1XGMA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
b'MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgmA01
1FPQA 5ILSA 1TQMA 4L5IA 1C27A 1ZAOA 1PP8F 2VC0A 2MLKA 3PKAA 3L9FA 5CVVA 2MATA 1P4AA 1O3TA 2V3XA 2IPQX 3TOBA 4GCVA 2GXBA 1V4RA 2OZ6A 1Y0UA 1XGOA 5EEHA 3BITA 3RJPA 1FOKA 1F5TA 3FXQA 4OMYA 4B28A 3NQOA 3VEPA 2Q0OA 4WWCA 2LKPA 3ZMVA 4U88A 3IU9A 4MQVA 3L24A 2XAQA 5CJ9A 4ZYGA 5FGMA 5HVQC 3KLOA 5J8FA 3R0JA 3ULQB 3GF2A 5JI6A 3KZYA 4G9YA 4UVCA 4LMYA 1VTNC 1ZGAA 3V8KA 1LDJA 2ZMEA 1AWCA 4HX4A 2LDUA 2P98A 5ICEA 1DPRA 3GZ5A 3O3KA 1ZRDA 2VOPA 3I59A 4WK8F 4A2UA 2HDCA 1YLFA 1IAWA 4EGEA 3EETA 3HUGA 3I64A 2V9VA 4UHTA 1BC7C 4S00A 1Z6TA 4QR8A 1FYKA 5BQTA 4BAYA 3LA2A 4GGGA 1W2MA 4U70A 2NNYA 4OOIA 5LHIA 4Y15A 1IRGA 4IKUA 3WU1B 3PKCA 4KDPA 3BWGA 1E17A 2QWWA 2P6SA 4O3MA 4EGZA 3ZMDA 3EQLF 4O6JA 4Y17A 3RORA 4ZYHA 1RUOA 2UWMA 1UCRA 1WKMA 3F21A 1JAWA 2Y0MA 4S04A 3V8LA 4I01A 2FEZA 4IXAA 4ETSA 1CF7A 3KETA 2P4WA 4HYEA 2XAHA 5LGTA 3RDIA 1NHAA 2FU4A 5DUIA 1YTYA 3KCCA 1J59A 2FA5A 5D5VB 3WE2A 1JXSA 5CDVA 3IL2A 5D8KB 3V7SA 1DP7P 2DPDA 2O6GE 1KU9A 5ICGA 3BIPA 4RGZ1 3WG9A 2V1XA 3WGGA 1MJ9A 1WN1A 3HSFA 4WX9A 1FP2A 1STZA 2GTXA 3GYHX 1YW7A 3D0SA 2R7FA 3KEQA 1WL6A 3SZTA 4EJVA 1KU7A 1R7JA 5HOOA 2LF7A 4N9HA 3I0TA 1C24A 4XRFA 2DQRA 1FX7A 5JHUA 3CUQA 5A2QK 4XLPF 1PDNC 2IA1A 3C18A 4P9UA 2L4MA 5DCMA 2IJLA 1T2KA 4PGHA 3F8CA 4B8XA 1FYMA 4AIKA 2Y48A 4R60A 2ISZA 2ZBKA 4HAMA 3ABUA 4KIBA 4Q4ZF 1IZ1A 4S05A 2VONA 2BHAA 2AXLA 1A16A 4OIQF 3HYIA 1YIOA 4U6WA 2OZUA 4S01A 1FZPB 2K4JA 5HS9A 3JAMZ 5HLIA 4LLNA 5DYMA 4FUKA 2BHCA 2ZMEB 5E8IA 2WC2A 1MDMA 4U6EA 3TQNA 4KICA 1QXWA 4FLJA 5IT9K 5D6FA 5CVUA 3WE3A 4I7HA 3FXUA 5TJJA 3R0AA 4IECA 3JSOA 3MEXA 5D5UB 5L3BA 5L3GA 4KMFA 2JPCA 2OQGA 2QQBA 2HFHA 2HOEA 4WCGA 4IRGA 3QPHA 3LWFA 3J81K 5DCFA 5F64A 2QENA 4FO8A 2ESNA 2RNJA 3V8JA 4F7ZA 1C21A 2ADUA 1SAXA 3FMRA 5CVRA 1QXZA 1F1ZA 1DPUA 3K1NA 1LQ1A 1D5VA 2CQKA 3P9KA 3F8NA 2KJBA 1KGSA 3R61A 2RV8A 2IT0A 2MC3A 3CJNA 3FM5A 2EFWA 2XIGA 4M73A 3KP3A 2M45A 5E1ZB 3F8BA 1IXRC 1ONVA 1MJAA 3W6KB 3BPVA 3LAJA 1UHWA 1KU2A 3LFKA 1MZBA 2HOWA 4ASNA 1GXPA 3RYPA 3R6SA 5HDGA 1W7PD 2BE5F 2ZFWA 3FHZA 1RI7A 4N0BA 1ZRFA 1BC8C 3SFZA 1KU3A 1H9TA 1U78A 4U0VA 4KFCA 3IU7A 3RPQA 2YSRA 3MX6A 2PN6A 3HRSA 4PV4A 4BHPA 2EVCA 2OBPA 3TDUC 2GZ5A 4A6DA 2M1BA 2VBZA 2YX4A 1XCBA 3BIQA 1IUYA 3E5UA 2F5DA 4BHBA 5LRRA 3PQKA 3BJ6A 3K9TA 3Q9VA 5F1RA 2HGCA 2CGPA 4HX8A 3PQJA 2PEXA 5E8GA 1BN5A 3CUQB 2A61A 3K0LA 2B3HA 1XD7A 1OPCA 2VE9A 3K1PA 2OKNA 2F5FA 3V7RA 1U5TC 2Z99A 3GO5A 4EJWA 3HRMA 5L3DA 1CGPA 5AONA 1J7KA 4IKTA 4U75A 3ERED 2HR3A 3WTYC 1O3QA 4YIFA 5DUKA 3WTZA 4GXOA 4EM0B 3REOA 1W4MA 1ZG3A 4MGRA 4NQWA 2R3SA 1MDMB 1WI9A 3DP7A 1I1GA 3KP7A 4MQ9F 4A6VA 3GZ6A 5HS8A 4MTDA 4BXUA 2UZKA 3DQVC 5CVJA 5F6FA 3HSEA 2QLZA 5D8LB 1WBQA 2CFXA 1JGSA 2JPBA 1WQ2A 1TQPA 2IP2A 3OV8A 1TW2A 3TGNA 2Q96A 4CO8A 2RC4A 4Z2YA 2ELHA 2Q2EA 4IF4A 1E2XA 2NAZA 2V6CA 2BWWA 3EYYA 4S2RP 4RGRA 1Z1DA 3BROA 5J8CA 2XGXA 4B09A 4MNUA 1O0XA 4A0ZA 1IW7F 2B3LA 4AWXB 3GVAA 5E1WA 3S2WA 2LSOA 3GFLA 1DDNA 4PNCA 4P9FA 2HZTA 1MGTA 4HV6A 5E20A 1YW8A 2FF4A 2DK5A 3CB6A 4EJUA 3EYIA 4ON0A 3J81Z 1ON1A 3ZMZA 5HLHA 1KQ0A 4RS8A 3RKXA 2QBYA 1MJBA 3SQNA 2DAOA 1IN5A 2OU2A 4KT5C 4RGXA 2EA4A 3ZN1A 1CHMA 1TLHB 1M35A 3RI4A 1Z7UA 4NHJA 5BS6A 3GUDA 4IKRA 5H6RA 4IVNA 2P8TA 1BI2A 4IKSA 2GG8A 4AIJA 1QGPA 3QU6A 2ZCWA 2BWUA 2XVCA 4DNCA 1WLRA 4KIGA 1I1SA 2TDXA 2W84A 4S2TP 4YFKF 1K78B 4I09A 5H20A 2VN2A 2E1CA 5FLXZ 4M72A 2ACJA 1FC3A 1D8JA 3JAMK 1FLIA 3ECOA 1BIAA 1IXSB 3U2RA 4CGZA 4IDYA 2X0LA 3R60A 3HOTA 3P7NA 2GU6A 2A68F 3VFZA 2GAUA 1FYLA 1SD7A 5LHGA 1S7AA 2YPRA 1XDSA 3G73A 3JSPA 3LQRA 4JK1X 2BYVE 5CLSA 2VODA 3HTSB 1XGNA 3F23A 3FF5A 4FLIA 3CUOA 1P4WA 3M9AA 3W6JB 1F9NA 4MHGA 3AAFA 3IHUA 1X3UA 2GGCA 4HF0A 1YJ3A 1O3SA 1YYVA 3CB5A 2X4HA 5LBQA 2BHBA 2O0YA 4EVIA 2Q93A 4IHSA 1TBXA 1B9NA 5D4RA 3TO9A 4L18B 2P7VB 1EV7A 4U0WA 2Z5UA 5E18F 1T98A 3EDPA 1YS6A 4ZZDA 3IWZA 4UV9A 3FM3A 2A5YB 2XAJA 2GQQA 1R1UA 4P5OA 1G3WA 3LQQA 1GXQA 3RVAA 1R1VA 1XMKA 2L02A 4ESFA 2KKOA 1S29A 2PQ8A 1W5SA 4FT8A 1LNWA 2HEOA 3GXOA 2ESHA 2RVCA 4FX0A 4U69A 5LEKA 1ZH5A 4MATA 2BGCA 4L0YB 4CDGA 4OIOF 1U2WA 4A5MA 3MFKA 4KN7X 3IRQA 1W7PA 1IN6A 1YS7A 2QQAA 2E7XA 2VE8A 4QWQA 4RAYA 1BOAA 4EJTA 1Z91A 3I58A 5L3EA 2MLGA 3ZMSA 3PFIA 2HTSA 2RQPA 3J80Z 3F6VA 4UVBA 3BZ6A 2GG2A 4H0EA 1Z6RA 2B3KA 1IF1A 2EV5A 2QUFA 2E1NA 3CLOA 3IWFA 3MQ0A 1TNTA 5LGNA 4FO7A 2V3ZA 4HW0A 1H9GA 4I2OA 1S8NA 3M8EA 4XBFA 3ECHA 4EQQA 1K79A 1G3YA 4FHTA 3VODA 5ED4A 4RZZA 2F2EA 3GX4X 4JQFA 4ZNGA 3F22A 3KZZA 2P6TA 2V79A 4L9NA 2F5EA 4WXDA 3T8TA 3WTUC 1T38A 5CDLA 4WF2A 1BI3A 1HSJA 4RGSA 2O8XA 4L9VA 3BP8A 2JRTA 3GFJA 4CZZA 1EH7A 3G3ZA 5D6EA 2XRNA 2K7LA 2D2WA 3P9CA 3T1BA 4M6YA 5EEGA 1TTYA 2E7WA 2HYGD 4R8HA 4G7OF 1FBUA 2DU9A 3E3VA 2XAGA 3RYRA 1A04A 2EJRA 2ZKZA 5L3FA 1R00A 1RNLA 2L54A 2NS0A 5CVIA 4LG0A 3KE2A 4OIRF 3PKDA 1LB2A 2WTEA 3I59B 