1XGMA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgmA01
4EJWA 1QXYA 4KICA 3DPTA 5HS9A 2RN7A 3EYIA 5ILUA 3KP5A 1ZARA 4U0YA 2NAZA 4MQVA 2A07F 2UZKA 4MEYF 1XSDA 4PNCA 3PQKA 4LMYA 2XAHA 2HR3A 1V3FA 1IRGA 5FLXZ 5IT9Z 3R60A 3ZMUA 1FY7A 3WTYC 5LHIA 4WX9A 2VBYA 4A5NA 1GVJA 3V7RA 2EFOA 2JPCA 1Z1DA 2FU4A 1TNTA 1P4WA 2PFBA 3DEUA 2RQPA 2EK5A 1XNZA 1OYYA 4G8XA 2DTRA 2ZCWA 4GXOA 1HSJA 1A16A 1BN5A 2GG9A 3QRFF 4LLLA 2NYXA 4LK0F 5H20A 4Z7MA 1KA8A 1RUNA 1E17A 4WCGA 5CLSA 3D5LA 1SMTA 2VONA 4PCQA 2QYOA 2FBHA 4YFNF 2QVOA 2ZMEB 2P4WA 2CSOA 3WTZA 4BHPA 4EGYA 4RB1A 1WN1A 2QBYA 2BH3A 2P9AA 2HYGD 1NHAA 1IN6A 1FP2A 3GFIA 2XVCA 2LKPA 5CIKA 3J81K 4HYEA 5E8IA 1XB4A 4U88A 2VC1A 1R1UA 2HQNA 4HAMA 1LNWA 4EVIA 1Z05A 2NRAC 4A12A 1FBSA 2CFXA 1JHHA 5BOXA 3RORA 3ECHA 3U1DA 4S01A 2M30A 2FNAA 4PGHA 3PFIA 3WTXC 2HWVA 2NS0A 1J59A 2DT5A 1XSVA 2MATA 2O3FA 1C22A 2ZSGA 1R5GA 2BWXA 4S2TP 1ZG3A 1O7FA 3B73A 4HF0A 3WG9A 2A3SA 5DCFA 1WKMA 3K69A 4MATA 1MDMA 2MA3A 5L3FA 2ZNYA 4IECA 1XD7A 2B3KA 4L5JA 5CVRA 4HLYA 2F5EA 3G73A 2EFNA 2W85A 3WGIA 1CF7A 2BWWA 3M8FA 2HOEA 2BYVE 2X0LA 4UNOA 4ZYEA 4P9UA 4JUQA 1R23A 4BQAA 4MGRA 1TBXA 2HFHA 4U75A 2PQ8A 3H92A 3O3KA 3E5UA 3SXYA 4OOIA 3CTZA 1BBYA 1D8KA 3FMQA 2AXLA 3J7AO 2V3XA 3WTWC 2A68F 5FFXA 5DDGA 4ASNA 1MGTA 3CLOA 3MEXA 5LEKA 2A6EF 3F6VA 2FXAA 4NB5A 1O3QA 1BM9A 4UXNA 5K1YA 2Y75A 4EQQA 4A0YA 2CO5A 1XN7A 5DCMB 4DNCA 1RI7A 3KZYA 1RZ4A 4HQMA 4P9FA 3WTTC 1O7LA 5JHUA 2HEOA 1HKTA 1ZH5A 2UXNA 1OPCA 4UV8A 1ZG1A 2ZJ2A 4G6QA 4UUVA 1XGNA 5BPDA 2EVCA 2Q0OA 4O5VA 2PEXA 5K5OA 1IN5A 1V4RA 4HA8A 1MATA 1T0FA 2QM3A 1DP7P 4KN4X 4Q5SF 1HW2A 4Z2YA 4AD9A 1QZZA 2GXBA 2XKOA 3GYHX 2GGBA 2WWYA 1R22A 5D8LB 2O61A 1PUEE 4P5OA 4G9YA 5ILSA 3ABTA 3TAVA 3L7WA 1P4XA 4ZH4F 5JR3A 5CDLA 2H6CA 4RGSA 4MHGA 1MJAA 2AS5F 3GZ5A 5LHGA 1R1VA 2CGPA 3V4GA 3WU0A 1L0OC 3GVAA 3RPUA 4MTDA 3WTUC 4M73A 2ZO4A 3EETA 3HOSA 3GO5A 1L3LA 2HQRA 3HTUA 3M1EA 1MJ9A 4ZYDA 4FHTA 3V8LA 2EA4A 4NQWA 3ZN1A 1Z6RA 3DQVC 3DFGA 1T6SA 2TDXA 3L7GA 2HOWA 2CWEA 4LFUA 1J0RA 3MWMA 3R0JA 4IF4A 2GAUA 2VT3A 2ZNZA 2YPRA 2XV4S 2H27A 4E70A 4EMSA 3VODA 3SQNA 4I98B 2DK8A 4L9NA 5FGMA 1FYKA 2XAJA 2LF8A 2Z33A 1DPRA 1FNNA 4B09A 1P6RA 3C1DA 2R3SA 4KIFA 3IU9A 4M6XA 2H6BA 4FUKA 1T2KA 3J81Z 3N4MA 2VXZA 4HX8A 2XAFA 2DPUA 4NHJA 3CUQB 2PG4A 5E8GA 3MZYA 4XLNF 1J7KA 3OV8A 3DPLC 1OYWA 4CHUA 3E6CC 4U69A 2JSCA 2O8XA 5D5UB 3BJAA 4L18B 2GG8A 1F9NA 2IP2A 3WE3A 2QWWA 1Y1NA 3O6BB 2IA0A 2STTA 2VN2A 4KYWA 3NQOA 5FB2A 5JVTA 4M9SA 2JRTA 5LRRA 2M1BA 5K5RA 3GFMA 2EWNA 5JI6A 4RB0A 1XDUA 2DO7A 5CYVA 1W7VA 3I58A 1U8RA 1QXZA 4EGEA 1S6LA 5LHHA 3EQLF 1WSUA 1PP8F 4KA4A 1F1ZA 2OU2A 1ULYA 2H09A 2DQLA 1M35A 1OKRA 3N97A 4KT5C 1I6XA 3I64A 1G6NA 2CYYA 5CJ9A 3RYRA 4A6WA 3SFZA 4ENJA 5JFRA 3SHFA 2Z5UA 2X4HA 3BJOA 1X3UA 2EV0A 3MAJA 5CVUA 1WL9A 1O0XA 2YU3A 4LLNA 4OIPF 5TJJA 2GU7A 3BITA 1KU3A 2FE3A 1DUXC 1R7JA 2CG4A 2MBFA 5ICCA 4M9XA 3IWZA 3T8RA 3P9IA 3HSFA 1LVAA 1K78A 2QLZA 1HBXG 3TQNA 2IRFG 1C23A 1ZLKA 1TW3A 2Y0MA 1ON2A 4ZZLA 4HDVA 1TNSA 3I0TA 4U76A 3F8BA 2A6HF 2W57A 2P7CB 3V8KA 4MQ9F 4DQ2A 1JAWA 4EGZA 1B59A 2F5CA 1YFHA 4ZWOA 5L3EA 3LQRA 3TO6A 4LG0B 2L3DA 1QNTA 2IA1A 3BIPA 1ODDA 2GG7A 4IRHA 4A2UA 4BH9A 1W7PB 4PGGA 3F72A 1Y0UA 2L54A 2EB7A 1I27A 2VODA 3F8MA 4I0AA 3HUGA 1KP0A 3RYPA 1LDDA 1EH7A 2DAOA 2FRHA 1K79A 4LLGF 2JZYA 4BYYA 2XAQA 3L9FA 1GXPA 4FLJA 3K1NA 4HV6A 4G7HF 3P7NA 4N0BA 2RVCA 3KLNA 4HX4A 3V7CA 3O2PE 4WWCA 3KFWX 2GG0A 5BMZA 5CDEA 4XRFA 2ZFWA 3FF5A 3ERED 4Y15A 5J8CA 1SD5A 4HW0A 3RJPA 2VBXA 1IZ1A 4IKTA 2BGCA 1KU2A 1OR7A 1P2FA 3CB6A 2K4JA 2M45A 1FPQA 4YIFA 2VC0A 3FM5A 2NQ7A 4GCVA 1U78A 2VE8A 3I59B 1ON1A 5EEHA 1YQAA 4RZYA 2BWYA 2QUFA 3J80Z 2B0LA 3F23A 4RGZ1 5FFZA 3E6BA 4BAYA 4IKUA 3QP5A 3PKAA 2G9WA 2HTJA 4A6EA 1SD6A 4RS8A 1U2WA 1ZRDA 4CDGA 3NEUA 2L01A 3EUHA 4OU0A 2RGVA 2BHBA 3ECOA 1B9MA 4CICA 1ZN2A 3CTAA 2J5OA 1JE8A 4IF7A 4I7HA 3V8JA 1YW9A 3FMRA 1O3RA 1FZPB 2V3ZA 3ROUA 1C24A 4MTEA 3HRMA 1IRFA 1KQ0A 1IN4A 1IN8A 1QPMA 2HTSA 4S05A 4IJAA 2V1DA 2MH2A 1R58A 1C0WA 5BS6A 4IVNA 3ZMVA 1N51A 2VBWA 4IRIA 3F8FA 1J2XA 1IW7F 3ZMSA 2H94A 2BWVA 2GU6A 3U2RA 4LB6B 1ZRFA 2OZUA 1JHFA 2FNPA 2F5FA 3HHGA 5D4SA 1B6AA 4FX4A 2D1VA 2OKNA 1WWXA 1XCVA 1Z91A 4Y13A 2G7UA 2P6SA 2E1CA 2GA2A 3HIFA 3WU1B 4ENMA 1MJBA 4PZJA 2Z3YA 4N9IA 5BQTA 5CDVA 4U0VA 4RGXA 5LEJA 4OIOF 3KETA 3BDDA 5F64A 3RIRA 4L9JA 4ESFA 3NRVA 5HLIA 3Q5FA 1S7OA 4YG2F 3HRUA 2V79A 3ZP5A 1B1BA 2GG3A 1FT9A 1FOKA 5K5QA 2R7FA 3ISPA 1GXQA 4A6DA 3KP7A 4RB3C 5J8FA 4LK1F 1DPUA 3S6BA 4UVCA 3JAMZ 4F7ZA 4CGZA 4BXUA 1IN7A 1S29A 2YX7A 1U6GA 1EH8A 2D1HA 4EM0B 5LGUA 3WTSC 2WC2A 1J5YA 4PV4A 4ZYGA 3VFZA 1CHMA 3TB5A 3ZQ7A 3KCCA 1TTYA 4AVPA 1QXWA 4B8XA 3Q9SA 5HDNA 1AWCA 4P55A 2LDUA 1LB2A 4OINF 2VE9A 1LJ9A 3GUDA 1WI9A 2QQBA 3WGGA 1BI0A 2QZ8A 4GO1A 1H0MA 4IKSA 3HSEA 5ICFA 3JTHA 4FX0A 1U5TA 5F1RA 2PBIA 4EJUA 2ESHA 2RC4A 2IVMA 1WBQA 4KIGA 4KIBA 1R5HA 2G6PA 1WLRA 3C3WA 5E1ZB 5KK1A 2V1UA 2EA2A 1XCBA 2HZTA 4KMFA 1RIOH 4EM1A 3LA3A 2Q92A 4OMYA 2FOKA 1LEAA 4ESBA 1FC3A 3DF8A 2V3YA 4FO7A 1XSXA 4KFCA 4EJVA 