVA 5L3FA 4ZWPA 1DPRA 4L5JA 2IA1A 4R79A 1FWZA 4U88A 2P99A 4I0AA 1U8RA 5EEHA 3HRUA 3E5UA 2IRFG 1U5TB 2G7UA 5D8LB 3AAFA 1YVMA 1QBJA 2UXNA 4M74A 5HLHA 4MTEA 2EFNA 1ZRFA 4U7BA 2PBIA 1RI7A 2J5OA 2PFBA 3TDZC 4UVBA 1IN4A 3GX4X 2BH3A 4IRHA 2V3ZA 4XSXF 1KYZA 3E6BA 3ECOA 1RZ4A 1U6GA 2GG7A 2KIFA 2A6EF 2P9AA 3GFIA 1R23A 1YTYA 3RTRA 2XROA 4D0PA 1F1ZA 3SZPA 3K1MA 3R0AA 4UVCA 2Y48A 1YJ3A 1BBYA 4L0ZB 4ON0A 5DCFA 2GWRA 1Z6TA 1BI1A 3DPLC 5E17F 2BEOA 5JFRA 4YFKF 1F4KA 4IHTA 2HDCA 1KU3A 1J5YA 4R1HA 5CE6A 1I5ZA 5L3GA 1TQIA 4RAZA 4TV7A 3QP6A 3MX6A 3BJ6A 1MATA 2MATA 1WL6A 3KP3A 2F5EA 1O3RA 3WE2A 1GXPA 3EYIA 4Y15A 3REOA 3FXRA 4PGGA 2Q96A 3V8LA 2MH9A 1XDUA 5DD4A 3FM3A 2HOEA 5ERIA 1XCVA 2HYGD 1KQ9A 4RGUA 4IF4A 4S05A 4M71A 4HZFA 2IA0A 1G6NA 2ZO4A 4S01A 2DPDA 4KIBA 5HS8A 1YW9A 3T8RA 4L18B 2LSOA 2ADUA 3ULQB 3EUHA 5CVUA 4ENJA 1YQAA 1J59A 2B3HA 2W25A 3P9IA 1T6SA 3IU7A 3MQ0A 1O3SA 3SXYA 1LQ1A 1WBQA 1IRGA 4A5MA 3I64A 4KMFA 1G3YA 2O03A 3KFWX 5L3EA 3F8FA 2K7LA 2V1UA 1FY7A 5K5QA 1ZREA 1XB4A 1IXSB 3F23A 3LA7A 2CGPA 3QAHA 1V4RA 3LFKA 1UHWA 3E3VA 1ZLJA 2G7HA 4A0ZA 2MC3A 5FCHA 2JRTA 4FLIA 2BB7A 2XAFA 3WTVC 1N51A 1ONVA 2NQ6A 3VB2A 3GLXA 1HQCA 2PEXA 2GG3A 4OMZA 1LEAA 4A5NA 1QXWA 4FKCA 3QU3A 2XAHA 3QPHA 5DDGA 3CO6C 1FLIA 1CF7A 2VBYA 2RV8A 1KP0A 1FZPB 2XVCA 5CIKA 5LLQA 5E8GA 4U7DA 2XKPA 3MR1A 2ISZA 2HKOA 5H6QA 3BZ6A 4I98B 3RPUA 3IKVA 4IVNA 4GYGA 3KEOA 3T1BA 3HYIA 5DUKA 3FF5A 4EGZA 3RKYA 2Y0MA 2QUFA 3WU1B 3JAMZ 2VONA 1T39A 4QR8A 2DLLA 2K27A 1KA8A 3WGIA 1FX7A 2Q94A 3JW4A 2OKNA 5HDNA 5AIPA 5FD5A 3OV8A 4M9SA 3BPVA 3L00A 3F72A 2EV6A 2GZWA 1Z91A 4NQWA 2CWEA 2B3LA 3W6KB 4YG2F 4PV4A 3Q6DA 4K2EA 3IWZA 3MAJA 5F6FA 1R00A 1KYWA 3V7CA 1H9GA 2LF8A 4JUQA 2DK8A 1YO5C 2L4AA 4KNYA 1MJAA 2MA3A 2PMHA 1P6RA 1I6XA 1J7KA 1JHHA 1FOKA 4KMUX 5CVIA 4CYDA 2UWMA 5D5WB 2X0LA 3FM5A 1GVJA 3Q9VA 1H0MA 1OYIA 3DPTA 3CUQC 4MEXF 1W7VA 3F8BA 1IUYA 2JPBA 3HHGA 3CUQA 4L9JA 4GO1A 4DNCA 3ECHA 2VBZA 4RB0A 3EYYA 1WN1A 3L24A 4GXOA 2FEZA 3ERED 2RVCA 4BYYA 2P6SA 3PQJA 1YW7A 1ZARA 3I5UA 2H09A 2P5LC 2XAGA 2L01A 3HRMA 5ICEA 5HVQC 4M73A 4O3MA 3E6MA 4L5IA 5D6FA 1H9TA 4KYWA 1ZGJA 3BIPA 2HEOA 1ZG3A 4BQAA 1IN7A 4PDKA 2PG4A 1QNTA 4HDVA 1LB2A 3DXJF 2F2EA 4HAMA 4U1BA 2NQ7A 2R7DA 3ABUA 3MCZA 4N9HA 4AWXB 2E1NA 2EFOA 2CFXA 2FBHA 2VBXA 4I02A 4EJWA 5HLGA 1FC3A 2TDXA 4P96A 3M7GA 2ZMEA 4JK1X 5CNXA 3KCCA 4HXXA 3MZYA 5HS7A 1W7PA 4Y13A 3QRFF 3RVAA 3QU6A 4IRGA