1C23A 3ZMUA 3B73A 1XDUA 1QQIA 1H0MA 2GU7A 2BH3A 2BV6A 1C22A 4Z7MA 4G7ZF 4LFUA 3QAHA 4A12A 3L09A 3C3WA 4KNYA 3MR1A 3LA7A 1P6RA 4I0AA 4IRHA 5KVRA 3TOAA 1R23A 3E6DA 1ODDA 2XAFA 4HDUA 1S3JA 3KEOA 4IRIA 2CSOA 3OOPA 2XUBA 1IRFA 3D27A 2ZNZA 3L7WA 4HF2A 1R22A 2QZ8A 3TB5A 2JTVA 4A5NA 5CIKA 3D5LA 4U6ZA 2FBKA 4PZJA 4AIHA 4A6WA 5BOXA 3P9IA 5D5XB 2PFBA 4RGUA 1CF7B 3SHFA 2Z9OA 3LA3A 3S6BA 2P5KA 5K5RA 5FFXA 4EM2A 2VBWA 1ZRCA 2KIUA 1SMYF 2M8EA 3WGIA 2EV0A 3I4PA 1SD5A 1R5HA 2RN7A 3PKBA 3HIFA 2KIFA 4HLXA 2Z33A 1WY2A 4IF7A 1G3SA 1ZLJA 1FBQA 2COMA 3I5UA 4ENJA 1GVJA 5FLXK 1R58A 3DFGA 2FOKA 1YO5C 2EV6A 5J6XA 1I27A 4UNOA 2UXXA 2DPUA 4UV8A 2HYFA 2STWA 2BWVA 4LB5A 4U6JA 5D4SA 2LF8A 3TO6A 1FNNA 4Q48A 2CG4A 1LEAA 3O6BB 2W85A 4ZZLA 3QP6A 4P96A 3GFMA 1B4AA 2BBYA 2GU5A 2Q95A 5CE6A 4XSXF 1HKSA 3N4MA 1IN7A 4MEXF 4RZYA 1HW1A 3QP5A 5DCMB 4A0YA 2G9WA 2FQ3A 1B1BA 4D0PA 2CYYA 2XKOA 5LRSA 1WWXA 4LD5A 4CHUA 1WL9A 3L7GA 3E6BA 4OOKA 5AIQA 2W57A 3I53A 3HHGA 4MTEA 4GYGA 2DT5A 1W5TA 2DFIA 1SD4A 4A0XA 4ZWOA 3KP5A 2CWEA 1UFMA 3K2ZA 1XSDA 2PG4A 1SD6A 4BQAA 1J5YA 1SMTA 4KA4A 4CYDA 1OYIA 1BJAA 1ZHFA 2DI3A 1BIBA 2FRHA 1EH8A 4NB5A 2BHDA 2EVMA 3QOPA 1QBJA 5HLGA 1BM9A 1QXYA 2KIMA 4GYIA 4K2EA 2D45A 3LSTA 4ZYEA 5IT3A 3DF8A 4DQ2A 5LLQA 1IN4A 2XASA 2BWXA 3IKTA 2M30A 5LEJA 2BWYA 3VB2A 2PLYA 2DLLA 1PUEE 1QNTA 2KRFA 3ZN0A 3MZHA 3GW2A 4G94A 1S7OA 3BPXA 3IC7A 1OMIA 4HF1A 1HKQA 3BJAA 2GWRA 3KP6A 2CW0F 3ZQ7A 1HXDA 4OIPF 4G6DA 3NEUA 1J75A 2IW2A 3J80K 3CO6C 4ZH4F 5FO5A 1Q1HA 2GZWA 3QPTA 3QU3A 5DEQA 1U6GA 2VT2A 2GG0A 1L0OC 4U7BA 1YFHA 5BPDA 1HBXG 3MZYA 1GHCA 1AOYA 2IA0A 1U5TA 3MCZA 3TKYA 3T8RA 3KFWX 1J2XA 2GIVA 3K1MA 1MKMA 2Q92A 3O2PE 3TAVA 2FXAA 2P9AA 3K69A 3I71A 5FD6A 2IW5A 1R36A 1YG2A 2O03A 2NQ6A 4R1HA 3HRTA 3COAC 1TW3A 1XSXA 5D5WB 4EV0A 2IA2A 1SFUA 3M7GA 3BOQA 2O61A 1RZ4A 1YVMA 4M71A 1J0RA 1UHMA 4U71A 4HV5A 5H6QA 2L01A 1FT9A 2FBIA 2DW4A 2JT1A 4GO1A 2PI0A 3KP2A 2Q8KA 2BWTA 4FLLA 3T5XA 2MA3A 3ROUA 4CICA 2P5VA 2WWYA 4PDKA 2FSWA 4QLCU 3T0YA 2R7DA 2EB7A 1OYWA 2FBHA 3ABTA 2PMUA 2P5LC 1O57A 1KQ8A 1KYWA 2H6BA 4YG2F 2QM3A 5JR3A 1JE8A 4U1BA 3FX3A 1EH6A 2KJCA 4HQEA 4R79A 2RDPA 1USSA 2PMHA 3CUQC 2GG3A 4RB2C 1REPC 5DV5A 2L3DA 1K6OA 3J7AO 1FSEA 1W7VA 2D1VA 3BY6A 3WTWC 2EFOA 4ESBA 2EK5A 2ETHA 2LNBA 5FD5A 2EFPA 3BDDA 1ZARA 4EGYA 5ILUA 3DEUA 1R5GA 2DTRA 4LK0F 2FNPA 4Y13A 4LB6B 2JZYA 3L00A 5K5QA 3F8MA 4ENKA 4E70A 2M5WA 4G6QA 2DBBA 2DQLA 2QBYB 3ZMTA 2RKHA 3Q9SA 3RIRA 3CTAA 2D1HA 4KN4X 3H3ZA 1JHHA 4PGGA 5L3CA 2WV0A 3DV8A 5LHHA 1G4DA 4O5VA 4JUQA 3RTRA 1RIOH 2UXNA 1KA8A 1QO0D 1U3EM 5DDGA 5HDNA 1HQCA 1G6NA 1U5TB 2XHKA 1XGMA 3E5QA 1LVAA 4M9ZA 4KM3A 4UUVA 3DPTA 4BH9A 2V1DA 1LJ9A 4YFXF 3HTUA 4KYWA 3H92A 5CYVA 4EMSA 1P92A 3BJOA 3MATA 1G3TA 1R1TA 1B6AA 2W24A 2GG5A 3F8FA 1LEBA 4MEYF 5ICCA 2YR2A 1FY7A 2A69F 1N51A 3H3UA 3GWZA 2W25A 3EUHA 3WTSC 2A6EF 3NRVA 4N9IA 4G7HF 3F72A 2PBIA 2ISYA 2VBXA 2XKPA 3JW4A 2G7UA 3RKWA 1RUNA 2GA2A 1F4KA 3R4KA 5FCHA 2NYXA 1D3YA 4P55A 1O7FA 3PKEA 2RGVA 3IG4A 5E5BA 3SXYA 5CDEA 1ZG1A 3E97A 2HQRA 4HX7A 4OU0A 4M9XA 1P4XA 2IVMA 4YIIA 5KK1A 1QZZA 4HDVA 4L9TA 3TO7A 2H6CA 1FP1D 1BBYA 4FLKA 2Q94A 1ZLKA 4U76A 3QRFF 4FKCA 5JVTA 2VC1A 1IXCA 2QYOA 4UVAA 1MD0A 2H94A 4WXHA 4IHTA 3GLXA 4HOBA 1Z05A 4PCQA 2K02A 3V7CA 3F3XA 5LGUA 2IRFG 2ZXJA 4HA8A 3VOEA 4AVPA 4IU6A 1O7LA 1SFXA 3KLNA 2FNAA 2VT3A 2GA1A 1WSUA 3IKVA 3Q6DA 2DK8A 3HRUA 2EVOA 2HTJA 2K4BA 1T6SA 1IN8A 1BI1A 2MD5A 1FWZA 3E5XA 2H27A 1PP7U 2ZSGA 2EFNA 1DUXC 2GXGA 2BWSA 2OD5A 1W7PB 1TQIA 2G7HA 4ZYDA 4ZWUA 4M74A 3HOSA 3ISPA 3E6CC 2AS5F 1LDKB 1V3FA 3FZVA 5FB2A 2QQ9A 4ENNA 2NRAC 4ESJA 1MATA 1XNZA 4HXXA 3TDZC 1SFEA 4BHCA 1ZREA 3FMSA 2HQNA 1QZYA 4LK1F 3DKWA 4FX4A 4ZWPA 5FCFA 4M6XA 1B59A 2XROA 2V3YA 2MH2A 3MAJA 3WGHA 4ENMA 3RKYA 1XMAA 3I54A 3M1EA 1FSHA 4L0ZB 1ON2A 4XSZF 1KP0A 3CTZA 4LLLA 1U8RA 5AIPA 1Z9CA 1ZGJA 2P7CB 4LJZF 4EM1A 2J5PA 2EFQA 1QPMA 5TRDA 4G8XA 3N97A 2GG7A 1S6LA 2K86A 2BB7A 1C0WA 3GFIA 4OINF 1D8KA 4IJAA 4RB3C 3ZPLA 4Q5SF 3MWMA 4LLGF 2F5CA 2V1UA 4KIFA 2M87A 5BMZA 1K78A 2CO5A 2B0LA 1HW2A 3L2CA 1ZG5A 2NQ7A 1HSTA 3SZPA 5K5OA 2C6YA 2FMLA 1OKRA 1O3RA 5E1XA 3WODF 1B9MA 1FBSA 4LG0B 4I0BA 1ULYA 1ZYRF 2G6PA 4M9SA 1KQ9A 1XSVA 2FMYA 1XCVA 2VXZA 2BN7A 1XB4A 2L4AA 4HQMA 4OMZA 1I6XA 1YQAA 2FE3A 3FMQA 2HWVA 5A2QZ 3ML6A 1USTA 1T0FA 1Y1NA 3V4GA 1BI0A 5DD4A 2K27A 4U0YA 3KP4A 2A07F 2DO7A 3GEZA 4EJOA 1KYZA 3E6MA 4RAZA 3WTXC 3DXJF 3IU8A 3WTVC 2J5OA 4KMUX 2MBFA 4L5JA 1XGSA 2Y75A 5HDKA 3CO7C 5ICFA 4BYYA 2EWNA 2A6HF 1WRJA 2GU4A 2JSCA 2P99A 1XN7A 2A3SA 2EA2A 1JHFA 4U7DA 2HKOA 3ELKA 4HZFA 1LDDA 3U1DA 2HS5A 1K7AA 2PJPA 2GG9A 1OYYA 2QVOA 4U6CA 5CNXA 5FFZA 3HSRA 1UB9A 2VBYA 1L3LA 5IT9Z 1P2FA 3C1DA 1ZN2A 3B02A 4RB0A 1J9IA 4UXNA 2Z3YA 2O3FA 1PV9A 3FXRA 4I02A 4KUMA 3HHHA 2ZJ2A 2MH9A 3JTGA 3JTHA 4HBLA 5DD8A 4HLYA 4JBAA 3LAPA 4CXFA 2VOOA 4U73A 4LGWA 1YW9A 2H09A 4L9JA 5E17F 4AD9A 3DPLC 5HS7A 4TV7A 4BNCA 2NNNA 4A6EA 4WXCA 2OA4A 1HW5A 3WU0A 2GGBA 4Q47A 1I5ZA 4IPAA 5ILVA 1HKTA 3RPUA 3FWEA 2ZNYA 6PAXA 3IRRA 4XLNF 3U9GA 2YU3A 5ERIA 2ZO4A 2OAZA 2BEOA 3C7JA 4YFNF 3M8FA 5JFRA 4RB1A 2XV4S 2HKXA 3ZP5A 2OQRA 5K1YA 2YX7A 3F6OA 5BPIA 1T39A 1TNSA 4I98B 3CDHA 1OR7A 2STTA 3Q5FA 3WTTC