4WXHA 4S04A 3QU3A 4IU6A 2F5DA 4ZZDA 3QOPA 6PAXA 2QBYB 1LEBA 4I09A 3ZMDA 4YIIA 4PDKA 2XIGA 4OMZA 2XROA 2FBIA 1ZAOA 3JSPA 4XSZF 3TO9A 4FLIA 4CYDA 1WY2A 3D27A 2R7DA 3IRRA 1EH6A 3C18A 2QQAA 3K1MA 2BWSA 3WODF 2E7WA 1F5TA 4M6YA 3GEZA 4IDYA 3KP4A 4U7BA 1UHWA 2DLLA 5FD6A 4H0EA 5IT9K 2ISYA 3Q9VA 3QAHA 1ZREA 2BHCA 2OAZA 3BJ6A 1MDMB 5BPIA 5DYMA 3E5QA 5HS8A 2COMA 5LLQA 1CGPA 5ERIA 3JTGA 3IHUA 4G7OF 1TQMA 2EVMA 1CF7B 1S3JA 4MNUA 1G3TA 2M8EA 2DPDA 1BIAA 1FX7A 2HDCA 4AIJA 2JPBA 5DUIA 3IU7A 4M9ZA 2QQ9A 1W4MA 4P96A 3CDHA 1U3EM 4WF2A 3B02A 3TOBA 1G4DA 2M87A 1BOAA 2ZBKA 3RPQA 3K2ZA 1FLIA 2J5PA 3OOPA 2O03A 4ZWPA 4XBFA 2PMHA 3GF2A 5HS7A 5A2QK 3E5XA 3ZPLA 3IWFA 4HLXA 1IF1A 3M8EA 5AONA 2GQQA 2Q95A 4IHSA 3M7GA 3QP6A 2P98A 4YFKF 4A6VA 3REOA 2E1NA 2Y48A 3FWEA 1REPC 2JT1A 3K0LA 2DU9A 1QGPA 2Q2EA 2EVOA 3BY6A 2BWUA 1UFMA 5DEQA 3HRSA 1S8NA 3RVAA 4CO8A 4IKRA 1ZYRF 2FMYA 1PV9A 2GA1A 5TRDA 3HSRA 1D3YA 4FKCA 2ZMEA 1T38A 1EV7A 1H9GA 2DI3A 1ZRCA 4EV0A 4WXCA 4ETSA 2BHDA 3TKYA 2Q96A 3F8NA 3VEPA 1P92A 1FSEA 4EM2A 1Z7UA 1G3WA 3I54A 4KM3A 5LBQA 4OIQF 5D6FA 4U70A 3MATA 2O6GE 2F2EA 2IT0A 3KP6A 4S2RP 4KNYA 1XMAA 3LSTA 3Q6DA 3DV8A 1YJ3A 3BIQA 3MCZA 5ED4A 4FLKA 1UCRA 1FP1D 1YS7A 1YTYA 4U7DA 1LQ1A 3PQJA 3P9CA 2A61A 4UVAA 1E2XA 4S00A 1BIBA 1IXSB 5CVJA 1TLHB 5L3BA 1HSTA 3I71A 4KDPA 4O6JA 1O3SA 1G3YA 2OQRA 1U5TC 5H6QA 1VTNC 4R60A 2BV6A 1P4AA 4BNCA 3F3XA 4L0ZB 2CW0F 1YW8A 3ULQB 1QO0D 5LGNA 4KMUX 4TV7A 2PN6A 5D6EA 2PI0A 4HQEA 2LNBA 2O0YA 2KIFA 3DP7A 1K6OA 3WE2A 1YW7A 2NQ6A 3KP3A 4WK8F 5J6XA 2OA4A 1KYZA 4HBLA 4LD5A 2CQKA 2IPQX 2MH9A 5EEGA 1J9IA 2P99A 2Z99A 4JBAA 1SD7A 5DD4A 4XLPF 4CZZA 1I5ZA 4K2EA 4ZNGA 3FMSA 2RDPA 3MR1A 1J75A 3L00A 3KP2A 1TQPA 5IT3A 5HLHA 2EV5A 3JSOA 3BPXA 1FWZA 2RKHA 4GYIA 3AAFA 3QPTA 1F4KA 2EV6A 1OYIA 1W7PD 5DCMA 2STWA 1FBQA 1BC7C 3DXJF 1KQ8A 2PMUA 1Z9CA 2EJRA 3IC7A 1HXDA 2B3LA 3TDUC 5ICGA 1W2MA 2RNJA 4EJTA 2ELHA 5D5XB 3ML6A 1IAWA 4RGRA 3BZ6A 3T0YA 3PKBA 1KU9A 3F21A 3RI4A 2A69F 4IRGA 3ZMZA 1W5SA 2G7HA 1KQ9A 4LJZF 3HYIA 1C27A 5L3CA 4Q4ZF 2C6YA 2Q93A 4U6EA 2VOOA 4IXAA 3L24A 3U9GA 4U71A 3M9AA 2EFQA 3I53A 2XHKA 4HDUA 5E17F 3R4KA 2GU5A 1D5VA 2K27A 2YR2A 4BHBA 3KEOA 2D2WA 4L9TA 1FSHA 1FYMA 2IA2A 3FX3A 2OZ6A 5D8KB 4A0XA 3GFLA 5A2QZ 2ZXJA 4I01A 3T8TA 4RB2C 2DK5A 2LSOA 4BHCA 1XGSA 1KU7A 3QU6A 1K78B 1TW2A 2Q8KA 3KE2A 4OIRF 2P8TA 2BEOA 2K02A 3H3UA 4EJOA 5DV5A 1MD0A 2L4MA 2P5KA 5HDGA 3FZVA 5L3DA 2DQRA 1MKMA 5LGTA 5CVVA 3TGNA 3PKDA 1O3TA 4WXDA 3LA2A 5LRSA 5FO5A 2KIUA 1BI1A 1SFXA 2HKXA 4YFXF 1C21A 2MLKA 4JK1X 2ETHA 1GHCA 1BI3A 1R36A 4HV5A 4AIKA 2FMLA 1RUOA 1HKQA 1R1TA 2FA5A 2VBZA 2HKOA 2GZ5A 1PDNC 4FLLA 2OD5A 1DDNA 2ACJA 2FF4A 3CUQA 3KZZA 3L09A 3S2WA 3F22A 2DBBA 2W84A 1YIOA 3E3VA 2BB7A 1UHMA 4FO8A 2P5VA 3ZMTA 2GU4A 1QQIA 1XMKA 3LWFA 5FCFA 3FXQA 2UXXA 3FM3A 1IXCA 3TO7A 2K86A 4AIHA 1B4AA 1IUYA 4RZZA 4QWQA 3PKCA 3RKWA 3BOQA 2E7XA 1RNLA 2XRNA 1TQIA 3VOEA 2NNYA 4N9HA 3RDIA 5HDKA 2W25A 3GX4X 3GLXA 1JXSA 2ADUA 3I5UA 1ZGAA 4KUMA 4G94A 1YS6A 3K1PA 3VB2A 2OQGA 5DUKA 3W6JB 2FQ3A 2FEZA 2YX4A 5AIPA 2EFWA 4FT8A 2KRFA 2K7LA 1K7AA 3EYYA 5AIQA 1WRJA 1KYWA 1KGSA 4ENNA 4UHTA 5D5VB 3MX6A 1B9NA 2BBYA 4HF1A 3C7JA 4M71A 4UV9A 4A0ZA 1PP7U 2XAGA 1LDKB 4ON0A 5CVIA 3L2CA 4AWXB 3R61A 1T98A 1USSA 3ELKA 2BWTA 2WV0A 2V6CA 3E6DA 5DD8A 3IG4A 1YYVA 4A5MA 2VOPA 4U6CA 5H6RA 5E20A 1HKSA 4LG0A 1G3SA 1WQ2A 2XASA 1SAXA 4U1BA 2ZKZA 5E18F 2DFIA 2DW4A 1JGSA 1XDSA 1USTA 1W7PA 3J80K 2HS5A 3GWZA 5FLXK 5ILVA 4QR8A 5HLGA 5D5WB 2A5YB 3CO7C 1O57A 2HYFA 4XSXF 3W6KB 1T39A 2D45A 2L4AA 5F6FA 1YVMA 2GWRA 2BHAA 2XGXA 3HRTA 1Q1HA 3ZN0A 1BC8C 5HOOA 3G3ZA 3GXOA 5E1XA 1QZYA 2KJBA 1D8JA 5FD5A 1HW1A 4R1HA 3KLOA 1MZBA 1YLFA 2KJCA 1AOYA 3MQ0A 4ZYHA 3IRQA 5FCHA 3R6SA 1W5TA 3I4PA 5KVRA 5D4RA 2GIVA 4ENKA 3GFJA 3I59A 5CNXA 1WL6A 1BJAA 2XUBA 4KN7X 2BN7A 3CO6C 2IW5A 2FSWA 3FXRA 2GGCA 3BROA 3HOTA 4Q48A 2GTXA 2RV8A 1XGOA 2P6TA 1R00A 3DKWA 3T5XA 1SMYF 5CE6A 4U6WA 2LF7A 1SFEA 3HTSB 3LA7A 1HW5A 2K4BA 1SFUA 2GG2A 2KIMA 4MEXF 3FXUA 4G6DA 3R0AA 4Y17A 4LB5A 1HQCA 3SZTA 3E97A 3F8CA 3PKEA 2BE5F 4U0WA 1IXRC 1STZA 1U5TB 3D0SA 4HZFA 1QBJA 4OOKA 3ABUA 1A04A 2MC3A 2W24A 5HVQC 1ZGJA 3RKYA 3TOAA 2IW2A 1OMIA 4O3MA 3P9KA 4L5IA 3MFKA 2YSRA 4U6ZA 3CUQC 2KKOA 5E5BA 3LFKA 3CB5A 2ESNA 2HGCA 1FYLA 1H9TA 4RAYA 2PLYA 5E1WA 2XKPA 3RKXA 3LQQA 4RAZA 1I1SA 4HX7A 2EFPA 4ZWUA 2MLGA 1ZLJA 4D0PA 4I02A 3JAMK 2Q94A 3IKTA 1ZHFA 2V9VA 3JW4A 3IU8A 3IKVA 3CUOA 4JQFA 1UB9A 2MD5A 3V7SA 5L3GA 1YG2A 1S7AA 3GZ6A 1I1GA 2QENA 2PJPA 2B3HA 2P5LC 3LAJA 2UWMA 4Q47A 2GG5A 2P7VB 3BPVA 2GXGA 4I2OA 3TDZC 2L02A 1LDJA 2V1XA 3K9TA 4ESJA 3RTRA 2NNNA 2FBKA 2WTEA 4RGUA 3LAPA 2JTVA 1BI2A 3QPHA 4G7ZF 3BP8A 4U73A 4I0BA 3WGHA 4L9VA 2VT2A 4IHTA 3EDPA 5ICEA 1XGMA 2GZWA 1YO5C 4HOBA 3H3ZA 4HF2A 1Z6TA 3HHHA 4GYGA 4R8HA 3MZHA 4B28A 4UVBA 3COAC 2ISZA 2IJLA 1FBUA 4LGWA 1ONVA 4HXXA 4R79A 2OBPA 3SZPA 4M72A 3E6MA 3IL2A 4CXFA 4U6JA 3T1BA 2M5WA 3BWGA 1ZG5A 2Z9OA 4IPAA 4GGGA 3WTVC 4QLCU 3KEQA 3GW2A 1SD4A 3CJNA 3F6OA 4L0YB 4M74A 3FHZA
chains in the Genus database with same CATH superfamily