chains in the Genus database with same CATH superfamily
2Y31A 1FPQA 2JUGA 5ILSA 2NS7A 1TQMA 1X2MA 4L5IA 1C27A 1ZAOA 4BXXJ 3FISA 2WY8Q 1PP8F 1OCZH 3QWLA 2VC0A 2MLKA 3E7LA 3PKAA 3L9FA 1SFOJ 1YRNB 1IRXA 2NVUB 5CVVA 1BJZA 2MATA 1P4AA 5GP9A 3O8HA 5M5XJ 1O3TA 4ABZA 2V3XA 2IPQX 5HODA 3TOBA 1W0UA 4GCVA 2GXBA 1V4RA 2OZ6A 1Y0UA 1XGOA 5EEHA 4A3IJ 2KZGA 3BITA 4PJJA 4DOZA 2MABA 2YUSA 3RJPA 2M34A 1FOKA 4S0HB 3OSGA 2EIMH 3SFIA 3OWTA 1F5TA 1TWGJ 3FXQA 4OMYA 4B28A 3JRBA 3OYKA 3BR2A 2MGQA 3NQOA 4IQ4A 3VEPA 2XGDA 4A3BJ 2Q0OA 2R7TA 1JT6A 2LKPA 3ZMVA 4QIWN 4U88A 2NS8A 4WWCA 2LKXA 1GV5A 3IU9A 4MQVA 3GTOJ 1WJFA 1FEXA 4E7JA 3FXKA 5JLWA 4Y3OA 3L24A 2XAQA 3CCRI 5CJ9A 1OFCX 4ZYGA 5FGMA 5HVQC 4BDZA 3KLOA 2XAUA 5J8FA 1POGA 2F6CA 3R0JA 2MW8A 3BT9A 3WHBA 3ULQB 4E7HA 2NVYJ 3GF2A 5JI6A 3KZYA 4G9YA 4UVCA 4LMYA 5JLXA 1LFBA 1VTNC 3F9KA 1ZGAA 3V8KA 1LDJA 2Y69H 2ZMEA 1UG0A 3PUFA 2QCOA 1AWCA 4HX4A 2LDUA 3S1NJ 2P98A 5ICEA 2N8GA 1DPRA 3GZ5A 3O3KA 2GXAA 1ZRDA 2VOPA 3I59A 4WK8F 1WVRA 4A2UA 2HDCA 1YLFA 3VYUB 1WGXA 1IAWA 2K9NA 3DEWA 2HVQA 4A93J 4EGEA 3EETA 3HUGA 3I64A 2V9VA 4UHTA 1BC7C 1Y39A 2E1MB 4S00A 1Z6TA 4QR8A 4DYCA 1WFXA 1FYKA 2FD5A 3CCYA 3E1SA 5BQTA 1TT5B 1K4SA 4BAYA 3LA2A 4E7LA 4GGGA 1UJ8A 2EINH 3W3CA 1W2MA 4U70A 1Z0XA 4IHVA 2NNYA 4OOIA 5LHIA 4Y15A 2KIQA 2IAIA 1IRGA 4IKUA 3WU1B 3PKCA 4KDPA 3BWGA 3N05A 1E17A 2QWWA 2P6SA 5C3EJ 3L2QA 4O3MA 5J47A 2F5VA 4EGZA 3ZMDA 2XPWA 3EQLF 4O6JA 4Y17A 3I56I 4BJ5C 4ZYHA 3UR3C 1RUOA 2UWMA 3RORA 1UCRA 1WKMA 3F21A 1JAWA 1FOWA 2Y0MA 3H5NA 4S04A 3OYHA 1W5CC 3V8LA 2ZB9A 1ZTRA 4GFBA 1A6QA 4I01A 3A01A 2FEZA 3BQZA 4IXAA 1ITYA 4ETSA 4QPQA 2XRLA 2ECCA 2VQCA 1CF7A 1QZEA 3KETA 2P4WA 4HYEA 1N75A 2XAHA 5LGTA 1I3QJ 4B1RA 1JUPA 3RDIA 1NHAA 1ZR2A 2FU4A 3DCFA 5DUIA 1YTYA 3KCCA 3GBGA 1BW6A 4RLQA 1J59A 1MBEA 2FA5A 2QSFX 3TMOA 5D5VB 3WE2A 1JXSA 5CDVA 2EZKA 3IL2A 5D8KB 3TW6A 3V7SA 1A31A 1DP7P 5C44J 3H5AA 2DPDA 3CCJI 2O6GE 1KU9A 5ICGA 5IP6A 2MD0A 3BIPA 4RGZ1 3WG9A 4CCKA 2V1XA 3WGGA 4CA0A 2HI3A 1E3OC 1MJ9A 1WN1A 3HSFA 2M7AA 4WX9A 1S72I 1FP2A 3RCOA 1STZA 2GTXA 4E7SA 3GYHX 1YW7A 3D0SA 2V7FA 2R7FA 3KEQA 2P0WA 1R9TJ 1WL6A 3SZTA 2IXSA 4XONA 4XLCA 4EJVA 1KU7A 1R7JA 4XKBA 5HOOA 2CV1A 2LF7A 4N9HA 3I0TA 1C24A 1X1PA 1A6IA 2LMDA 4XRFA 2DQRA 3CMMA 4UUSB 1FX7A 2L9SA 5JHUA 3CUQA 5HLTA 1JJ8C 2TCTA 5A2QK 3ZQFA 5F1JA 1ERDA 3CLQA 4XLPF 4PFPA 1MH4A 4E6KG 5LD2C 1PDNC 2IA1A 3QPLA 3C18A 2K40A 3CJTB 5FKOA 3LSIA 4HPQA 2Z16A 4P9UA 2L4MA 4UUTA 5DCMA 2IJLA 3NAUA 3EPZA 2LBFB 1T2KA 4PGHA 3F8CA 2R5ZA 4B8XA 4C3HJ 1FYMA 4AIKA 2X85A 2Y48A 4R60A 2VB6A 2ZBKA 4HAMA 2ISZA 1MNEA 3ABUA 4KIBA 2KLOA 3H9JA 3IH2A 1IZ1A 4S05A 4L5EA 4Q4ZF 2VONA 3DTKA 2BHAA 2BXZA 3MVPA 1TP4A 2IS1A 2AXLA 1A16A 4BQOA 4OIQF 3HYIA 1VF9A 1YIOA 2OZUA 5FLMJ 4U6WA 4PFOA 4BXFA 3J7YJ 2JA6J 4S01A 2IGNA 3OYJA 3K4MA 1FZPB 2K4JA 5HS9A 1YIJI 3JAMZ 2M2EA 5HLIA 4LLNA 1F43A 5DYMA 4FUKA 1WI3A 4I76A 2BHCA 1K6YA 3GTJJ 2ZMEB 4AYBN 1SFKA 5E8IA 4XQFA 1FTZA 2WC2A 1MDMA 4U6EA 3TQNA 2ZJQF 4KICA 3KYDB 1UZCA 4RBOA 3K70C 1QXWA 5IT9K 4FLJA 5D6FA 5CVUA 2FX0A 3WE3A 2JQ7A 3OYDA 2XGCA 4I7HA 3FXUA 5TJJA 3R0AA 4IECA 3JSOA 3MEXA 5D5UB 2R7ZJ 3FKIJ 5L3GA 5L3BA 4KMFA 3VSLA 3ABKH 2JPCA 1JKOC 2OQGA 1RETA 1LKXA 2QQBA 3HZJA 3DLLF 2HFHA 2HOEA 4WCGA 3GTGJ 4IRGA 2LG4A 3QPHA 3LWFA 3J81K 4LOCA 3S1RJ 3SZGA 1MMGA 5DCFA 5F64A 4OWRB 2QENA 4FO8A 2K3FA 4XKCA 2ESNA 2RNJA 2IGOA 4M3GA 3V8JA 1IDZA 4F7ZA 1C21A 2ADUA 1SAXA 4AUXA 3FMRA 5CVRA 1QXZA 1F1ZA 1HCRA 1DPUA 3K1NA 1LQ1A 1D5VA 2CQKA 3P9KA 3F8NA 4IOCF 2KJBA 1KGSA 3R61A 3VDXA 2RV8A 2HQAA 2IT0A 4AIDA 3LSJA 2MC3A 4DZPA 3CJNA 5GAHJ 3FM5A 2M7BA 3G6EI 2EFWA 4IEJA 2XIGA 4M73A 5FRMA 2CUZA 2M45A 3KP3A 5E1ZB 1R4NB 3F8BA 2KRCA 4BE2A 1IXRC 1ONVA 1MJAA 2HVRA 3W6KB 3BPVA 2K85A 3LAJA 1UHWA 1R71A 4D9JA 1KU2A 4J19A 3LFKA 1MZBA 2HOWA 4ASNA 3ASNH 2CUEA 2MC4A 1JKRC 1GXPA 3RYPA 3R6SA 5HDGA 3BZKA 1W7PD 3CF2A 1B72A 3ASOH 5C4XJ 2BE5F 1YJWI 2ZFWA 2R93J 1SVMA 3FHZA 1ACIA 1RI7A 4D5CA 3OMYA 2R5YA 4N0BA 2DOFA 1ZRFA 1BC8C 3SFZA 2XC7A 1PJRA 1K4TA 1KU3A 1H9TA 1U78A 4U0VA 4KFCA 3IU7A 1YJNI 3RPQA 4GDFA 2YSRA 3LSGA 3MX6A 2PN6A 3HRSA 4RMNA 4OAZA 4CSWA 4NC7A 4PV4A 2ELKA 1MBGA 1QVTA 4BHPA 3IUOA 2EVCA 1MMDA 3RQIA 2OBPA 3TDUC 2GZ5A 4A6DA 3PO2J 2M1BA 2M0MA 4FCYA 2VBZA 5EZGA 1JUMA 2GOXB 2QKLB 2Y9ZA 2YX4A 3CCSI 4XRSA 1XCBA 3BIQA 1IUYA 3E5UA 2F5DA 4BHBA 1T08B 5LRRA 4KISA 3PQKA 1HOMA 3BJ6A 3K9TA 3Q9VA 5F1RA 2HGCA 2CGPA 4HX8A 3PQJA 2BHZA 3DKYA 2M4GA 2PEXA 5E8GA 4DZJA 5F0CA 3OR1C 1BN5A 3CUQB 1X1BA 1FMVA 4HRIA 2O9LA 2A61A 1MNMC 5EZHA 3K0LA 2B3HA 1XD7A 1ETVA 1TZLA 4IZZA 1OPCA 2X48A 5B3SH 2JA8J 1BL0A 5IPAA 2VUMJ 2VE9A 4ZTFA 3K1PA 2OKNA 2F5FA 3V7RA 