4E7LA 2VPRA 4EJWA 1QXYA 2Z2SB 4KICA 1ZGWA 3DPTA 1I3AA 5HS9A 1Z7LA 3CC2I 2RN7A 1JUPA 3EYIA 5ILUA 3KP5A 1ZARA 1FOWA 4U0YA 2NAZA 2DDBA 4MQVA 2A07F 2UZKA 4MEYF 2FQ4A 5LD2C 2IGOA 1XSDA 4PNCA 2ELJA 3IV5A 3PQKA 5GAEJ 1VFCA 1D1CA 3FXMA 3ASNH 4LMYA 4AUXA 1Z0XA 2XAHA 2HR3A 1V3FA 2E60A 4F93B 1IRGA 5FLXZ 5IT9Z 3R60A 3CMMA 1YJ9I 3ZMUA 2JA2A 3N05A 1ZTRA 1ZQ3P 4Z6YA 1YHQI 1FY7A 2IEKA 3W2WA 3WU2C 4NUBA 3WTYC 4A3IJ 2MFZA 5LHIA 4WX9A 2VBYA 4MO7A 1YRNB 1JTXA 2R7OA 4A5NA 3M07A 2GLOA 1GVJA 1Y6IA 3V7RA 2EFOA 2JPCA 1Z1DA 2FU4A 1TNTA 2DOAA 1P4WA 2PFBA 3DEUA 1BA5A 1POGA 2RQPA 2EK5A 3GTGJ 1XNZA 4IL6C 1OYYA 4M3DA 3RCOA 4G8XA 2DTRA 2ZCWA 3NARA 4GXOA 2BHYA 1HSJA 3HPHA 1NK3P 1BN5A 1A16A 2GG9A 4C9YA 3QRFF 4LLLA 4ZDOA 2NYXA 4LK0F 2Q2EB 2NXNB 4BY7J 5H20A 3JRBA 2QA4I 2MC4A 1KA8A 2AQFA 3CCMI 1DU0A 1RUNA 4Z7MA 1E17A 4WCGA 3HGYA 5CLSA 3D5LA 3DBRB 2DDAA 1SMTA 1N78A 4A3FJ 2CH0A 4FETA 2VONA 1G8XA 4PCQA 2QYOA 2FBHA 4YFNF 2QVOA 2Z16A 2ZMEB 2P4WA 2P81A 3PNVA 3ZXSA 3JRFA 2CSOA 1FOYA 3WTZA 4BHPA 4EGYA 4RB1A 1WN1A 2QBYA 5F27A 2BH3A 2P9AA 1NTCA 3HZJA 2HYGD 2MYSA 1NHAA 3I3LA 1IN6A 1FP2A 3A02A 2V1NA 3GFIA 4D5CA 3PIPF 2XVCA 1OJLA 2LKPA 4YELA 5CIKA 3J81K 2E5ZA 5FRNA 4HYEA 5E8IA 1XB4A 4U88A 4ZYAA 1IRZA 2VC1A 3RZOJ 1R1UA 2HQNA 4HAMA 1LNWA 1GT0C 2I10A 4EVIA 2O9LA 4XKCA 1Z05A 2NRAC 4A12A 1FBSA 2CFXA 1JHHA 4IZZA 5BOXA 3RORA 4XIDA 3ECHA 3U1DA 2JWTA 4S01A 2HNHA 2HDDA 2M30A 2FNAA 4PGHA 3PFIA 4ANJA 3S3MA 3WTXC 2HWVA 2NS0A 5J47A 5F0HA 4D1QA 1J59A 4BBSJ 2DT5A 1XSVA 2MATA 4DIQA 2HQ5A 2O3FA 1C22A 1Y1VJ 2W1OA 2ZSGA 1R5GA 2BWXA 4S2TP 2X6WA 1ZG3A 1O7FA 3BTJA 3B73A 4HF0A 3WG9A 1SFOJ 3JRIA 4H4KC 3G1LA 2A3SA 2ID3A 5DCFA 2RNGA 1WKMA 3K69A 1TT0A 4XNFA 1MDMA 3BR0A 4MATA 2MA3A 4X1EA 5L3FA 2ZNYA 2BY2A 4IECA 1SC7A 1XD7A 3OSGA 2B3KA 3QPSA 4L5JA 5CVRA 4HLYA 2DJIA 2F5EA 3D1NI 3G73A 2F5VA 3CLQA 2WADA 2EFNA 1VZ0A 3BR5A 4LIVA 4KITB 3MKLA 2W85A 3AG3H 3WGIA 1CF7A 2BWWA 3M8FA 2LK2A 2XGCA 3RZDJ 1O4XA 4XLAA 2HOEA 3PL8A 1P7IA 2BYVE 2X0LA 5GAHJ 4UNOA 4ZYEA 4P9UA 4JUQA 1R23A 5CQEA 4BQAA 3KPHA 2NS8A 4MGRA 4LOCA 1JKQC 3I56I 3AL0B 1TBXA 2X6OA 2HFHA 4JX5A 4U75A 1UG2A 2PQ8A 3CC4I 1X1DA 3H92A 3O3KA 2KIQA 3LFUA 3BZCA 4RM3A 3E5UA 3SXYA 4OOIA 3CTZA 2OF7A 1BBYA 4A93J 1JT0A 1WJDA 3OIOA 1D8KA 3FMQA 2AXLA 3J7AO 4D7MA 2V3XA 5GADJ 3K10A 2KMUA 2A68F 5FFXA 3WTWC 5DDGA 4ASNA 1MGTA 3CLOA 3MEXA 4QIWN 5LEKA 3AKZA 3IAS2 2A6EF 3F6VA 2R0QC 2FXAA 4NB5A 1O3QA 1BM9A 3OIQA 4UXNA 5K1YA 2Y75A 3FK7A 3CCUI 2M0CA 2VLAA 1ETXA 2M34A 3EUKL 1VQ4I 2DA1A 4EQQA 2OC6A 5EG0B 1YE9A 4A0YA 2CO5A 1XN7A 5DCMB 4DNCA 1RI7A 3KZYA 1RZ4A 2EBIA 4HQMA 2CUFA 4P9FA 3WTTC 1O7LA 3OYIA 5JHFA 5JHUA 2HEOA 1D5YA 1HKTA 1HOMA 5KHDA 1ZH5A 2UXNA 3DLAA 1OPCA 2LTPA 4UV8A 4BQQA 1ZG1A 2ZJ2A 4G6QA 4UUVA 3WG7H 1XGNA 5EEAA 3I4NJ 5BPDA 1U8BA 2EVCA 4XOPA 1BJZA 4W97A 1R9TJ 2Q0OA 3CCLI 1Y0NA 4O5VA 3TP0A 2XPWA 4IO9F 4IOAF 2PEXA 1D0XA 3CDLA 5K5OA 4RLFA 1IN5A 1LVKA 4IHVA 1V4RA 2FX0A 4HA8A 1MATA 2VKEA 1T0FA 2QM3A 2DOFA 2HZDA 2L0KA 2M7BA 1DP7P 3VYRB 1HLVA 4KN4X 4Q5SF 1HW2A 4Z2YA 4Y7NJ 4AD9A 1QZZA 2GXBA 2XKOA 3GYHX 2GGBA 2HVQA 2WWYA 4CCMA 1WCMJ 1R22A 5D8LB 2O61A 1PUEE 3GMEA 4Y33A 1UELB 2IGKA 4P5OA 4ZDPA 4G9YA 3K70C 3OYJA 5ILSA 1I3QJ 3ABTA 3TAVA 3L7WA 1P4XA 4ZH4F 5JR3A 2ZJQF 5CDLA 2CV0A 2H6CA 3VYSB 4RGSA 3GZNB 3PO2J 2EZLA 2R7RA 4MHGA 2CQQA 1BR4A 2E19A 1ETYA 2DA6A 1MJAA 1WH5A 2AS5F 3GZ5A 5LHGA 3HOZJ 1R1VA 3VSLA 2EINH 3F0CA 2CGPA 9ANTA 3V4GA 3WU0A 1L0OC 3BG3A 3CCVI 3GVAA 3RPUA 4MTDA 3WTUC 4M73A 2ZO4A 4C30A 3EETA 3HOSA 3GO5A 1ZR4A 1L3LA 4IOCF 2HQRA 3HTUA 3M1EA 4Y3OA 1MJ9A 4ZYDA 4BY1J 4FHTA 2KP6A 3V8LA 2EA4A 4NQWA 2IS1A 3ZN1A 5J1RA 1Z6RA 4XKVA 3DQVC 3OYKA 3DFGA 1T6SA 2TDXA 1PVEA 3L7GA 2HOWA 2HU9A 2CWEA 4LFUA 3ONQA 1J0RA 4XMYA 3MWMA 2YUSA 3R0JA 4IF4A 2GAUA 4F92B 1HF0A 2R5YB 2VT3A 2ZNZA 2M2EA 2YPRA 2BHZA 4II2A 2XV4S 1F43A 2GIZA 2H27A 4E70A 4EMSA 4XR6A 3VODA 3SQNA 4I98B 2DK8A 4L9NA 5FGMA 3S1MJ 2WAQA 3M3YJ 1FYKA 1WFXA 2ICWG 1JJ6C 2XAJA 2LF8A 1XMXA 2Z33A 1DPRA 1FNNA 4BJ5C 4B09A 5IOYA 3PNYA 1P6RA 5C4JJ 1QHHD 3C1DA 1X1AA 2R3SA 4KIFA 5JLWA 3IU9A 4M6XA 3E7LA 2L7ZA 2LBFB 3DLLF 1PYVA 2H6BA 4FUKA 1T2KA 3J81Z 3N4MA 1YI2I 2FUG2 2L9RA 2VXZA 4HX8A 2XAFA 2DPUA 4NHJA 3CUQB 4XRMA 2PG4A 2DA7A 3MZYA 5E8GA 4XLNF 2ME0A 1J7KA 3OV8A 3DPLC 4KT6A 1OYWA 2RQQA 5EDNA 4CHUA 3E6CC 4U69A 4BEHB 3OYNA 4IHXA 3JRHA 5HODA 2R7ZJ 2JSCA 4A3CJ 4CCJA 2O8XA 5D5UB 4X0GA 2VJIA 2Y9YA 3BJAA 2HOSA 4L18B 2GG8A 2CJJA 1F9NA 3BR2A 1TL8A 2IP2A 4BQOA 1MW7A 3WE3A 3TL4X 2QWWA 1QHGA 4M3GA 3O6BB 1Y1NA 2IA0A 2STTA 2VN2A 2X85A 4KYWA 4RM2A 4BE1A 4I99C 3NQOA 5FB2A 4M9SA 2JRTA 5LRRA 4E4HA 5JVTA 2M1BA 5K5RA 2LG4A 3CP2A 3GFMA 2EWNA 3J7YJ 1B8IA 4DZPA 4CZCA 5JI6A 1NK2P 4RB0A 1XDUA 2DO7A 5CYVA 1EKEA 1W7VA 2DMQA 1OCCH 3I58A 1U8RA 1QXZA 4EGEA 1S6LA 5LHHA 3EQLF 1Z77A 1VF9A 1WSUA 1PP8F 4KA4A 1F1ZA 2OU2A 5IOZA 1ULYA 2E1MC 2H09A 3E0JB 3JRAA 2GXAA 2L7FP 2DQLA 3S8PA 1M35A 3ZQGA 5J1UA 4UUSA 1OKRA 2JA6J 3N97A 4KT5C 2DN0A 1XPXA 4RAGA 3BQZA 1I6XA 3QYBA 3I64A 3DKXA 1G6NA 2HVSA 3KYDB 2CYYA 5CJ9A 4ITVA 3RYRA 4A6WA 3SFZA 4ENJA 2VPLA 5JFRA 3GTPJ 1MH3A 3SHFA 2Z5UA 2X4HA 2ME6A 3BJOA 1X3UA 5F1JA 2EV0A 4GRIA 3MAJA 5CVUA 4HSRA 1WL9A 1O0XA 2YU3A 4LLNA 4RA2A 4OIPF 2X1DA 5TJJA 2JVHA 1RR8C 2GU7A 3BITA 3QYEA 1KU3A 2FE3A 1DUXC 3HBLA 1R7JA 2CG4A 2NVXJ 2CFOA 4XLCA 2MBFA 5J4VA 1E0EA 3H5AA 5ICCA 3TBIA 1JI8A 3L2UA 3GCMA 4M9XA 2XF6A 3IWZA 3T8RA 2VKVA 3P9IA 3DCFA 3HSFA 1LVAA 1K78A 2QLZA 1HBXG 3OYGA 4UUTA 3FBIB 3TQNA 2IRFG 1C23A 4UB6C 1ZLKA 1TW3A 1PJRA 2Y0MA 4A3MJ 1T95A 4BXFA 4BS9A 3J7ZI 1ON2A 1AKHB 4ZZLA 1FJLA 3PUBA 4XORA 1D1BA 4HDVA 1TNSA 3I0TA 1Y56A 4M3BA 4U76A 1TWAJ 1IUFA 3F8BA 2A6HF 2W57A 4NC8A 2P7CB 3V8KA 3S1QJ 2CUJA 1MBEA 4MQ9F 3LL7A 4DQ2A 1JAWA 2Y2ZA 5M3MJ 2CRGA 2DCEA 4EGZA 1I39A 1B59A 1J09A 2WAEA 2F5CA 1YFHA 3BCBA 4ZWOA 5L3EA 3LQRA 3TO6A 3TP3A 1X3WB 3NWSA 4E6KG 2L3DA 1QNTA 3LSPA 2QSFX 3MKZA 2R5ZB 1ETWA 2IA1A 3BIPA 1ETKA 4FCYA 1TZLA 3LMMA 1ODDA 5B1BH 2CV2A 3PO3J 4E7KA 2GG7A 4IRHA 4A2UA 4BH9A 1BL0A 5CQGA 1W7PB 5J4YA 3ZQIA 2EILH 4PGGA 3F72A 2XF7A 1Y0UA 2L54A 2EB7A 2PMZN 4A3KJ 4C2UA 1I27A 2VODA 3F8MA 4I0AA 3HUGA 1T0FC 1KP0A 1SANA 3RYPA 1LDDA 1EH7A 2DAOA 2E1OA 2FRHA 3P5JA 1K79A 4LLGF 2JZYA 4BYYA 2XAQA 3BR1A 5J1YA 3L9FA 1GXPA 1W5CC 4FLJA 3K1NA 3MVPA 4HV6A 3GTQJ 3IAM2 4G7HF 4B44A 2MSYA 3P7NA 2LOOA 4N0BA 2RVCA 3KLNA 4HX4A 3V7CA 3O2PE 4WWCA 3KFWX 2GG0A 5BMZA 4YEJA 5CDEA 4XRFA 1BR2A 1DGRM 4U87A 1U9NA 2ZFWA 3FF5A 1YIJI 3ERED 4Y15A 3S2HJ 5J8CA 2K9MA 1SD5A 1UZCA 4HW0A 3RJPA 1A36A 4RMNA 2VBXA 3M1CA 3QWLA 1IZ1A 4BDYA 1LFBA 1K6YA 4IKTA 2BGCA 1SAUA 3OIPA 3SZGA 2E2JJ 1KU2A 3OL3A 2DA2A 3SEZA 4B1RA 1OR7A 1A6QA 1P2FA 2A6TA 3JRCA 3CB6A 2K4JA 1ITYA 1MNDA 2M45A 1FPQA 2OPTA 4YIFA 2VC0A 2XPVA 1X19A 3IH2A 3FM5A 3ERMA 2NQ7A 4GCVA 1X1CA 3BT9A 5M5WJ 1U78A 1HDDC 2VE8A 3I59B 3VYUB 1ON1A 4LIUA 4JP0A 5EEHA 1YQAA 4RZYA 2BWYA 2QUFA 3GTMJ 3J80Z 2B0LA 3F23A 3H5RA 4BJ6C 1VQOI 3HJEA 2EPFA 4RGZ1 1WHUA 5M5YJ 1FTZA 5FFZA 3E6BA 4BAYA 4IKUA 4B3AA 3QP5A 3DU6A 3M4OJ 2MGQA 3PKAA 2G9WA 2HTJA 1TP4A 3RQ4A 4L5EA 4A6EA 1ZELA 4PSXA 1SD6A 3PIOF 4G12A 4RS8A 1U2WA 4NC6A 1ZRDA 1YX3A 4CDGA 5E3NA 3NEUA 4PFPA 4CYCA 3GTKJ 3S16J 2L01A 3EUHA 4OU0A 4FISA 2RGVA 2BHBA 3ECOA 1UMQA 3BCAA 1B9MA 4CCNA 4CICA 1ZN2A 3CTAA 1EF4A 2WAQN 2J5OA 4IHYA 1JE8A 5F04A 3H9JA 4IF7A 4XLFA 3PFYA 3QOEA 4I7HA 4FQGA 3V8JA 3CCEI 3CZ6A 1P9QC 4YRVA 1YW9A 3FXOA 1ENHA 3BTIA 3A03A 1IJWC 2QEXI 2M7AA 2VB6A 3JR9A 3TMOA 3H5NA 3FMRA 1O3RA 1FZPB 5FKMA 2V3ZA 3ROUA 1C24A 1FIPA 4MTEA 3HRMA 4XLEA 5KNLA 1IRFA 1KQ0A 2XF5A 2DXIA 1IN4A 1IDZA 1IN8A 1QPMA 2HTSA 4S05A 1IG7A 4IJAA 4OAZA 1FEXA 1RRJA 2V1DA 2MH2A 1R58A 2ZXWH 1Y1WJ 1C0WA 2LMDA 3SJMA 5BS6A 2H1KA 3CDIA 4IVNA 3ZMVA 2BZTA 4QPQA 1N51A 2HI3A 2VBWA 4IRIA 3F8FA 1T8IA 2XGDA 2DA4A 3AFHA 1J2XA 1IW7F 3ZMSA 1OQYA 2H94A 2BWVA 3CJQB 2GU6A 3ZRGA 1V5FA 1OCZH 3U2RA 4LB6B 1ZRFA 2OZUA 3FBNB 4QSHA 1JHFA 3SDGA 3QQAA 2V26A 2FNPA 3SDBA 3I4MJ 4C3IJ 1FMVA 2F5FA 4CUGA 3HHGA 5D4SA 1QRYA 4CH7A 1B6AA 4FX4A 2D1VA 2DTZA 1LFPA 1VNDA 2M4GA 2ZC2A 3FISA 2DODA 4HSTA 5GPCA 1WWXA 2OCEA 1XCVA 1NH3A 1BW5A 2KLOA 3CQZJ 1Z91A 4Y13A 5IP7J 4A3EJ 3NWTA 1TWHJ 2JRMA 4RDUA 1X58A 2G7UA 2P6SA 1X4OA 2E1CA 5EYRA 3HKZN 2OTJI 2GA2A 4A3JJ 1P7JA 3IH4A 2M9HA 2JMWA 3HIFA 3WU1B 4ENMA 1MJBA 2CQ7A 4PZJA 2Z3YA 4XQFA 4N9IA 5BQTA 3KYLA 5CDVA 4U0VA 4RGXA 1U9OA 4I76A 2JUCA 3S93A 1VQ8I 5LEJA 3S3NA 2WA0A 4OIOF 3D5SC 2KPMA 4MFEA 3OR1C 3MZ8A 3KETA 2Y30A 2F4IA 3BDDA 5F64A 3HM5A 3RIRA 4L9JA 1CQTA 4ESFA 3NRVA 5HLIA 2CW7A 3Q5FA 1S7OA 4D5FA 4YG2F 5C4XJ 3HRUA 3I9V2 3OS1A 1PUFA 2V79A 3ZP5A 1B1BA 1RC9A 1FT9A 2GG3A 1FOKA 3AG4H 1S5LC 5K5QA 2F4MB 2R7FA 4B43A 3ISPA 3K4BA 5EGOA 1GXQA 4A6DA 2W7NA 2OTLI 3RKQA 3KP7A 4RB3C 2HDWA 2LY9A 4LK1F 3AG2H 5B66C 5J8FA 3A01A 1DPUA 3S6BA 1T33A 4UVCA 2N8GA 3JAMZ 2OUMA 4F7ZA 4BXUA 4CGZA 3HG9A 2LH9A 3LSIA 2B63J 4M3FA 1IN7A 1Y39A 1S29A 1TT5B 2YX7A 2Z1DA 1U6GA 2NOJB 4A3GJ 2MG4A 1EH8A 2D1HA 3CESA 3HC7A 4EM0B 2YS9A 5LGUA 3WTSC 2WC2A 1J5YA 4IEJA 4FTHA 4PV4A 3HXLA 4ZYGA 3K4LA 4BJTA 3VFZA 1CHMA 1E3OC 3TB5A 3ZQ7A 3KCCA 4XKBA 1B72A 2I8DA 1TTYA 4AVPA 1GV2A 5F08A 1QXWA 2OV7A 4QPOA 1A6IA 3C2GA 4B8XA 1OCOH 1VQKI 4C3HJ 3Q9SA 5HDNA 1VQNI 1AWCA 2W00A 4P55A 2LDUA 2VKDA 1LB2A 4OINF 5KCMA 2HOAA 2BXYA 2LY2A 4ZDLA 2CQXA 2VE9A 1LJ9A 3LSJA 1H89C 3GUDA 1WI9A 3LOCA 5IP6A 1YJNI 2QQBA 3WGGA 1BI0A 4AM3A 2P0WA 2XRLA 2KRCA 3ABKH 2QZ8A 4BKXA 3TEDA 3H3VK 2E36A 1HC8A 4GO1A 2HYJA 1TC3C 2QSHX 1H0MA 1BR1A 4IKSA 3I55I 3HSEA 5ICFA 3JTHA 4FX0A 1U5TA 4I6ZA 5F1RA 2PBIA 4EJUA 2ESHA 1SEUA 5GP9A 3S1NJ 4QTRA 1QU3A 2OJED 2RC4A 3BG9A 2IVMA 1WBQA 4KIGA 1WPKA 4KIBA 1R5HA 1MH4A 2PMZA 3CMEI 4HNUA 3PM1A 4DBRA 2G6PA 2R7XA 1WLRA 3C3WA 2X48A 5E1ZB 5KK1A 2V1UA 2EA2A 1XCBA 2HZTA 5E3OA 4KMFA 1RIOH 4OWRB 2W82A 4EM1A 3FDYA 4NBQA 3HOWJ 3LA3A 4ZC3A 2Q92A 4OMYA 2FOKA 1LEAA 4ESBA 3OOUA 1FC3A 3H0GJ 4DYCA 1XX5A 3ZQLA 3DF8A 4XK4A 2V3YA 4FO7A 4MLOA 3VYTB 3KEYA 4N4OB 1XSXA 4J19A 2CU7A 3OYEA 4EJVA 1JUSA 4WXHA 1AHDP 3S3OA 4KFCA 3DWLE 2DFFA 2HVRA 4S04A 3QU3A 2R7UA 4IU6A 4JYKA 2IBDA 2F5DA 5K7ZA 4W1UA 3MMYB 3BTCA 2HPIA 4PJMA 4ZZDA 4IHWA 2DMPA 3QOPA 6PAXA 1OR7C 