4BJTA 1U5TC 4D7MA 2Z99A 1ORKA 3GO5A 4EJWA 2GBYA 1T56A 2BVLA 3HRMA 2HOSA 2DT7B 5L3DA 3GZNB 1IDYA 1CGPA 3JRFA 4AC0A 3JCUC 3DU5A 5AONA 1J7KA 4IKTA 4U75A 2CMPA 5BNGA 4JYKA 2L7KA 3ERED 2LTPA 3PIOF 1WH7A 5CPRB 2JMWA 2HR3A 3WTYC 3MD2A 1O3QA 4YIFA 2DYSH 1WJDA 2XGEA 5DUKA 3WTZA 4GXOA 4EM0B 3REOA 1Y1VJ 1W4MA 2KL4A 1ZG3A 4MGRA 2FUG2 4NQWA 5J4YA 2L0KA 2R3SA 4JX6A 4CCMA 1MDMB 4PJNA 1R5ID 3BTJA 1WI9A 3DP7A 1I1GA 3KP7A 1ETYA 1B8IB 4MQ9F 4A6VA 3GZ6A 3IP4B 5HS8A 2LD5A 4MTDA 4BXUA 3PNTA 3DQVC 5CVJA 5F6FA 3HSEA 2UZKA 2QLZA 5D8LB 1WBQA 1QHHD 2CFXA 1JGSA 2JPBA 1WQ2A 1TQPA 2IP2A 3OV8A 4Y7NJ 1TW2A 4A3CJ 3W2WA 5K7ZA 3TGNA 5EF6A 1NK3P 2Q96A 4CO8A 2RC4A 2X51A 4DW6A 3LSHA 4XRSG 4Z2YA 3PO3J 2ELHA 3FDYA 2JA2A 4XORA 2PMZN 2Q2EA 4IF4A 3TW7A 2E71A 1E2XA 4DBRA 2NAZA 3FIWA 4A3EJ 2V6CA 2BWWA 2Y9YA 3EYYA 4S2RP 3PUBA 2GOMA 4RGRA 2CQNA 4BY1J 5CQEA 1Z1DA 3BROA 5J8CA 1ZR4A 2EZLA 3OS1A 3ZQQA 2XGXA 3HKZN 2BY3A 2XPUA 3HC7A 2CW8A 4LITA 3CC4I 4B09A 1IJWC 2E2HJ 2BZTA 4MNUA 1O0XA 4PK4A 4A0ZA 1IW7F 2B3LA 1LVKA 2TRTA 4AWXB 3GVAA 5EJCA 3FXMA 5E1WA 3S2WA 2HDDA 2HXIA 2LSOA 4W1UA 4XMYA 3GFLA 3M4OJ 1UELB 5KCMA 1DDNA 5J40A 2DMQA 4PNCA 2KISA 3W6VA 5IOYA 1JJ6C 4P9FA 3OL3A 2R7QA 4NUBA 3Q0WA 5EYRA 2HZTA 1MGTA 1WJ5A 4HV6A 5E20A 4J01A 1YW8A 2CW7A 2DK5A 2FF4A 4A3FJ 3LFUA 3CB6A 4IHXA 2H1KA 4EJUA 3EYIA 2X6YA 1U8BA 1HLVA 1G59A 4ON0A 3J81Z 1ON1A 1VQLI 2VKHA 3ZMZA 5HLHA 2H8RA 4QPOA 4Y4RA 4D5FA 1KQ0A 4BQQA 4RS8A 4BBSJ 3PJRA 4II3A 3RKXA 4C9YA 2QBYA 1MJBA 4XK4A 1YJ9I 1B72B 3AG4H 3SQNA 2DAOA 2VKEA 3ABLH 1IN5A 2OU2A 1WJEA 2X1DA 4KT5C 4RGXA 3IAM2 4PJMA 1E0EA 2NVQJ 2EA4A 1XPXA 1DGRM 4NBQA 3ZN1A 1CHMA 1MMNA 1P7JA 1TLHB 2A05A 1M35A 3RI4A 3DWLE 1Z7UA 1EA3A 1IG7A 4NHJA 2K9MA 5BS6A 3GUDA 3KPHA 3ZQHA 2XDVA 2V4JC 4ZYAA 2AHQA 3B6CA 5TISC 4IKRA 2DT6A 4M3EA 4RM3A 5H6RA 4IVNA 1EKEA 2P8TA 2RREA 1VQ8I 1BI2A 1JTYA 2NOGA 1OCCH 4RM2A 1YI2I 4F93B 4B44A 3OS0A 1JI8A 4IKSA 2GG8A 2E60A 1RPWA 4AIJA 1QGPA 3QU6A 2ZCWA 2BWUA 2QKMB 2XVCA 3EUKL 4DNCA 3LMMA 1WLRA 4KIGA 2LLKA 1I1SA 3GTMJ 2CRGA 2TDXA 3JRIA 2H1LA 4V2FA 2Y2ZA 2W84A 2DA6A 4S2TP 2K9LA 2LY1A 4YFKF 1V5EA 2ICWG 4M3FA 4I09A 5H20A 1K78B 3SEQA 2VN2A 2E1CA 5FLXZ 3VYRB 3GTPJ 1RR8C 3FXOA 4M72A 1FC3A 2ACJA 1D8JA 3MKWB 3JAMK 1FLIA 3ECOA 1BIAA 1IXSB 3HM5A 3U2RA 2Q1ZB 5LFAA 5IY5H 4CGZA 4IDYA 2X0LA 1TC3C 3R60A 3HOTA 1JUSA 3P7NA 2GU6A 1H88C 2A68F 2JUCA 3VFZA 5M5WJ 1N25A 2GAUA 1V5GA 2WAQN 5B1BH 2PJRA 3BR6A 2LY9A 4N4OB 1FYLA 2DDBA 1SD7A 3K70D 1VFCA 1G8XA 5LHGA 1MIJA 1S7AA 3L2WA 2YPRA 1XDSA 1VQ4I 3G73A 2VQHA 2DTZA 3JSPA 4HNVA 3PIPF 3HXLA 4MIMA 3LQRA 4JK1X 2BYVE 2LKSA 4NQWB 4G12A 5CLSA 1I39A 2VODA 3HTSB 3D1NI 1XGNA 3F23A 1OCOH 3FF5A 1R49A 1A5JA 4FLIA 4CH7A 3CUOA 4B3XA 3OYFA 1P4WA 3M9AA 3BR3A 3UNGC 2V1NA 5M3MJ 1WH5A 3FK7A 3W6JB 1P7IA 3EUHC 1F9NA 2M9HA 4HG2A 4YELA 4MHGA 2W7NA 3AAFA 5KAIC 4ZDOA 2KHMA 3IHUA 3G2BA 2R7VA 1X3UA 2GGCA 2RAEA 4RAGA 2L5QA 4HF0A 5CKTA 3TBIA 2FOWA 1YJ3A 3WU2C 1O3SA 3ZCOA 2VKVA 1YYVA 3CB5A 3RKQA 2X4HA 2I8DA 5LBQA 1TWCJ 2E34A 3PFYA 2BHBA 3OYCA 2O0YA 4EVIA 5IP7J 2Q93A 4IHSA 1TBXA 1B9NA 5D4RA 4FISA 3TO9A 3OYNA 4L18B 2P7VB 2CS3A 1EV7A 1W36C 4U0WA 1GDTA 3H36A 4A3LJ 4NDLA 2Z5UA 5E18F 1T98A 2WA0A 1JT0A 2CJJA 3EDPA 4ZC3A 1H8AC 1NK2P 1YS6A 4ZZDA 3IWZA 4UV9A 4AYBA 1X4PA 3FM3A 5EG0B 3CJQB 2WV1A 1GT0C 1VI0A 2A5YB 2XAJA 2BW3A 2GQQA 3DTEA 1R1UA 4P5OA 4E7IA 3ZQLA 1G3WA 3K7AJ 3LQQA 3JRHA 1GXQA 3OY9A 2O8KA 1DU0A 3RVAA 1FTTA 1R1VA 1XMKA 2L02A 2VPLA 4ESFA 2KKOA 1MBKA 2DJIA 1S29A 3BG5A 2K9QA 4RDUA 2PQ8A 4C3JJ 1W5SA 4FT8A 1LNWA 2NOJB 2HEOA 3GXOA 1VQ9I 2ESHA 5GPAA 2RVCA 1BA5A 5F27A 4DBQA 3CC2I 4FX0A 4U69A 2IEKA 5LEKA 1ZH5A 4MATA 2HPMA 2BGCA 3K4CA 4L0YB 4CDGA 5B5EC 4CCOA 4C3IJ 1I6HJ 4OIOF 4FQGA 4XLAA 1U2WA 4A5MA 1UG2A 4PUSA 3KYLA 3MFKA 4KN7X 3IRQA 1W7PA 5FROA 3IH4A 3TEDA 1IN6A 1YS7A 3HGGA 2CQQA 1NH3A 2VJ4A 4BQNA 2QQAA 4MFDA 2VJIA 2E7XA 2VE8A 2EPFA 2HU9A 4QWQA 1PUFA 4RAYA 1BOAA 1X1AA 2IS4A 5IOZA 4EJTA 5EGOB 1Z91A 3AFHA 3OYBA 1ZQ3P 3I58A 5L3EA 2MLGA 3ZMSA 3PFIA 1HA8A 2COBA 2HTSA 2RQPA 3J80Z 1W1WE 3F6VA 4UVBA 3BZ6A 4ZDLA 3JRGA 2GG2A 2WB1N 3C2BA 2M0CA 4H0EA 1OISA 1Z6RA 2B3KA 3KX2A 4XLFA 3PNVA 3MMYB 5E3MA 1IF1A 2GM4A 2EV5A 2FJ1A 2VLAA 2AQFA 2QUFA 3B6AA 1FOYA 2CFOA 1BOBA 2E1NA 3CLOA 3IWFA 3MQ0A 1TNTA 5LGNA 2JJ7A 5HNFA 4FO7A 2KQRA 1VQNI 2V3ZA 4HW0A 1H9GA 2AXTC 4I2OA 1S8NA 3M8EA 4XBFA 2JA7J 3ECHA 4EQQA 3GTLJ 2X9DA 1SC7A 5DM7F 1K79A 1G3YA 4FHTA 1ETXA 3VODA 5ED4A 4RZZA 3ZR8X 2F2EA 4DYQA 3VSKA 5M5YJ 2G0EA 3GX4X 1SEUA 2F4MB 4JQFA 5JVGF 4ZNGA 3CCUI 3F22A 1XTAA 3KZZA 4M3BA 2P6TA 2V79A 1Z3XA 4L9NA 2OCCH 2F5EA 1OCTC 2BY2A 4WXDA 2ID3A 2LFBA 5E17F 2LP0A 3T8TA 3WTUC 1T38A 5CDLA 4WF2A 1BI3A 1HSJA 3M1CA 4RGSA 3S8PA 3HL2A 3CCQI 4ZTJA 2O8XA 4L9VA 3UKGA 3BP8A 2JRTA 2X6WA 4IOAF 4UY8I 4A3GJ 3GFJA 4CZZA 1EH7A 3G3ZA 5D6EA 3HB9A 2XRNA 2K7LA 2D2WA 2K3PA 2DMTA 3P9CA 3T1BA 4M6YA 2V9KA 4MFEA 1KONA 1TTYA 5EEGA 3OYGA 2E7WA 5GTIC 4XR6A 2HYGD 4R8HA 