2QBYB 1LEBA 1RKTA 4I09A 4BL0B 2BW3A 3ZMDA 4YIIA 4PDKA 2XIGA 4OMZA 2XROA 2FBIA 3ZCOA 4PJLA 1ZAOA 3JSPA 1W0TA 2DT7B 4XSZF 4P1WA 3TO9A 4FLIA 5F0FA 4CYDA 2CV1A 1WY2A 3D27A 2R7DA 4J00A 2M4KA 3IRRA 4OAYA 3RSNA 1EH6A 3C18A 2QQAA 3DBHB 3K1MA 1VQ7I 3WODF 2BWSA 2E7WA 3L2WA 2VI6A 1F5TA 4M6YA 2DT6A 3GEZA 4A69C 4IDYA 2WB1A 3PSFA 3KP4A 4BXXJ 4D7NA 4U7BA 1UHWA 2DLLA 4DYQA 2I5UA 5FD6A 3ZR8X 4H0EA 5IT9K 3EUHC 2ISYA 2JK3A 3Q9VA 3OYAA 3QAHA 2ZXHA 1MBFA 2L9SA 3U21A 1ZREA 2OAZA 2BHCA 4Y52J 2Q1ZB 1KZHA 3BJ6A 1WZ2A 1MDMB 3K4NA 5BPIA 1WJFA 5DYMA 2E1MB 3A0HC 3OL4A 3E5QA 1VQLI 5HS8A 2COMA 5LLQA 4XKWA 4A3LJ 1CGPA 1IDYA 4G6TB 5ERIA 3JTGA 3SEQA 4BQNA 3IHUA 2EIKH 1R6RA 1GDTA 1XC5A 4G7OF 2QF7A 1TQMA 2JVGA 2XSJC 1CF7B 2EVMA 1S3JA 3KZIC 1G3TA 1I50J 1RPWA 3PNTA 4MNUA 5LFAA 2M8EA 2DPDA 2JA5J 2K9QA 1BIAA 1FX7A 3Q0WA 1ZR2A 2HDCA 4AIJA 4CCOA 4B4CA 2VJ5A 2JPBA 5FKLA 5DUIA 5J40A 3IU7A 4XL9A 1T56A 4M9ZA 2QQ9A 3C2HA 3LSRA 3DTIA 2QSGX 1W4MA 3QODA 2EIJH 1R5ID 5GPAA 4P96A 3ABLH 5EGOB 5EF6A 1DQUA 3CDHA 1U3EM 4WF2A 1QPIA 4ZJZA 3B02A 2DFHA 3CCRI 3TOBA 2ZFUA 2M87A 1G4DA 1BOAA 1VQ5I 2ZBKA 3RPQA 3K2ZA 2NVUB 4GDFA 1FLIA 4E7SA 2J5PA 3K4JA 3OOPA 4KJZA 2O03A 4ZWPA 4XBFA 1UJ8A 3DU5A 1X1PA 3W2VA 2IXSA 2PMHA 3GF2A 1SVOA 5HS7A 5A2QK 3E5XA 3ZPLA 2MABA 3GTOJ 1D1AA 3IWFA 4HLXA 1IF1A 2QKMB 3M8EA 5AONA 4AC0A 1YRNA 3ZGKA 2GQQA 2Q95A 3OYDA 4IHSA 3M7GA 3QP6A 2P98A 2CUEA 4YFKF 4A6VA 3CCYA 3LSKA 3REOA 3G4SI 4HEA2 3LNQA 3HKZA 2HXOA 2LKXA 2E1NA 2Y48A 3FWEA 2ID6A 5B1AH 1REPC 1ETQA 2JT1A 3K0LA 2BXZA 1UHSA 2DU9A 1QGPA 1Z3XA 2Q2EA 2EVOA 3BG7A 3W3CA 3BY6A 2DMNA 2BWUA 1UFMA 5DEQA 2JQ7A 3HRSA 1S8NA 5JLXA 5B5EC 4CO8A 2K9NA 1MMSA 3UKGA 5E79C 1ZYRF 3BG6A 4IKRA 3RVAA 2FMYA 4C3JJ 1PV9A 2GA1A 5TRDA 1W36D 3TW7A 1LE8A 2R7SA 3HSRA 1YITI 1DGWY 1D3YA 1K61A 4FKCA 1GVDA 1OLTA 1RETA 4CCLA 2ZMEA 1T38A 1EV7A 1XS9A 1H88C 2KZGA 3UNGC 4DW6A 1H9GA 2DI3A 2IAIA 1ZRCA 4EV0A 2KDOA 4WXCA 4ETSA 2BHDA 4E7ZA 3TKYA 2Q96A 1MMDA 3F8NA 2AHQA 3VEPA 4F91B 2IGNA 1P92A 1FSEA 2K9LA 4EM2A 3ASOH 4MIMA 4XICA 1N75A 1Z7UA 4ZTFA 1G3WA 1MIJA 2YU9J 3I54A 3K4CA 4KM3A 1D0ZA 5LBQA 4OIQF 2KHMA 3W6VA 1FMWA 1JTYA 5D6FA 2Y69H 3OSFA 1M1EB 4DGWB 2E2IJ 4U70A 3MATA 2LKSA 2O6GE 4RBOA 2F2EA 2IT0A 3KP6A 4S2RP 2F48A 2VXDA 4KNYA 4ABZA 3K4MA 2TRTA 1XMAA 3LSTA 4AIDA 3Q6DA 2F4OB 3DV8A 1X4PA 1YJ3A 1JGGA 1G59A 3BIQA 3MCZA 5ED4A 4FLKA 1UCRA 1FP1D 1YS7A 1YTYA 4IQJA 4EEFG 5C44J 2BVLA 4U7DA 4E7HA 1LQ1A 3L2RA 5DM6F 3PQJA 3P9CA 2A61A 4UVAA 5BNGA 2GM4A 1E2XA 3OS2A 1VQPI 4S00A 1BIBA 1IXSB 5J3LA 4A3BJ 5CVJA 1TLHB 5L3BA 1WH7A 4XRSA 1HSTA 3G1OA 3I71A 4KDPA 4O6JA 1S72I 3JCUC 3G71I 4LG3A 1A35A 1O3SA 1G3YA 2OQRA 1Y8QB 4XN0A 2V9PA 3CD6I 4B3XA 1ERDA 3S15J 1U5TC 4NQWB 5H6QA 1VTNC 4R60A 2BV6A 1P4AA 2CS3A 3G1MA 3F3XA 2H8WA 4M6VA 5CPRB 3ZQQA 4BNCA 1WI3A 4L0ZB 3FXKA 2CW0F 1YW8A 3ULQB 1QO0D 5LGNA 2EH3A 4KMUX 1Z3YA 2L7MP 4TV7A 2PN6A 5D6EA 2PI0A 4HQEA 2LNBA 4C2TA 1WJCA 2O0YA 2KIFA 1W1WE 2VQLA 3DP7A 3NAUA 2K85A 3ABMH 3WE2A 1YW7A 1R4NB 1K6OA 2NQ6A 3KP3A 3B6CA 4WK8F 4XLHA 4ZTJA 5J6XA 2VUMJ 2OA4A 1KYZA 4PJJA 4HBLA 4LD5A 2CQKA 2LR8A 2IPQX 3GBGA 2KFDA 2MH9A 1Z21A 1SVLA 2R7VA 3L2VA 5EEGA 2VQGA 1J9IA 2P99A 2Z99A 4JBAA 1SD7A 5DD4A 2H1LA 4XLPF 2X51A 3OYBA 4CZZA 2H8RA 1I5ZA 3W2AA 2V7FA 1OFCX 1ORKA 2JN6A 4K2EA 3G6EI 3BR6A 4ZNGA 3FMSA 2RDPA 3MR1A 1J75A 3L00A 1JJ8C 3KP2A 1TQPA 5IT3A 5HLHA 4BE0A 3A1YA 3QPLA 2EV5A 3OS0A 3JSOA 3BPXA 1FWZA 1T08B 2RKHA 4GYIA 3AAFA 1HA8A 5EG0A 3QPTA 3HL2A 2X6YA 2EV6A 3FKJA 1F4KA 2QGUA 1OYIA 1W7PD 2VL8A 5DCMA 1QA6A 2OKNA 1GUUA 2STWA 2PJRA 1OCTC 1VQ6I 1MSEC 1FBQA 1BC7C 1DU6A 2BOLA 2X1EA 2ZJRF 3DXJF 1KQ8A 1A5JA 2PX9A 3H9QA 3S32A 2PMUA 4JOMA 1Z9CA 2EJRA 5FKKA 2HOTA 2EQRA 2WB1N 3IC7A 3CP8A 1S9HA 3EUAA 1HXDA 3BC8A 2B3LA 3TDUC 3CF5F 5ICGA 1W2MA 1X1BA 2RNJA 3JREA 3HPGA 4EJTA 3HOVJ 2ELHA 3H1CA 2DYRH 3EPZA 5D5XB 3A0BC 3ML6A 1IAWA 4RGRA 1K4TA 3BZ6A 1JKPC 1B8IB 3PJRA 3T0YA 3PKBA 1KU9A 2VQHA 1WJEA 3Q0UA 3F21A 2LY1A 3RI4A 2Y9ZA 2A69F 2VJJA 3MN2A 4IRGA 2R7WA 3ZMZA 1K4SA 4S0HB 1W5SA 2DYSH 3OYCA 1JUMA 1KQ9A 2G7HA 2TCTA 4LJZF 1E3HA 3HYIA 2IS2A 1C27A 1IRXA 5L3CA 4Q4ZF 2C6YA 3VSKA 4AVZA 2Q93A 2B7EA 3O8GA 4U6EA 3OYLA 4UUSB 2DJNA 3IUOA 2VOOA 4DYRA 2FD5A 1X2NA 3DEWA 4IXAA 2V4JC 1MBGA 5IYCJ 3L24A 5TISC 4BGDA 4Y4RA 3GTLJ 4F3QA 1UG0A 2NVYJ 1YOVB 3PUFA 4YIRX 3U9GA 4U71A 3M9AA 2EFQA 1QVTA 4DZJA 1LE8B 3I53A 2XHKA 4HDUA 5E17F 3WHBA 2CUZA 2ELKA 3R4KA 2GU5A 1D5VA 2K27A 2YR2A 1GV5A 4D9JA 4BHBA 1EJ9A 3KEOA 5IP9J 2VASA 2D2WA 3ESWB 4E7JA 4L9TA 3BR3A 1FSHA 1FYMA 2IA2A 4E7IA 2EZIA 3FX3A 2OZ6A 5D8KB 3M8JA 4JX6A 4A0XA 3GFLA 3VWBA 2Y0SA 2ZXJA 4I01A 5A2QZ 1SFKA 4AYBA 4JX4A 4DOZA 3T8TA 1RR7A 4PSWA 1V5EA 4RB2C 2G0EA 4BE2A 2DK5A 2LSOA 1FTTA 4BHCA 1XGSA 2BY0A 4RLQA 1KU7A 4DJAA 3QU6A 3MKYB 1K78B 4FE4A 3TW6A 1TW2A 2Q8KA 3KE2A 1VI0A 4OIRF 1N77A 2P8TA 2BEOA 2K02A 3H3UA 4EJOA 5DV5A 1MD0A 3FK6A 4AU7A 2L4MA 3LSGA 2R5YA 2P5KA 4FE7A 5HDGA 3FZVA 5L3DA 2L9VA 2DQRA 1MKMA 4FASD 3FXJA 5LGTA 3DPUA 5CVVA 1RKWA 1SVMA 3TGNA 4NDLA 2W48A 3PKDA 1O3TA 4WXDA 3LA2A 3K4KA 5LRSA 5FO5A 2LRDA 2KIUA 2V9KA 3IP4B 3K2AA 1BI1A 1SFXA 2HKXA 4RAFA 2IGMA 2K3PA 4YFXF 1R71A 1C21A 4BU2A 1OCRH 2MLKA 1TWGJ 2ETHA 4JK1X 1GHCA 1BI3A 1R36A 4HV5A 4AIKA 2FMLA 2ZMEC 1RUOA 1I6HJ 1HKQA 1R1TA 2FA5A 2VBZA 2HKOA 2GZ5A 2HPMA 1VQ9I 2LBFA 1PDNC 2DFEA 4FLLA 2OD5A 3OYMA 2BVMA 3GLLA 3HUGB 4UB8C 1DDNA 3CJRB 2ACJA 2FF4A 3CUQA 3KZZA 2A05A 4HNVA 4IX7A 4EATA 4BDZA 1XTAA 3L09A 5FKNA 3S2WA 3F22A 3S14J 3BZKA 2DBBA 2GBYA 3C2BA 2W84A 4BEHA 4F55A 3H0DA 1YIOA 1TWCJ 3E3VA 2BB7A 2M0MA 1UHMA 4NNJA 4FO8A 2P5VA 3ZMTA 2GU4A 1QQIA 1XMKA 3LWFA 5FCFA 3HOUJ 2L2OA 3BQYA 3FXQA 1W0UA 2UXXA 4HPQA 3VDXA 5DM7F 2E71A 5TGTA 2IS6A 3FM3A 1IXCA 5IYDJ 4BACA 3TO7A 2GOMA 2K86A 2EZHA 4AIHA 2GOXB 1B4AA 1IUYA 3QYFA 4RZZA 4QWQA 3PKCA 3RKWA 3FHNA 3BOQA 2DOEA 2E7XA 4II3A 1RNLA 2XRNA 3DKYA 2KL4A 4BBRJ 3LSMA 3CCJI 2D5VA 1TQIA 3CMYA 3VOEA 1ZKGA 1ETOA 2NNYA 5M5XJ 4N9HA 5JVGF 3RDIA 2RREA 5HDKA 5HNFA 2PJRB 2W25A 3GX4X 2AO9A 3GLXA 2XDVA 1JXSA 2JA7J 1FIAA 1NG6A 2ADUA 1N25A 2VIXA 4NC7A 2KISA 2M8GX 3DBLB 3I5UA 1ZGAA 4KUMA 2NOGA 2MW8A 4G94A 1YS6A 3K1PA 3VB2A 2W4SA 1X3ZB 2OQGA 5FKOA 3SFIA 3K70D 2MD0A 5DUKA 3W6JB 3AL0C 4CYCB 2FQ3A 1ETVA 1WJAA 3FKIJ 1IV6A 4V2GA 2FEZA 5FJ8J 2YX4A 5AIPA 2EFWA 2ZSIB 2XC7A 4FT8A 1YX5A 4MFDA 1MNEA 2R7TA 2WY8Q 5CKTA 2JA8J 2K5CA 2WV1A 2KRFA 1OCPA 3O8HA 1V55H 2K7LA 3ZQCA 1K7AA 3EYYA 5AIQA 1WRJA 4XM3A 1MSFC 1KYWA 4CA0A 1KGSA 2IS4A 4ENNA 4X6AJ 4UHTA 3HOXJ 3Q3SA 5FLVA 5D5VB 3MX6A 1KONA 2BY3A 2R92J 1B9NA 5KAIC 3K7AJ 2QCOA 2BBYA 1LPQA 4HF1A 3C7JA 4M71A 3L1PA 2X9DA 2WY7Q 1JT6A 3K6GA 4UV9A 4KISA 2JUGA 4CCKA 4A0ZA 1PP7U 1AKHA 2XAGA 1LDKB 4ON0A 2CQNA 3CMAI 1LKXA 5CVIA 3VPRA 5HLTA 3L2CA 4AWXB 2Y31A 2KT0A 3R61A 1T98A 1USSA 3ELKA 2BWTA 2WV0A 2V6CA 3E6DA 3S17J 5DD8A 3BTLA 3IG4A 1YYVA 4A5MA 2VOPA 4U6CA 3H35A 5H6RA 5E20A 3HDDA 1HKSA 4LG0A 1G3SA 1WQ2A 2XASA 1TWFJ 3BG5A 3OY9A 2R5ZA 2ZKZA 1SAXA 5E18F 4U1BA 2DFIA 2DW4A 5B3SH 3FXLA 2CMPA 2NS7A 1JKRC 1HCRA 3J7AY 2DMTA 1JGSA 1XDSA 4XN3A 5IYBJ 1USTA 1W7PA 3J80K 2HS5A 3GWZA 3A2KA 3V42A 5FLXK 5ILVA 2LVSA 5EZHA 4QR8A 4IKFA 2O8KA 5HLGA 3KYCB 2A5YB 3D5RC 3ZOBA 5D5WB 3CO7C 2VJ4A 1O57A 4HNTA 4HRIA 2HYFA 4XSXF 3W6KB 1T39A 2D45A 2L4AA 5F6FA 3OMYA 1YVMA 2GWRA 2BHAA 2XGXA 5GAGJ 2BY1A 3HRTA 1Q1HA 3HEFA 2R93J 5GTHC 3ZN0A 1UAAA 3GTJJ 1BC8C 5HOOA 1ACIA 3G3ZA 1BW6A 2LLKA 3GXOA 5E1XA 3S2DJ 1QZYA 2DA5A 1R4MB 5IY5H 2WAFA 2KJBA 3HGGA 5DTDA 1D8JA 2XB0X 5FD5A 2JJ7A 1HW1A 2L5QA 4R1HA 3OR2C 3CCQI 2KQRA 1DP3A 3KLOA 1QZEA 3MKWB 1MZBA 2E5NA 1YLFA 4LITA 2KJCA 1AOYA 3L2QA 3MQ0A 4ZYHA 1PUFB 4A3DJ 5FLMJ 1EA3A 3IRQA 2R4GA 4PFOA 5FCHA 3R6SA 2ECCA 1RESA 1W5TA 3I4PA 5KVRA 1WVRA 2LC2A 5D4RA 1D0YA 3LSHA 2GIVA 2M3AA 4ENKA 2Y0SN 3GFJA 3I59A 5E3LA 5CNXA 1WL6A 3A01B 2VKHA 3RQIA 1BJAA 2XUBA 4KN7X 2E2HJ 4F52A 2BN7A 4AYBN 3CO6C 2IW5A 2B9SA 2FSWA 2QKLB 3OYFA 1FOXA 3FXRA 2GGCA 3BROA 3F9KA 3HOTA 1Y8RB 2O5RA 4Q48A 2L9NA 2GTXA 2RV8A 1GLNA 1XGOA 4PK4A 2P6TA 1R00A 1LFUP 1JKOC 3DKWA 3T5XA 2UUZA 1A31A 1SMYF 2LP0A 5CE6A 2ZSHB 1B72B 3E1SA 2V6EA 4U6WA 3OWTA 2X6XA 1AA7A 1WGXA 2LF7A 1WJ5A 1SFEA 4PUSA 3HTSB 3LA7A 4DBQA 1Q1VA 1HW5A 2K4BA 5E3MA 1SFUA 2AXTC 2GG2A 2KIMA 4MEXF 3FXUA 4G6DA 2EIMH 2L7KA 2K40A 1X2MA 2VQCA 3R0AA 2WBMA 4Y17A 2DMUA 2KDZA 4LB5A 2KRHA 1HQCA 3SZTA 3E97A 3F8CA 5EZGA 4V19K 4BUPA 3S1RJ 3PKEA 1H8AC 3ZQFA 2BE5F 2FOWA 4U0WA 1IXRC 1LUJB 1STZA 1OISA 2KZVA 1U5TB 3PSIA 3D0SA 4HZFA 1QBJA 2F6CA 1NG7A 4OOKA 4J01A 3ABUA 1A04A 2MC3A 2W24A 5FRMA 5HVQC 1ZGJA 2LREA 3RKYA 2O7OA 3TOAA 2IW2A 1OMIA 1Z67A 4O3MA 3P9KA 4L5IA 3CC7I 2LD5A 3MFKA 1VQMI 2YSRA 4U6ZA 3MD2A 1K83J 3CUQC 2KKOA 5E5BA 2NVTJ 3LFKA 3CB5A 4M74A 2ESNA 2HGCA 5M3FJ 5K7HA 2ZB9A 1W36C 1MMNA 5K7FA 2XGEA 3A4CA 2LYCA 3X2QH 1FYLA 2EZKA 2XAUA 2LFBA 1H9TA 4PJNA 4RAYA 2PLYA 5E1WA 2XKPA 3RKXA 2QQ8A 3LQQA 2COBA 1V5GA 4N4NB 4RAZA 1I1SA 4HX7A 2EFPA 5EJCA 4ZWUA 2MLGA 5IPAA 3OYHA 4M3EA 4HG2A 1ZLJA 4D0PA 2A5WA 1QVUA 4I02A 3JAMK 2Q94A 4B47A 3SYTA 2NVQJ 3IKTA 3AG1H 1ZHFA 2V9VA 3DTEA 3KIOA 4UY8I 3ZQHA 3JW4A 3IU8A 3IKVA 3CUOA 2X1CA 4JQFA 1UB9A 2K3FA 5GTIC 1ZK8A 5DS9A 2MD5A 3V7SA 4C2MJ 5L3GA 1U0JA 1YG2A 1S7AA 4XRSG 3GZ6A 2BW3B 1MMGA 1I1GA 2QENA 2PJPA 2FJ1A 2B3HA 1R49A 2P5LC 3LAJA 2OCCH 1YJWI 2UWMA 5HNHA 1G2HA 1HDPA 3HB9A 4Q47A 1V54H 2GG5A 2JSPA 2P7VB 1E3PA 2RAEA 1IC8A 1F36A 3BPVA 2AQEA 3CF2A 3KX2A 3G2BA 2GXGA 3DTKA 3DEEA 4I2OA 2E34A 3TDZC 4B48A 2L02A 1LDJA 2V1XA 3K9TA 4ESJA 3RTRA 2XPUA 2NNNA 3IH3A 2R7QA 2FBKA 2WTEA 4LG0B 4RGUA 3FIWA 3H9GA 2XSDC 3LAPA 2JTVA 3UR3C 3CJTB 1BI2A 1XG1A 3QPHA 3HOYJ 2DA3A 2ZXIA 3B6AA 4G7ZF 3BP8A 4U73A 3JRDA 4I0BA 1MBKA 3WGHA 4L9VA 4PJ0C 1WJBA 2VT2A 5H2FC 4IHTA 1MMAA 1APLC 5FROA 4XOTA 1MNMC 4XONA 3EDPA 5ICEA 5KAFC 1MBHA 1XGMA 2GZWA 4V2FA 4HOBA 5F0CA 3JRGA 3H3ZA 1YO5C 1AU7A 4HF2A 1Z6TA 2HQAA 3HHHA 4GYGA 1MBJA 4R8HA 3MZHA 5C3EJ 4B28A 2ECBA 4UVBA 3COAC 3U1KA 2ISZA 2IJLA 4CSWA 1FBUA 4LGWA 1ONVA 4HXXA 4R79A 2OBPA 1S7EA 1BOBA 3SZPA 4M72A 4GFBA 3H36A 3E6MA 2CW8A 3IL2A 1IO2A 4CXFA 4U6JA 2HXIA 2E35A 3T1BA 2K9SA 2UV1A 3WHCA 2M5WA 3BWGA 3RPUD 1ZG5A 1IV8A 2ZJPF 2Z9OA 4IPAA 4GGGA 3WTVC 4QLCU 3KEQA 3GW2A 1IGNA 1SD4A 3CJNA 3Q0VA 3F6OA 3CCSI 4L0YB 3BLYA 4IQ4A 2XB5A 3FHZA