3HDDA 3A0BC 1FBUA 2DU9A 4G7OF 2EIJH 3E3VA 2XAGA 3RYRA 1A35A 3DBLB 2EZHA 1A04A 5FJ8J 3C2HA 2EJRA 2ZKZA 2IGMA 2LC2A 5GAEJ 5L3FA 5EEAA 4U87A 1R00A 2DJNA 1RNLA 2L54A 2NS0A 3S2DJ 5CVIA 4LG0A 1VQ6I 3KE2A 4OIRF 3AL0C 3PKDA 2VPRA 1LB2A 1D0YA 2WTEA 3I59B 1C23A 4XRMA 1Z67A 2IGKA 3VPRA 3B73A 3ZMUA 1FJLA 3H35A 1XDUA 1QQIA 3CZ6A 9ANTA 1H0MA 2R7SA 2EIKH 2GU7A 2BH3A 3CF5F 2BV6A 2OPTA 1C22A 4Z7MA 4G7ZF 4LFUA 2DA3A 3HUGB 4XLEA 1KZHA 3L1PA 3QAHA 4A12A 1APLC 3BLYA 3H0GJ 3L09A 3C3WA 4KNYA 1ETWA 3MR1A 2DMUA 3M07A 1U9NA 1P6RA 1BR1A 3LA7A 2BW3B 3HOVJ 4I0AA 4IRHA 3PNYA 2QF7A 1FIAA 5KVRA 3TOAA 1AU7A 1R23A 3JRDA 3BTIA 3E6DA 1ODDA 3BZCA 1G2HA 2R7OA 2XAFA 3S2HJ 4BEHA 4D7NA 3RZOJ 1Y1WJ 3GTQJ 4HDUA 1S3JA 3KEOA 3S32A 3A0HC 4IRIA 1YOVB 1OQYA 2CSOA 3OOPA 2XUBA 1IRFA 3D5SC 4JX5A 4CUGA 2ZNZA 4E4HA 3L7WA 3D27A 4HF2A 1R22A 2QZ8A 2PMZA 3TB5A 2JTVA 4A5NA 2RQQA 4V2GA 5CIKA 3D5LA 4XOTA 4U6ZA 4HEA2 4X6AJ 2FBKA 1T95A 2L7FP 3I9V2 3PM1A 4PZJA 4AIHA 5BOXA 4A6WA 2VJ5A 3KZIC 3U21A 3A01B 4BL0B 3P9IA 3HKZA 5D5XB 2PFBA 1VQMI 1DQUA 3L2RA 2JA5J 4RGUA 1CF7B 3SHFA 2GIZA 3LA3A 2Z9OA 3S6BA 2P5KA 5K5RA 5FFXA 4EM2A 2VBWA 1N77A 1OCRH 1ZRCA 2KIUA 1SMYF 2M8EA 5IYDJ 3WGIA 1PUFB 2EV0A 2JWTA 2LH9A 1SD5A 3I4PA 1CQTA 1R5HA 2DFHA 2RN7A 2KPMA 3PKBA 3HIFA 2KIFA 1JKQC 4HLXA 2Z33A 1WY2A 4IF7A 1D0ZA 1G3SA 1ZLJA 1FBQA 2COMA 4MLOA 3LOCA 3I5UA 4ENJA 1GVJA 2ECBA 2F4OB 5FLXK 1R58A 5FKMA 1AKHA 3DFGA 2E1MC 2FOKA 1YO5C 2EV6A 2HZDA 2LOOA 5J6XA 1I27A 4UB8C 4UNOA 2UXXA 2DPUA 2YU9J 1D1BA 4UV8A 4FASD 4Y52J 2HYFA 2STWA 2HQ5A 3U1KA 4LB5A 2BWVA 4U6JA 3KIOA 5D4SA 2LF8A 3TO6A 3GLLA 3BG6A 3FXJA 1FNNA 2Y30A 4F55A 4Q48A 2EBIA 4BACA 2CG4A 1LEAA 2WY7Q 2W85A 3BTCA 3O6BB 3QP6A 4CCLA 4ZZLA 1HDDC 4P96A 3H1CA 3GFMA 1B4AA 1Z3YA 2BBYA 2GU5A 2Q95A 5CE6A 4XSXF 2HYJA 1HKSA 1OCPA 2NXNB 2K5CA 3HEFA 3N4MA 1IN7A 1JGGA 4MEXF 2DA5A 4RLFA 4RZYA 3P5JA 4PJ0C 3A1YA 2GLOA 3HGYA 4FE7A 1HW1A 2B9SA 3QP5A 5DCMB 4A0YA 4A3DJ 2G9WA 3HG9A 5HNHA 2FQ3A 2R5ZB 1DGWY 1YE9A 1I3AA 1B1BA 4D0PA 2CYYA 2XKOA 3QOEA 1WWXA 5LRSA 4LD5A 2HVSA 4CHUA 2R7UA 1WL9A 3I3LA 2EZIA 3L7GA 3E6BA 4OOKA 4D1QA 5AIQA 2W57A 2AO9A 3A02A 4BS9A 3K4BA 4C2MJ 4RA2A 3QYEA 2F4IA 3I53A 3HHGA 4XN3A 2EQRA 4MTEA 3LL7A 3OIPA 2LR8A 5J4VA 4GYGA 3BG9A 4IL6C 2DT5A 2IS2A 1RKWA 1W5TA 4EEFG 1YRNA 3K4KA 2DFIA 4F52A 4I6ZA 5M3FJ 1SD4A 3ESWB 1W36D 4A0XA 4ZWOA 3KP5A 3CCLI 2QSHX 2CWEA 1UFMA 3K2AA 3K2ZA 1XSDA 1OR7C 2FQ4A 3I4MJ 2VQLA 1X1CA 2PG4A 1SD6A 4BQAA 2L9NA 1J5YA 3MKLA 2WAQA 1SMTA 4KA4A 4BDYA 3ABMH 1X2NA 1IV6A 4EATA 1FIPA 4CYDA 1OYIA 1BJAA 1ZHFA 2DI3A 1BIBA 2FRHA 2L9RA 1EH8A 4NB5A 3I55I 1XG1A 1A36A 1V55H 2BHDA 2EVMA 3NWTA 3QOPA 3HOXJ 1QBJA 5HLGA 3IH3A 1BM9A 1QXYA 5E79C 2I5UA 2KIMA 4GRIA 4GYIA 4BBRJ 4K2EA 2VQGA 4AM3A 3CDLA 4BKXA 5IP9J 3FKJA 3LSTA 4ZYEA 2DFFA 3ZQCA 2D45A 1IRZA 2BOLA 5CQGA 3ZXSA 4BUPA 5IT3A 3ONQA 3X2QH 4HSRA 4BEHB 3DF8A 3DBHB 4DQ2A 2OV7A 4E7ZA 5LLQA 2QA4I 1IN4A 2XASA 2BWXA 3IKTA 3HOWJ 5FKLA 2M30A 5LEJA 4B47A 3VWBA 2BWYA 3ZGKA 2XSJC 3VB2A 3VYSB 1ZGWA 3CD6I 2PLYA 2DLLA 1PUEE 1QNTA 2KRFA 3OIQA 3ZN0A 3MZHA 3GW2A 2LK2A 1N78A 3BTLA 4G94A 2ZJRF 4XLHA 1S7OA 3TL4X 3BPXA 4JOMA 3IC7A 2KRHA 1OMIA 1MBFA 4HF1A 1HKQA 3BJAA 2GWRA 3KP6A 2CW0F 3OYAA 3ZQ7A 2EH3A 1HXDA 4OIPF 4G6DA 3NEUA 1J75A 2IW2A 3J80K 3CO6C 2ZMEC 1E3PA 3S1MJ 4ZH4F 1MNDA 5FO5A 3MKYB 5B1AH 1Q1HA 2GZWA 3H0DA 3QPTA 3QU3A 5DEQA 3VYTB 5E3LA 2QEXI 1U6GA 2R5YB 2VT2A 4DGWB 2DXIA 2B7EA 2GG0A 1V5FA 1L0OC 4U7BA 2XF5A 1BR4A 1YFHA 3SDBA 3CC7I 5BPDA 2L7ZA 3J7ZI 3E0JB 3D5RC 1HBXG 1AKHB 2CUJA 3V42A 1T8IA 1MBJA 3MZYA 1VNDA 1ZELA 1GHCA 4F91B 3KYCB 4F3QA 1AOYA 2ZSIB 2IA0A 1U5TA 3MCZA 3OOUA 3TKYA 3A4CA 2R92J 3T8RA 1XX5A 3RZDJ 3KFWX 4B43A 3K6GA 1J2XA 2GIVA 3K1MA 1MKMA 2Q92A 3O2PE 3TAVA 2FXAA 1TWAJ 2P9AA 1V54H 2DODA 3O8GA 3K69A 2XB0X 3I71A 5FD6A 2R7RA 3S3MA 2IW5A 1R36A 4P1WA 1YG2A 3LSRA 5F08A 2WAFA 2O03A 4XNFA 2M3AA 3H3VK 3QYBA 2NQ6A 4R1HA 3FK6A 3HRTA 3COAC 1TW3A 3ERMA 1XSXA 5D5WB 2OTLI 4EV0A 2IA2A 1NTCA 3AG3H 1SFUA 3M7GA 4W97A 4ANJA 1ETKA 3BOQA 3CMEI 2O61A 1RZ4A 1YVMA 2L2OA 3K4NA 1J0RA 4M71A 1UHMA 3HJEA 4ITVA 1EJ9A 1WHUA 1DP3A 4U71A 5C4JJ 3IV5A 4HV5A 1Y8RB 2WB1A 5H6QA 4E7KA 2L01A 3DKXA 3WG7H 2BHYA 1FT9A 4FETA 2FBIA 2DW4A 2HOTA 1RESA 2JT1A 1GUUA 4BE1A 2ZFUA 4GO1A 3CQZJ 2EILH 4X0GA 3KP2A 2Q8KA 2PI0A 2IBDA 2BWTA 3T5XA 4FLLA 1T33A 2MA3A 2KDZA 2MG4A 4G6TB 1JTXA 3G4SI 1LE8A 3ROUA 4HSTA 2E35A 5IYCJ 1H89C 1VQKI 4CICA 2P5VA 2WWYA 4PDKA 1IGNA 2FSWA 2OJED 3FHNA 4QLCU 5F04A 1SVLA 3W2AA 3T0YA 2R7DA 2EB7A 2R0QC 2R4GA 1OYWA 2FBHA 3ABTA 4UUSA 2PMUA 2P5LC 1MMSA 1O57A 2WBMA 1KQ8A 3NWSA 2DMPA 2XF6A 1KYWA 4PSXA 5J1UA 5GAGJ 3PSFA 2H6BA 4YG2F 2QM3A 5JR3A 3ZRGA 1U9OA 3CP8A 3Q0VA 1R4MB 2W48A 2LRDA 3H9QA 2LBFA 1JE8A 2LREA 1WCMJ 4U1BA 3FX3A 4YIRX 1EH6A 2Q2EB 2KJCA 4HQEA 1YITI 4R79A 4ZDPA 5FLVA 3S15J 2RDPA 1USSA 2PMHA 3CUQC 1ETOA 3DLAA 1X4OA 4C2UA 2GG3A 4CCNA 1R6RA 4OAYA 2K9SA 4RB2C 1REPC 5DV5A 3BR1A 2L3DA 1K6OA 3J7AO 3OSFA 2H8WA 4A3KJ 1FSEA 3QODA 4RAFA 1W7VA 3BY6A 2D1VA 1AA7A 2KZVA 3C2GA 1UHSA 2R7WA 4XOPA 1OLTA 2WADA 3WTWC 2EFOA 4ESBA 2XSDC 2EK5A 1LPQA 2ETHA 2LNBA 2A5WA 5FD5A 2EFPA 1TWHJ 3BDDA 4XICA 1ZARA 4EGYA 5ILUA 3BQYA 3DEUA 3GMEA 1R5GA 1QPIA 2DTRA 4LIVA 4LK0F 2FNPA 4Y13A 3HPGA 4LB6B 2JZYA 1RKTA 3J7AY 3L00A 2X6XA 5K5QA 3F8MA 3LSMA 1S9HA 4ENKA 4E70A 4IX7A 2W00A 2M5WA 4G6QA 2DBBA 2DQLA 2QBYB 1AHDP 3ZMTA 1FOXA 2RKHA 2Y0SN 3Q9SA 3RIRA 5KHDA 3CTAA 4II2A 2D1HA 4KN4X 3FBNB 3RSNA 3H3ZA 1JHHA 5J1YA 4PGGA 2YS9A 3OYLA 5L3CA 2WV0A 1SANA 2VL8A 3DV8A 3TP3A 5LHHA 3DTIA 1G4DA 4O5VA 1MSFC 2RNGA 3RTRA 4JUQA 1RIOH 5F0HA 2UXNA 1PYVA 2MFZA 1D0XA 1KA8A 1QO0D 1WJCA 1LFUP 1U3EM 5DDGA 1U0JA 5TGTA 1HQCA 5HDNA 2R7XA 2OUMA 1G6NA 1U5TB 4LIUA 5FRNA 2XHKA 1XGMA 3E5QA 3GTKJ 2B63J 3OL4A 1LVAA 4M9ZA 2E19A 4KM3A 4UUVA 3DPTA 4BH9A 2V1DA 1LJ9A 4YFXF 4XM3A 3HTUA 4Z6YA 4KYWA 3H92A 1YX5A 2HOAA 5CYVA 5H2FC 4EMSA 4HNUA 2BVMA 1P92A 3RPUD 1TT0A 4DIQA 3BJOA 2KMUA 1ETQA 1OJLA 3MATA 1G3TA 1R1TA 3Q0UA 1B6AA 3DU6A 2W24A 2GG5A 3OYEA 3F8FA 1LUJB 3LSKA 2VIXA 1W0TA 1LEBA 1O4XA 1MMAA 4MEYF 5E3NA 5ICCA 3DEEA 4B48A 3HOYJ 2HNHA 2VI6A 2V26A 2E5NA 2YR2A 1FY7A 1MW7A 1TWFJ 2A69F 5KAFC 1X1DA 1N51A 3H3UA 1X19A 2PJRB 3GWZA 1S7EA 2W25A 2ZXHA 3EUHA 3WTSC 2A6EF 3NRVA 4IO9F 4N9IA 4G7HF 3F72A 2PBIA 1LE8B 2JRMA 3QQAA 1MH3A 2ISYA 2F48A 1Q1VA 2VBXA 2XKPA 3JW4A 4QTRA 2DFEA 2I10A 3K4JA 5K7FA 2G7UA 2QQ8A 3RKWA 1RUNA 2GA2A 1F4KA 2LYCA 2DCEA 3R4KA 1UMQA 3JREA 2NVTJ 5FCHA 1VZ0A 1D3YA 2NYXA 4P55A 4IKFA 1O7FA 2VJJA 4BE0A 3HOZJ 2P81A 2VASA 3HPHA 3CCVI 1X3ZB 2DA2A 4F92B 5GADJ 4IQJA 4NC6A 3Q3SA 3PKEA 2RGVA 1VQPI 4MO7A 3IG4A 5E5BA 3PSIA 2DOAA 5J1RA 1S5LC 3SXYA 5CDEA 1ZG1A 3E97A 1QHGA 1LFPA 3S3OA 2HQRA 1WJBA 4HX7A 2CQ7A 1HF0A 4OU0A 3S1QJ 4M9XA 1GV2A 1PVEA 1P4XA 2IVMA 4YIIA 3CCEI 1VQ7I 4NC8A 5KK1A 1QZZA 1NG6A 2CV2A 4HDVA 3F0CA 1DU6A 4L9TA 3TO7A 2H6CA 3BG3A 4C2TA 1FP1D 1BBYA 1E3HA 4FLKA 2VKDA 2Q94A 2JVHA 2UUZA 1ZLKA 2OF7A 4U76A 4QSHA 3H9GA 2ELJA 3QRFF 4FKCA 1D5YA 1F36A 2BY1A 2VC1A 1IXCA 5JVTA 2QYOA 4KT6A 4UVAA 1UAAA 1MD0A 2H94A 2MYSA 4WXHA 4IHTA 5IYBJ 4A3MJ 3GLXA 1I50J 1B8IA 4HOBA 1Z05A 4PCQA 2K02A 3V7CA 3F3XA 5LGUA 2IRFG 1IUFA 1Y6IA 2KFDA 2ZXJA 4DJAA 2E36A 4HA8A 4M3DA 3VOEA 4AVPA 1YHQI 4IU6A 1O7LA 1SFXA 3KLNA 1FMWA 1IO2A 2FNAA 4LG3A 2VT3A 5F0FA 3CJRB 2GA1A 1WSUA 1Z7LA 3CP2A 3IKVA 2E2JJ 4ZJZA 3Q6DA 2DK8A 3HRUA 2E5ZA 2EVOA 2OCEA 5FKNA 2HTJA 1EF4A 2K4BA 1T6SA 1IN8A 2IS6A 1BI1A 1T0FC 4CYCA 2MD5A 3GCMA 1FWZA 3E5XA 2H27A 1PP7U 4IHWA 2ZSGA 2EFNA 1IV8A 1DUXC 2CV0A 2CQXA 2GXGA 2BWSA 3WHCA 2XB5A 4CCJA 3S17J 3BG7A 1TL8A 2L7MP 2OD5A 1W7PB 3OIOA 1TQIA 4YEJA 2G7HA 4ZYDA 3L2VA 4ZWUA 4M74A 3HOSA 3ISPA 3E6CC 2AS5F 3BCBA 1VQ5I 5JHFA 1LDKB 1V3FA 3FZVA 5FB2A 2QQ9A 3JR9A 1JKPC 1X58A 3AG1H 4ENNA 2Z1DA 4PSWA 2NRAC 4ESJA 5DS9A 2WAEA 3KEYA 1MATA 1XNZA 4HXXA 4DYRA 3TDZC 1SFEA 2XPVA 4AU7A 4BHCA 4BGDA 1K61A 1ZREA 4IHYA 1VQOI 3S14J 2ID6A 1RR7A 3FMSA 2DYRH 2HQNA 1QZYA 4Y33A 4LK1F 3DKWA 4FX4A 4ZWPA 5FCFA 1XMXA 4I99C 3SJMA 4M6XA 1B59A 2HPIA 2XROA 2V3YA 3TP0A 1RRJA 2MH2A 4XL9A 3MAJA 1WZ2A 2DOEA 1HC8A 3WGHA 4ENMA 4HNTA 1K83J 3RKYA 1XMAA 1IC8A 3I54A 2VXDA 3M1EA 4N4NB 5EDNA 3AKZA 1FSHA 4L0ZB 2OC6A 1ON2A 2KP6A 3ZQIA 3G71I 4XSZF 1QU3A 1KP0A 3CTZA 1Y0NA 2ZC2A 4LLLA 1XS9A 1U8RA 2KDOA 5AIPA 1Z9CA 1MBHA 1ZGJA 3W2VA 3K10A 2P7CB 4B4CA 4LJZF 4EM1A 4UB6C 2J5PA 2EFQA 1QPMA 5TRDA 2ME0A 4G8XA 3N97A 2GG7A 2OTJI 1S6LA 2K86A 2BB7A 1GVDA 1BW5A 5GPCA 3OYIA 3S16J 1C0WA 1SAUA 3GFIA 2JVGA 4OINF 4BY7J 2BY0A 3MKZA 1D8KA 3CMAI 4IJAA 4RB3C 3ZPLA 4A3JJ 4Q5SF 1D1CA 3MWMA 2CU7A 1GLNA 1M1EB 4LLGF 3JRAA 5KNLA 3FXLA 1D1AA 2DA1A 4V19K 1RC9A 4AVZA 2F5CA 2V1UA 2DA7A 3HBLA 4KIFA 2M87A 5BMZA 1K78A 2CO5A 2B0LA 1HW2A 2UV1A 3L2CA 1ZG5A 2NQ7A 2ME6A 1HSTA 3OS2A 3SZPA 5K5OA 2C6YA 2FMLA 1OKRA 1O3RA 2W82A 5E1XA 3WODF 1B9MA 1FBSA 4XKWA 4LG0B 3K4LA 4I0BA 1ULYA 1ZK8A 1ZYRF 3SDGA 3OYMA 1QRYA 2G6PA 1HDPA 4M9SA 3LSPA 4X1EA 1KQ9A 1XSVA 2FMYA 1XCVA 2VXZA 2BN7A 1XB4A 2L4AA 2DA4A 2PX9A 2M4KA 2V9PA 4HQMA 4OMZA 2KT0A 1I6XA 1YQAA 2FE3A 2ZJPF 2LY2A 2BXYA 3BR5A 1Y8QB 2HWVA 3FMQA 5GTHC 1YX3A 5A2QZ 2AQEA 3ML6A 1USTA 3A2KA 1T0FA 1Y1NA 3V4GA 1BI0A 3M3YJ 5DD4A 2K27A 4B3AA 4U0YA 3KP4A 2A07F 2DO7A 3CCMI 2ZSHB 3GEZA 2X6OA 2XF7A 4EJOA 2CH0A 5K7HA 1KYZA 3JRCA 3E6MA 4RAZA 1QA6A 3WTXC 3DXJF 3IU8A 3WTVC 1NG7A 2J5OA 4KMUX 5J3LA 2MSYA 1MSEC 2MBFA 3LNQA 4L5JA 2O7OA 1XGSA 2Y75A 5FKKA 5HDKA 3CO7C 5ICFA 4BYYA 3ZQGA 4JX4A 2EWNA 2A6HF 2DMNA 1WRJA 1Z21A 2GU4A 4BU2A 1J09A 2JSCA 2A6TA 4XIDA 1ENHA 4CYCB 2P99A 3RQ4A 4C30A 1SVOA 1XN7A 2JN6A 2A3SA 5B66C 2X1EA 3S93A 2EA2A 1XC5A 1JHFA 4U7DA 3CDIA 2CUFA 2HKOA 2W1OA 3ELKA 3G1LA 4HZFA 1LDDA 1Z77A 1Y56A 3CESA 3U1DA 2HS5A 1K7AA 2PJPA 2GG9A 1OYYA 2DN0A 2QVOA 3QYFA 4U6CA 5CNXA 3G1OA 5FFZA 3CMYA 3HSRA 1UB9A 3NARA 2VBYA 1L3LA 5IT9Z 1P2FA 3C1DA 5EG0A 1ZN2A 4JP0A 4FTHA 3B02A 3S3NA 5DM6F 4RB0A 1J9IA 3BCAA 2HDWA 2QSGX 3M8JA 4UXNA 4KJZA 