chains in the Genus database with same CATH topology
4EJWA 1QXYA 4KICA 3DPTA 5HS9A 2RN7A 3EYIA 5ILUA 3KP5A 1ZARA 4U0YA 2NAZA 4MQVA 2A07F 2UZKA 4MEYF 1XSDA 4PNCA 3PQKA 4LMYA 2XAHA 2HR3A 1V3FA 1IRGA 5FLXZ 5IT9Z 3R60A 3ZMUA 1FY7A 3WTYC 5LHIA 4WX9A 2VBYA 4A5NA 1GVJA 3V7RA 2EFOA 2JPCA 1Z1DA 2FU4A 1TNTA 1P4WA 2PFBA 3DEUA 2RQPA 2EK5A 1XNZA 1OYYA 4G8XA 2DTRA 2ZCWA 4GXOA 1HSJA 1A16A 1BN5A 2GG9A 3QRFF 4LLLA 2NYXA 4LK0F 5H20A 4Z7MA 1KA8A 1RUNA 1E17A 4WCGA 5CLSA 3D5LA 1SMTA 2VONA 4PCQA 2QYOA 2FBHA 4YFNF 2QVOA 2ZMEB 2P4WA 2CSOA 3WTZA 4BHPA 4EGYA 4RB1A 1WN1A 2QBYA 2BH3A 2P9AA 2HYGD 1NHAA 1IN6A 1FP2A 3GFIA 2XVCA 2LKPA 5CIKA 3J81K 4HYEA 5E8IA 1XB4A 4U88A 2VC1A 1R1UA 2HQNA 4HAMA 1LNWA 4EVIA 1Z05A 2NRAC 4A12A 1FBSA 2CFXA 1JHHA 5BOXA 3RORA 3ECHA 3U1DA 4S01A 2M30A 2FNAA 4PGHA 3PFIA 3WTXC 2HWVA 2NS0A 1J59A 2DT5A 1XSVA 2MATA 2O3FA 1C22A 2ZSGA 1R5GA 2BWXA 4S2TP 1ZG3A 1O7FA 3B73A 4HF0A 3WG9A 2A3SA 5DCFA 1WKMA 3K69A 4MATA 1MDMA 2MA3A 5L3FA 2ZNYA 4IECA 1XD7A 2B3KA 4L5JA 5CVRA 4HLYA 2F5EA 3G73A 2EFNA 2W85A 3WGIA 1CF7A 2BWWA 3M8FA 2HOEA 2BYVE 2X0LA 4UNOA 4ZYEA 4P9UA 4JUQA 1R23A 4BQAA 4MGRA 1TBXA 2HFHA 4U75A 2PQ8A 3H92A 3O3KA 3E5UA 3SXYA 4OOIA 3CTZA 1BBYA 1D8KA 3FMQA 2AXLA 3J7AO 2V3XA 3WTWC 2A68F 5FFXA 5DDGA 4ASNA 1MGTA 3CLOA 3MEXA 5LEKA 2A6EF 3F6VA 2FXAA 4NB5A 1O3QA 1BM9A 4UXNA 5K1YA 2Y75A 4EQQA 4A0YA 2CO5A 1XN7A 5DCMB 4DNCA 1RI7A 3KZYA 1RZ4A 4HQMA 4P9FA 3WTTC 1O7LA 5JHUA 2HEOA 1HKTA 1ZH5A 2UXNA 1OPCA 4UV8A 1ZG1A 2ZJ2A 4G6QA 4UUVA 1XGNA 5BPDA 2EVCA 2Q0OA 4O5VA 2PEXA 5K5OA 1IN5A 1V4RA 4HA8A 1MATA 1T0FA 2QM3A 1DP7P 4KN4X 4Q5SF 1HW2A 4Z2YA 4AD9A 1QZZA 2GXBA 2XKOA 3GYHX 2GGBA 2WWYA 1R22A 5D8LB 2O61A 1PUEE 4P5OA 4G9YA 5ILSA 3ABTA 3TAVA 3L7WA 1P4XA 4ZH4F 5JR3A 5CDLA 2H6CA 4RGSA 4MHGA 1MJAA 2AS5F 3GZ5A 5LHGA 1R1VA 2CGPA 3V4GA 3WU0A 1L0OC 3GVAA 3RPUA 4MTDA 3WTUC 4M73A 2ZO4A 3EETA 3HOSA 3GO5A 1L3LA 2HQRA 3HTUA 3M1EA 1MJ9A 4ZYDA 4FHTA 3V8LA 2EA4A 4NQWA 3ZN1A 1Z6RA 3DQVC 3DFGA 1T6SA 2TDXA 3L7GA 2HOWA 2CWEA 4LFUA 1J0RA 3MWMA 3R0JA 4IF4A 2GAUA 2VT3A 2ZNZA 2YPRA 2XV4S 2H27A 4E70A 4EMSA 3VODA 3SQNA 4I98B 2DK8A 4L9NA 5FGMA 1FYKA 2XAJA 2LF8A 2Z33A 1DPRA 1FNNA 4B09A 1P6RA 3C1DA 2R3SA 4KIFA 3IU9A 4M6XA 2H6BA 4FUKA 1T2KA 3J81Z 3N4MA 2VXZA 4HX8A 2XAFA 2DPUA 4NHJA 3CUQB 2PG4A 5E8GA 3MZYA 4XLNF 1J7KA 3OV8A 3DPLC 1OYWA 4CHUA 3E6CC 4U69A 2JSCA 2O8XA 5D5UB 3BJAA 4L18B 2GG8A 1F9NA 2IP2A 3WE3A 2QWWA 1Y1NA 3O6BB 2IA0A 2STTA 2VN2A 4KYWA 3NQOA 5FB2A 5JVTA 4M9SA 2JRTA 5LRRA 2M1BA 5K5RA 3GFMA 2EWNA 5JI6A 4RB0A 1XDUA 2DO7A 5CYVA 1W7VA 3I58A 1U8RA 1QXZA 4EGEA 1S6LA 5LHHA 3EQLF 1WSUA 1PP8F 4KA4A 1F1ZA 2OU2A 1ULYA 2H09A 2DQLA 1M35A 1OKRA 3N97A 4KT5C 1I6XA 3I64A 1G6NA 2CYYA 5CJ9A 3RYRA 4A6WA 3SFZA 4ENJA 5JFRA 3SHFA 2Z5UA 2X4HA 3BJOA 1X3UA 2EV0A 3MAJA 5CVUA 1WL9A 1O0XA 2YU3A 4LLNA 4OIPF 5TJJA 2GU7A 3BITA 1KU3A 2FE3A 1DUXC 1R7JA 2CG4A 2MBFA 5ICCA 4M9XA 3IWZA 3T8RA 3P9IA 3HSFA 1LVAA 1K78A 2QLZA 1HBXG 3TQNA 2IRFG 1C23A 1ZLKA 1TW3A 2Y0MA 1ON2A 4ZZLA 4HDVA 1TNSA 3I0TA 4U76A 3F8BA 2A6HF 2W57A 2P7CB 3V8KA 4MQ9F 4DQ2A 1JAWA 4EGZA 1B59A 2F5CA 1YFHA 4ZWOA 5L3EA 3LQRA 3TO6A 4LG0B 2L3DA 1QNTA 2IA1A 3BIPA 1ODDA 2GG7A 4IRHA 4A2UA 4BH9A 1W7PB 4PGGA 3F72A 1Y0UA 2L54A 2EB7A 1I27A 2VODA 3F8MA 4I0AA 3HUGA 1KP0A 3RYPA 1LDDA 1EH7A 2DAOA 2FRHA 1K79A 4LLGF 2JZYA 4BYYA 2XAQA 3L9FA 1GXPA 4FLJA 3K1NA 4HV6A 4G7HF 3P7NA 4N0BA 2RVCA 3KLNA 4HX4A 3V7CA 3O2PE 4WWCA 3KFWX 2GG0A 5BMZA 5CDEA 4XRFA 2ZFWA 3FF5A 3ERED 4Y15A 5J8CA 1SD5A 4HW0A 3RJPA 2VBXA 1IZ1A 4IKTA 2BGCA 1KU2A 1OR7A 1P2FA 3CB6A 2K4JA 2M45A 1FPQA 4YIFA 2VC0A 3FM5A 2NQ7A 4GCVA 1U78A 2VE8A 3I59B 1ON1A 5EEHA 1YQAA 4RZYA 2BWYA 2QUFA 3J80Z 2B0LA 3F23A 4RGZ1 5FFZA 3E6BA 4BAYA 4IKUA 3QP5A 3PKAA 2G9WA 2HTJA 4A6EA 1SD6A 4RS8A 1U2WA 1ZRDA 4CDGA 3NEUA 2L01A 3EUHA 4OU0A 2RGVA 2BHBA 3ECOA 1B9MA 4CICA 1ZN2A 3CTAA 2J5OA 1JE8A 4IF7A 4I7HA 3V8JA 1YW9A 3FMRA 1O3RA 1FZPB 2V3ZA 3ROUA 1C24A 4MTEA 3HRMA 1IRFA 1KQ0A 1IN4A 1IN8A 1QPMA 2HTSA 4S05A 4IJAA 2V1DA 2MH2A 1R58A 1C0WA 5BS6A 4IVNA 3ZMVA 1N51A 2VBWA 4IRIA 3F8FA 1J2XA 1IW7F 3ZMSA 2H94A 2BWVA 2GU6A 3U2RA 4LB6B 1ZRFA 2OZUA 1JHFA 2FNPA 2F5FA 3HHGA 5D4SA 1B6AA 4FX4A 2D1VA 2OKNA 1WWXA 1XCVA 1Z91A 4Y13A 2G7UA 2P6SA 2E1CA 2GA2A 3HIFA 3WU1B 4ENMA 1MJBA 4PZJA 2Z3YA 4N9IA 5BQTA 5CDVA 4U0VA 4RGXA 5LEJA 4OIOF 3KETA 3BDDA 5F64A 3RIRA 4L9JA 4ESFA 3NRVA 5HLIA 3Q5FA 1S7OA 4YG2F 3HRUA 2V79A 3ZP5A 1B1BA 2GG3A 1FT9A 1FOKA 5K5QA 2R7FA 3ISPA 1GXQA 4A6DA 3KP7A 4RB3C 5J8FA 4LK1F 1DPUA 3S6BA 4UVCA 3JAMZ 4F7ZA 4CGZA 4BXUA 1IN7A 1S29A 2YX7A 1U6GA 1EH8A 2D1HA 4EM0B 5LGUA 3WTSC 2WC2A 1J5YA 4PV4A 4ZYGA 3VFZA 1CHMA 3TB5A 3ZQ7A 3KCCA 1TTYA 4AVPA 1QXWA 4B8XA 3Q9SA 5HDNA 1AWCA 4P55A 2LDUA 1LB2A 4OINF 2VE9A 1LJ9A 3GUDA 1WI9A 2QQBA 3WGGA 1BI0A 2QZ8A 4GO1A 1H0MA 4IKSA 3HSEA 5ICFA 3JTHA 4FX0A 1U5TA 5F1RA 2PBIA 4EJUA 2ESHA 2RC4A 2IVMA 1WBQA 4KIGA 4KIBA 1R5HA 2G6PA 1WLRA 3C3WA 5E1ZB 5KK1A 2V1UA 2EA2A 1XCBA 2HZTA 4KMFA 1RIOH 4EM1A 3LA3A 2Q92A 4OMYA 