4KITB 3ZOBA 4XKVA 2Z3YA 2O3FA 1PV9A 3FXRA 4PJLA 4I02A 4KUMA 3HHHA 2LVSA 3PL8A 3AG2H 2ZXIA 2ZJ2A 3HOUJ 1X3WB 4H4KC 2MH9A 3JTGA 3JTHA 4HBLA 5DD8A 4HLYA 4JBAA 3LAPA 4CXFA 4J00A 2E2IJ 2VOOA 4U73A 2O5RA 3A03A 1WJAA 2M8GX 4LGWA 2D5VA 1YW9A 2H09A 2DDAA 4FE4A 4L9JA 3MN2A 1P9QC 4AD9A 2L9VA 3DPLC 3BC8A 3BR0A 4TV7A 5HS7A 2JK3A 2QGUA 2Z2SB 4BNCA 2NNNA 3SYTA 2Y0SA 4A6EA 4WXCA 2HXOA 4CZCA 4A69C 1ZKGA 5DTDA 2OA4A 1HW5A 3WU0A 3MZ8A 5E3OA 3IAS2 3I4NJ 3DPUA 2GGBA 4Q47A 1I5ZA 4IPAA 5ILVA 1HKTA 3RPUA 3FWEA 3FBIB 2ZNYA 6PAXA 2V6EA 4M6VA 3L2UA 3IRRA 2ZXWH 3H5RA 4XLNF 3U9GA 2YU3A 5ERIA 2ZO4A 2OAZA 2BEOA 3DBRB 1BR2A 3C7JA 4YFNF 3M8FA 2NVXJ 5JFRA 3OR2C 3SEZA 2X1CA 4YRVA 4XN0A 2E1OA 4RB1A 5EGOA 2XV4S 2HKXA 4BJ6C 2W4SA 3ZP5A 2OQRA 3G1MA 3QPSA 5K1YA 2YX7A 3F6OA 5BPIA 1T39A 1TNSA 4I98B 3EUAA 3CDHA 1WPKA 1OR7A 4NNJA 2STTA 3AL0B 2JSPA 3Q5FA 3WTTC 1QVUA
chains in the Genus database with same CATH topology
1FPQA 5ILSA 1TQMA 4L5IA 1C27A 1ZAOA 1PP8F 2VC0A 2MLKA 3PKAA 3L9FA 5CVVA 2MATA 1P4AA 1O3TA 2V3XA 2IPQX 3TOBA 4GCVA 2GXBA 1V4RA 2OZ6A 1Y0UA 1XGOA 5EEHA 3BITA 3RJPA 1FOKA 1F5TA 3FXQA 4OMYA 4B28A 3NQOA 3VEPA 2Q0OA 4WWCA 2LKPA 3ZMVA 4U88A 3IU9A 4MQVA 3L24A 2XAQA 5CJ9A 4ZYGA 5FGMA 5HVQC 3KLOA 5J8FA 3R0JA 3ULQB 3GF2A 5JI6A 3KZYA 4G9YA 4UVCA 4LMYA 1VTNC 1ZGAA 3V8KA 1LDJA 2ZMEA 1AWCA 4HX4A 2LDUA 2P98A 5ICEA 1DPRA 3GZ5A 3O3KA 1ZRDA 2VOPA 3I59A 4WK8F 4A2UA 2HDCA 1YLFA 1IAWA 4EGEA 3EETA 3HUGA 3I64A 2V9VA 4UHTA 1BC7C 4S00A 1Z6TA 4QR8A 1FYKA 5BQTA 4BAYA 3LA2A 4GGGA 1W2MA 4U70A 2NNYA 4OOIA 5LHIA 4Y15A 1IRGA 4IKUA 3WU1B 3PKCA 4KDPA 3BWGA 1E17A 2QWWA 2P6SA 4O3MA 4EGZA 3ZMDA 3EQLF 4O6JA 4Y17A 3RORA 4ZYHA 1RUOA 2UWMA 1UCRA 1WKMA 3F21A 1JAWA 2Y0MA 4S04A 3V8LA 4I01A 2FEZA 4IXAA 4ETSA 1CF7A 3KETA 2P4WA 4HYEA 2XAHA 5LGTA 3RDIA 1NHAA 2FU4A 5DUIA 1YTYA 3KCCA 1J59A 2FA5A 5D5VB 3WE2A 1JXSA 5CDVA 3IL2A 5D8KB 3V7SA 1DP7P 2DPDA 2O6GE 1KU9A 5ICGA 3BIPA 4RGZ1 3WG9A 2V1XA 3WGGA 1MJ9A 1WN1A 3HSFA 4WX9A 1FP2A 1STZA 2GTXA 3GYHX 1YW7A 3D0SA 2R7FA 3KEQA 1WL6A 3SZTA 4EJVA 1KU7A 1R7JA 5HOOA 2LF7A 4N9HA 3I0TA 1C24A 4XRFA 2DQRA 1FX7A 5JHUA 3CUQA 5A2QK 4XLPF 1PDNC 2IA1A 3C18A 4P9UA 2L4MA 5DCMA 2IJLA 1T2KA 4PGHA 3F8CA 4B8XA 1FYMA 4AIKA 2Y48A 4R60A 2ISZA 2ZBKA 4HAMA 3ABUA 4KIBA 4Q4ZF 1IZ1A 4S05A 2VONA 2BHAA 2AXLA 1A16A 4OIQF 3HYIA 1YIOA 4U6WA 2OZUA 4S01A 1FZPB 2K4JA 5HS9A 3JAMZ 5HLIA 4LLNA 5DYMA 4FUKA 2BHCA 2ZMEB 5E8IA 2WC2A 1MDMA 4U6EA 3TQNA 4KICA 1QXWA 4FLJA 5IT9K 5D6FA 5CVUA 3WE3A 4I7HA 3FXUA 5TJJA 3R0AA 4IECA 3JSOA 3MEXA 5D5UB 5L3BA 5L3GA 4KMFA 2JPCA 2OQGA 2QQBA 2HFHA 2HOEA 4WCGA 4IRGA 3QPHA 3LWFA 3J81K 5DCFA 5F64A 2QENA 4FO8A 2ESNA 2RNJA 3V8JA 4F7ZA 1C21A 2ADUA 1SAXA 3FMRA 5CVRA 1QXZA 1F1ZA 1DPUA 3K1NA 1LQ1A 1D5VA 2CQKA 3P9KA 3F8NA 2KJBA 1KGSA 3R61A 2RV8A 2IT0A 2MC3A 3CJNA 3FM5A 2EFWA 2XIGA 4M73A 3KP3A 2M45A 5E1ZB 3F8BA 1IXRC 1ONVA 1MJAA 3W6KB 3BPVA 3LAJA 1UHWA 1KU2A 3LFKA 1MZBA 2HOWA 4ASNA 1GXPA 3RYPA 3R6SA 5HDGA 1W7PD 2BE5F 2ZFWA 3FHZA 1RI7A 4N0BA 1ZRFA 1BC8C 3SFZA 1KU3A 1H9TA 1U78A 4U0VA 4KFCA 3IU7A 3RPQA 2YSRA 3MX6A 2PN6A 3HRSA 4PV4A 4BHPA 2EVCA 2OBPA 3TDUC 2GZ5A 4A6DA 2M1BA 2VBZA 2YX4A 1XCBA 3BIQA 1IUYA 3E5UA 2F5DA 4BHBA 5LRRA 3PQKA 3BJ6A 3K9TA 3Q9VA 5F1RA 2HGCA 2CGPA 4HX8A 3PQJA 2PEXA 5E8GA 1BN5A 3CUQB 2A61A 3K0LA 2B3HA 1XD7A 1OPCA 2VE9A 3K1PA 2OKNA 2F5FA 3V7RA 1U5TC 2Z99A 3GO5A 4EJWA 3HRMA 5L3DA 1CGPA 5AONA 1J7KA 4IKTA 4U75A 3ERED 2HR3A 3WTYC 1O3QA 4YIFA 5DUKA 3WTZA 4GXOA 4EM0B 3REOA 1W4MA 1ZG3A 4MGRA 4NQWA 2R3SA 1MDMB 1WI9A 3DP7A 1I1GA 3KP7A 4MQ9F 4A6VA 3GZ6A 5HS8A 4MTDA 4BXUA 2UZKA 3DQVC 5CVJA 5F6FA 3HSEA 2QLZA 5D8LB 1WBQA 2CFXA 1JGSA 2JPBA 1WQ2A 1TQPA 2IP2A 3OV8A 1TW2A 3TGNA 2Q96A 4CO8A 2RC4A 4Z2YA 2ELHA 2Q2EA 4IF4A 1E2XA 2NAZA 2V6CA 2BWWA 3EYYA 4S2RP 4RGRA 1Z1DA 3BROA 5J8CA 2XGXA 4B09A 4MNUA 1O0XA 4A0ZA 1IW7F 2B3LA 4AWXB 3GVAA 5E1WA 3S2WA 2LSOA 3GFLA 1DDNA 4PNCA 4P9FA 2HZTA 1MGTA 4HV6A 5E20A 1YW8A 2FF4A 2DK5A 3CB6A 4EJUA 3EYIA 4ON0A 3J81Z 1ON1A 3ZMZA 5HLHA 1KQ0A 4RS8A 3RKXA 2QBYA 1MJBA 3SQNA 2DAOA 1IN5A 2OU2A 4KT5C 4RGXA 2EA4A 3ZN1A 1CHMA 1TLHB 1M35A 3RI4A 1Z7UA 4NHJA 5BS6A 3GUDA 4IKRA 5H6RA 4IVNA 2P8TA 1BI2A 4IKSA 2GG8A 4AIJA 1QGPA 3QU6A 2ZCWA 2BWUA 2XVCA 4DNCA 1WLRA 4KIGA 1I1SA 2TDXA 2W84A 4S2TP 4YFKF 1K78B 4I09A 5H20A 2VN2A 2E1CA 5FLXZ 4M72A 2ACJA 1FC3A 1D8JA 3JAMK 1FLIA 3ECOA 1BIAA 1IXSB 3U2RA 4CGZA 4IDYA 2X0LA 3R60A 3HOTA 3P7NA 2GU6A 2A68F 3VFZA 2GAUA 1FYLA 1SD7A 5LHGA 1S7AA 2YPRA 1XDSA 3G73A 3JSPA 3LQRA 4JK1X 2BYVE 5CLSA 2VODA 3HTSB 1XGNA 3F23A 3FF5A 4FLIA 3CUOA 1P4WA 3M9AA 3W6JB 1F9NA 4MHGA 3AAFA 3IHUA 1X3UA 2GGCA 4HF0A 1YJ3A 1O3SA 1YYVA 3CB5A 2X4HA 5LBQA 2BHBA 2O0YA 4EVIA 2Q93A 4IHSA 1TBXA 1B9NA 5D4RA 3TO9A 4L18B 2P7VB 1EV7A 4U0WA 2Z5UA 5E18F 1T98A 3EDPA 1YS6A 4ZZDA 3IWZA 4UV9A 3FM3A 2A5YB 2XAJA 2GQQA 1R1UA 4P5OA 1G3WA 3LQQA 1GXQA 3RVAA 1R1VA 1XMKA 2L02A 4ESFA 2KKOA 1S29A 2PQ8A 1W5SA 4FT8A 1LNWA 2HEOA 