2FOKA 1LEAA 4ESBA 1FC3A 3DF8A 2V3YA 4FO7A 1XSXA 4KFCA 4EJVA 4WXHA 4S04A 3QU3A 4IU6A 2F5DA 4ZZDA 3QOPA 6PAXA 2QBYB 1LEBA 4I09A 3ZMDA 4YIIA 4PDKA 2XIGA 4OMZA 2XROA 2FBIA 1ZAOA 3JSPA 4XSZF 3TO9A 4FLIA 4CYDA 1WY2A 3D27A 2R7DA 3IRRA 1EH6A 3C18A 2QQAA 3K1MA 2BWSA 3WODF 2E7WA 1F5TA 4M6YA 3GEZA 4IDYA 3KP4A 4U7BA 1UHWA 2DLLA 5FD6A 4H0EA 5IT9K 2ISYA 3Q9VA 3QAHA 1ZREA 2BHCA 2OAZA 3BJ6A 1MDMB 5BPIA 5DYMA 3E5QA 5HS8A 2COMA 5LLQA 1CGPA 5ERIA 3JTGA 3IHUA 4G7OF 1TQMA 2EVMA 1CF7B 1S3JA 4MNUA 1G3TA 2M8EA 2DPDA 1BIAA 1FX7A 2HDCA 4AIJA 2JPBA 5DUIA 3IU7A 4M9ZA 2QQ9A 1W4MA 4P96A 3CDHA 1U3EM 4WF2A 3B02A 3TOBA 1G4DA 2M87A 1BOAA 2ZBKA 3RPQA 3K2ZA 1FLIA 2J5PA 3OOPA 2O03A 4ZWPA 4XBFA 2PMHA 3GF2A 5HS7A 5A2QK 3E5XA 3ZPLA 3IWFA 4HLXA 1IF1A 3M8EA 5AONA 2GQQA 2Q95A 4IHSA 3M7GA 3QP6A 2P98A 4YFKF 4A6VA 3REOA 2E1NA 2Y48A 3FWEA 1REPC 2JT1A 3K0LA 2DU9A 1QGPA 2Q2EA 2EVOA 3BY6A 2BWUA 1UFMA 5DEQA 3HRSA 1S8NA 3RVAA 4CO8A 4IKRA 1ZYRF 2FMYA 1PV9A 2GA1A 5TRDA 3HSRA 1D3YA 4FKCA 2ZMEA 1T38A 1EV7A 1H9GA 2DI3A 1ZRCA 4EV0A 4WXCA 4ETSA 2BHDA 3TKYA 2Q96A 3F8NA 3VEPA 1P92A 1FSEA 4EM2A 1Z7UA 1G3WA 3I54A 4KM3A 5LBQA 4OIQF 5D6FA 4U70A 3MATA 2O6GE 2F2EA 2IT0A 3KP6A 4S2RP 4KNYA 1XMAA 3LSTA 3Q6DA 3DV8A 1YJ3A 3BIQA 3MCZA 5ED4A 4FLKA 1UCRA 1FP1D 1YS7A 1YTYA 4U7DA 1LQ1A 3PQJA 3P9CA 2A61A 4UVAA 1E2XA 4S00A 1BIBA 1IXSB 5CVJA 1TLHB 5L3BA 1HSTA 3I71A 4KDPA 4O6JA 1O3SA 1G3YA 2OQRA 1U5TC 5H6QA 1VTNC 4R60A 2BV6A 1P4AA 4BNCA 3F3XA 4L0ZB 2CW0F 1YW8A 3ULQB 1QO0D 5LGNA 4KMUX 4TV7A 2PN6A 5D6EA 2PI0A 4HQEA 2LNBA 2O0YA 2KIFA 3DP7A 1K6OA 3WE2A 1YW7A 2NQ6A 3KP3A 4WK8F 5J6XA 2OA4A 1KYZA 4HBLA 4LD5A 2CQKA 2IPQX 2MH9A 5EEGA 1J9IA 2P99A 2Z99A 4JBAA 1SD7A 5DD4A 4XLPF 4CZZA 1I5ZA 4K2EA 4ZNGA 3FMSA 2RDPA 3MR1A 1J75A 3L00A 3KP2A 1TQPA 5IT3A 5HLHA 2EV5A 3JSOA 3BPXA 1FWZA 2RKHA 4GYIA 3AAFA 3QPTA 1F4KA 2EV6A 1OYIA 1W7PD 5DCMA 2STWA 1FBQA 1BC7C 3DXJF 1KQ8A 2PMUA 1Z9CA 2EJRA 3IC7A 1HXDA 2B3LA 3TDUC 5ICGA 1W2MA 2RNJA 4EJTA 2ELHA 5D5XB 3ML6A 1IAWA 4RGRA 3BZ6A 3T0YA 3PKBA 1KU9A 3F21A 3RI4A 2A69F 4IRGA 3ZMZA 1W5SA 2G7HA 1KQ9A 4LJZF 3HYIA 1C27A 5L3CA 4Q4ZF 2C6YA 2Q93A 4U6EA 2VOOA 4IXAA 3L24A 3U9GA 4U71A 3M9AA 2EFQA 3I53A 2XHKA 4HDUA 5E17F 3R4KA 2GU5A 1D5VA 2K27A 2YR2A 4BHBA 3KEOA 2D2WA 4L9TA 1FSHA 1FYMA 2IA2A 3FX3A 2OZ6A 5D8KB 4A0XA 3GFLA 5A2QZ 2ZXJA 4I01A 3T8TA 4RB2C 2DK5A 2LSOA 4BHCA 1XGSA 1KU7A 3QU6A 1K78B 1TW2A 2Q8KA 3KE2A 4OIRF 2P8TA 2BEOA 2K02A 3H3UA 4EJOA 5DV5A 1MD0A 2L4MA 2P5KA 5HDGA 3FZVA 5L3DA 2DQRA 1MKMA 5LGTA 5CVVA 3TGNA 3PKDA 1O3TA 4WXDA 3LA2A 5LRSA 5FO5A 2KIUA 1BI1A 1SFXA 2HKXA 4YFXF 1C21A 2MLKA 4JK1X 2ETHA 1GHCA 1BI3A 1R36A 4HV5A 4AIKA 2FMLA 1RUOA 1HKQA 1R1TA 2FA5A 2VBZA 2HKOA 2GZ5A 1PDNC 4FLLA 2OD5A 1DDNA 2ACJA 2FF4A 3CUQA 3KZZA 3L09A 3S2WA 3F22A 2DBBA 2W84A 1YIOA 3E3VA 2BB7A 1UHMA 4FO8A 2P5VA 3ZMTA 2GU4A 1QQIA 1XMKA 3LWFA 5FCFA 3FXQA 2UXXA 3FM3A 1IXCA 3TO7A 2K86A 4AIHA 1B4AA 1IUYA 4RZZA 4QWQA 3PKCA 3RKWA 3BOQA 2E7XA 1RNLA 2XRNA 1TQIA 3VOEA 2NNYA 4N9HA 3RDIA 5HDKA 2W25A 3GX4X 3GLXA 1JXSA 2ADUA 3I5UA 1ZGAA 4KUMA 4G94A 1YS6A 3K1PA 3VB2A 2OQGA 5DUKA 3W6JB 2FQ3A 2FEZA 2YX4A 5AIPA 2EFWA 4FT8A 2KRFA 2K7LA 1K7AA 3EYYA 5AIQA 1WRJA 1KYWA 1KGSA 4ENNA 4UHTA 5D5VB 3MX6A 1B9NA 2BBYA 4HF1A 3C7JA 4M71A 4UV9A 4A0ZA 1PP7U 2XAGA 1LDKB 4ON0A 5CVIA 3L2CA 4AWXB 3R61A 1T98A 1USSA 3ELKA 2BWTA 2WV0A 2V6CA 3E6DA 5DD8A 3IG4A 1YYVA 4A5MA 2VOPA 4U6CA 5H6RA 5E20A 1HKSA 4LG0A 1G3SA 1WQ2A 2XASA 1SAXA 4U1BA 2ZKZA 5E18F 2DFIA 2DW4A 1JGSA 1XDSA 1USTA 1W7PA 3J80K 2HS5A 3GWZA 5FLXK 5ILVA 4QR8A 5HLGA 5D5WB 2A5YB 3CO7C 1O57A 2HYFA 4XSXF 3W6KB 1T39A 2D45A 2L4AA 5F6FA 1YVMA 2GWRA 2BHAA 2XGXA 3HRTA 1Q1HA 3ZN0A 1BC8C 5HOOA 3G3ZA 3GXOA 5E1XA 1QZYA 2KJBA 1D8JA 5FD5A 1HW1A 4R1HA 3KLOA 1MZBA 1YLFA 2KJCA 1AOYA 3MQ0A 4ZYHA 3IRQA 5FCHA 3R6SA 1W5TA 3I4PA 5KVRA 5D4RA 2GIVA 4ENKA 3GFJA 3I59A 5CNXA 1WL6A 1BJAA 2XUBA 4KN7X 2BN7A 3CO6C 2IW5A 2FSWA 3FXRA 2GGCA 3BROA 3HOTA 4Q48A 2GTXA 2RV8A 1XGOA 2P6TA 1R00A 3DKWA 3T5XA 1SMYF 5CE6A 4U6WA 2LF7A 1SFEA 3HTSB 3LA7A 1HW5A 2K4BA 1SFUA 2GG2A 2KIMA 4MEXF 3FXUA 4G6DA 3R0AA 4Y17A 4LB5A 1HQCA 3SZTA 3E97A 3F8CA 3PKEA 2BE5F 4U0WA 1IXRC 1STZA 1U5TB 3D0SA 4HZFA 1QBJA 4OOKA 3ABUA 1A04A 2MC3A 2W24A 5HVQC 1ZGJA 3RKYA 3TOAA 2IW2A 1OMIA 4O3MA 3P9KA 4L5IA 3MFKA 2YSRA 4U6ZA 3CUQC 2KKOA 5E5BA 3LFKA 3CB5A 2ESNA 2HGCA 1FYLA 1H9TA 4RAYA 2PLYA 5E1WA 2XKPA 3RKXA 3LQQA 4RAZA 1I1SA 4HX7A 2EFPA 4ZWUA 2MLGA 1ZLJA 4D0PA 4I02A 3JAMK 2Q94A 3IKTA 1ZHFA 2V9VA 3JW4A 3IU8A 3IKVA 3CUOA 4JQFA 1UB9A 2MD5A 3V7SA 5L3GA 1YG2A 1S7AA 3GZ6A 1I1GA 2QENA 2PJPA 2B3HA 2P5LC 3LAJA 2UWMA 4Q47A 2GG5A 2P7VB 3BPVA 2GXGA 4I2OA 3TDZC 2L02A 1LDJA 2V1XA 3K9TA 4ESJA 3RTRA 2NNNA 2FBKA 2WTEA 4RGUA 3LAPA 2JTVA 1BI2A 3QPHA 4G7ZF 3BP8A 4U73A 4I0BA 3WGHA 4L9VA 2VT2A 4IHTA 3EDPA 5ICEA 1XGMA 2GZWA 1YO5C 4HOBA 3H3ZA 4HF2A 1Z6TA 3HHHA 4GYGA 4R8HA 3MZHA 4B28A 4UVBA 3COAC 2ISZA 2IJLA 1FBUA 4LGWA 1ONVA 4HXXA 4R79A 2OBPA 3SZPA 4M72A 3E6MA 3IL2A 4CXFA 4U6JA 3T1BA 2M5WA 3BWGA 1ZG5A 2Z9OA 4IPAA 4GGGA 3WTVC 4QLCU 3KEQA 3GW2A 1SD4A 3CJNA