3GXOA 2ESHA 2RVCA 4FX0A 4U69A 5LEKA 1ZH5A 4MATA 2BGCA 4L0YB 4CDGA 4OIOF 1U2WA 4A5MA 3MFKA 4KN7X 3IRQA 1W7PA 1IN6A 1YS7A 2QQAA 2E7XA 2VE8A 4QWQA 4RAYA 1BOAA 4EJTA 1Z91A 3I58A 5L3EA 2MLGA 3ZMSA 3PFIA 2HTSA 2RQPA 3J80Z 3F6VA 4UVBA 3BZ6A 2GG2A 4H0EA 1Z6RA 2B3KA 1IF1A 2EV5A 2QUFA 2E1NA 3CLOA 3IWFA 3MQ0A 1TNTA 5LGNA 4FO7A 2V3ZA 4HW0A 1H9GA 4I2OA 1S8NA 3M8EA 4XBFA 3ECHA 4EQQA 1K79A 1G3YA 4FHTA 3VODA 5ED4A 4RZZA 2F2EA 3GX4X 4JQFA 4ZNGA 3F22A 3KZZA 2P6TA 2V79A 4L9NA 2F5EA 4WXDA 3T8TA 3WTUC 1T38A 5CDLA 4WF2A 1BI3A 1HSJA 4RGSA 2O8XA 4L9VA 3BP8A 2JRTA 3GFJA 4CZZA 1EH7A 3G3ZA 5D6EA 2XRNA 2K7LA 2D2WA 3P9CA 3T1BA 4M6YA 5EEGA 1TTYA 2E7WA 2HYGD 4R8HA 4G7OF 1FBUA 2DU9A 3E3VA 2XAGA 3RYRA 1A04A 2EJRA 2ZKZA 5L3FA 1R00A 1RNLA 2L54A 2NS0A 5CVIA 4LG0A 3KE2A 4OIRF 3PKDA 1LB2A 2WTEA 3I59B 1C23A 3ZMUA 3B73A 1XDUA 1QQIA 1H0MA 2GU7A 2BH3A 2BV6A 1C22A 4Z7MA 4G7ZF 4LFUA 3QAHA 4A12A 3L09A 3C3WA 4KNYA 3MR1A 3LA7A 1P6RA 4I0AA 4IRHA 5KVRA 3TOAA 1R23A 3E6DA 1ODDA 2XAFA 4HDUA 1S3JA 3KEOA 4IRIA 2CSOA 3OOPA 2XUBA 1IRFA 3D27A 2ZNZA 3L7WA 4HF2A 1R22A 2QZ8A 3TB5A 2JTVA 4A5NA 5CIKA 3D5LA 4U6ZA 2FBKA 4PZJA 4AIHA 4A6WA 5BOXA 3P9IA 5D5XB 2PFBA 4RGUA 1CF7B 3SHFA 2Z9OA 3LA3A 3S6BA 2P5KA 5K5RA 5FFXA 4EM2A 2VBWA 1ZRCA 2KIUA 1SMYF 2M8EA 3WGIA 2EV0A 3I4PA 1SD5A 1R5HA 2RN7A 3PKBA 3HIFA 2KIFA 4HLXA 2Z33A 1WY2A 4IF7A 1G3SA 1ZLJA 1FBQA 2COMA 3I5UA 4ENJA 1GVJA 5FLXK 1R58A 3DFGA 2FOKA 1YO5C 2EV6A 5J6XA 1I27A 4UNOA 2UXXA 2DPUA 4UV8A 2HYFA 2STWA 2BWVA 4LB5A 4U6JA 5D4SA 2LF8A 3TO6A 1FNNA 4Q48A 2CG4A 1LEAA 3O6BB 2W85A 4ZZLA 3QP6A 4P96A 3GFMA 1B4AA 2BBYA 2GU5A 2Q95A 5CE6A 4XSXF 1HKSA 3N4MA 1IN7A 4MEXF 4RZYA 1HW1A 3QP5A 5DCMB 4A0YA 2G9WA 2FQ3A 1B1BA 4D0PA 2CYYA 2XKOA 5LRSA 1WWXA 4LD5A 4CHUA 1WL9A 3L7GA 3E6BA 4OOKA 5AIQA 2W57A 3I53A 3HHGA 4MTEA 4GYGA 2DT5A 1W5TA 2DFIA 1SD4A 4A0XA 4ZWOA 3KP5A 2CWEA 1UFMA 3K2ZA 1XSDA 2PG4A 1SD6A 4BQAA 1J5YA 1SMTA 4KA4A 4CYDA 1OYIA 1BJAA 1ZHFA 2DI3A 1BIBA 2FRHA 1EH8A 4NB5A 2BHDA 2EVMA 3QOPA 1QBJA 5HLGA 1BM9A 1QXYA 2KIMA 4GYIA 4K2EA 2D45A 3LSTA 4ZYEA 5IT3A 3DF8A 4DQ2A 5LLQA 1IN4A 2XASA 2BWXA 3IKTA 2M30A 5LEJA 2BWYA 3VB2A 2PLYA 2DLLA 1PUEE 1QNTA 2KRFA 3ZN0A 3MZHA 3GW2A 4G94A 1S7OA 3BPXA 3IC7A 1OMIA 4HF1A 1HKQA 3BJAA 2GWRA 3KP6A 2CW0F 3ZQ7A 1HXDA 4OIPF 4G6DA 3NEUA 1J75A 2IW2A 3J80K 3CO6C 4ZH4F 5FO5A 1Q1HA 2GZWA 3QPTA 3QU3A 5DEQA 1U6GA 2VT2A 2GG0A 1L0OC 4U7BA 1YFHA 5BPDA 1HBXG 3MZYA 1GHCA 1AOYA 2IA0A 1U5TA 3MCZA 3TKYA 3T8RA 3KFWX 1J2XA 2GIVA 3K1MA 1MKMA 2Q92A 3O2PE 3TAVA 2FXAA 2P9AA 3K69A 3I71A 5FD6A 2IW5A 1R36A 1YG2A 2O03A 2NQ6A 4R1HA 3HRTA 3COAC 1TW3A 1XSXA 5D5WB 4EV0A 2IA2A 1SFUA 3M7GA 3BOQA 2O61A 1RZ4A 1YVMA 4M71A 1J0RA 1UHMA 4U71A 4HV5A 5H6QA 2L01A 1FT9A 2FBIA 2DW4A 2JT1A 4GO1A 2PI0A 3KP2A 2Q8KA 2BWTA 4FLLA 3T5XA 2MA3A 3ROUA 4CICA 2P5VA 2WWYA 4PDKA 2FSWA 4QLCU 3T0YA 2R7DA 2EB7A 1OYWA 2FBHA 3ABTA 2PMUA 2P5LC 1O57A 1KQ8A 1KYWA 2H6BA 4YG2F 2QM3A 5JR3A 1JE8A 4U1BA 3FX3A 1EH6A 2KJCA 4HQEA 4R79A 2RDPA 1USSA 2PMHA 3CUQC 2GG3A 4RB2C 1REPC 5DV5A 2L3DA 1K6OA 3J7AO 1FSEA 1W7VA 2D1VA 3BY6A 3WTWC 2EFOA 4ESBA 2EK5A 2ETHA 2LNBA 5FD5A 2EFPA 3BDDA 1ZARA 4EGYA 5ILUA 3DEUA 1R5GA 2DTRA 4LK0F 2FNPA 4Y13A 4LB6B 2JZYA 3L00A 5K5QA 3F8MA 4ENKA 4E70A 2M5WA 4G6QA 2DBBA 2DQLA 2QBYB 3ZMTA 2RKHA 3Q9SA 3RIRA 3CTAA 2D1HA 4KN4X 3H3ZA 1JHHA 4PGGA 5L3CA 2WV0A 3DV8A 5LHHA 1G4DA 4O5VA 4JUQA 3RTRA 1RIOH 2UXNA 1KA8A 1QO0D 1U3EM 5DDGA 5HDNA 1HQCA 1G6NA 1U5TB 2XHKA 1XGMA 3E5QA 1LVAA 4M9ZA 4KM3A 4UUVA 3DPTA 4BH9A 2V1DA 1LJ9A 4YFXF 3HTUA 4KYWA 3H92A 5CYVA 4EMSA 1P92A 3BJOA 3MATA 1G3TA 1R1TA 1B6AA 2W24A 2GG5A 3F8FA 1LEBA 4MEYF 5ICCA 2YR2A 1FY7A 2A69F 1N51A 3H3UA 3GWZA 2W25A 3EUHA 3WTSC 2A6EF 3NRVA 4N9IA 4G7HF 3F72A 2PBIA 2ISYA 2VBXA 2XKPA 3JW4A 2G7UA 3RKWA 1RUNA 2GA2A 1F4KA 3R4KA 5FCHA 2NYXA 1D3YA 4P55A 1O7FA 3PKEA 2RGVA 3IG4A 5E5BA 3SXYA 5CDEA 1ZG1A 3E97A 2HQRA 4HX7A 4OU0A 4M9XA 1P4XA 2IVMA 4YIIA 5KK1A 1QZZA 4HDVA 4L9TA 3TO7A 2H6CA 1FP1D 1BBYA 4FLKA 2Q94A 1ZLKA 4U76A 3QRFF 4FKCA 5JVTA 2VC1A 1IXCA 2QYOA 4UVAA 1MD0A 2H94A 4WXHA 4IHTA 3GLXA 4HOBA 1Z05A 4PCQA 2K02A 3V7CA 3F3XA 5LGUA 2IRFG 2ZXJA 4HA8A 3VOEA 4AVPA 4IU6A 1O7LA 1SFXA 3KLNA 2FNAA 2VT3A 2GA1A 1WSUA 3IKVA 3Q6DA 2DK8A 3HRUA 2EVOA 2HTJA 2K4BA 1T6SA 1IN8A 1BI1A 2MD5A 1FWZA 3E5XA 2H27A 1PP7U 2ZSGA 2EFNA 1DUXC 2GXGA 2BWSA 2OD5A 1W7PB 1TQIA 2G7HA 4ZYDA 4ZWUA 4M74A 3HOSA 3ISPA 3E6CC 2AS5F 1LDKB 1V3FA 3FZVA 5FB2A 2QQ9A 4ENNA 2NRAC 4ESJA 1MATA 1XNZA 4HXXA 3TDZC 1SFEA 4BHCA 1ZREA 3FMSA 2HQNA 1QZYA 4LK1F 3DKWA 4FX4A 4ZWPA 5FCFA 4M6XA 1B59A 2XROA 2V3YA 2MH2A 3MAJA 3WGHA 4ENMA 3RKYA 1XMAA 3I54A 3M1EA 1FSHA 4L0ZB 1ON2A 4XSZF 1KP0A 3CTZA 4LLLA 1U8RA 5AIPA 1Z9CA 1ZGJA 2P7CB 4LJZF 4EM1A 2J5PA 2EFQA 1QPMA 5TRDA 4G8XA 3N97A 2GG7A 1S6LA 2K86A 2BB7A 1C0WA 3GFIA 4OINF 1D8KA 4IJAA 4RB3C 3ZPLA 4Q5SF 3MWMA 4LLGF 2F5CA 2V1UA 4KIFA 2M87A 5BMZA 1K78A 2CO5A 2B0LA 1HW2A 3L2CA 1ZG5A 2NQ7A 1HSTA 3SZPA 5K5OA 2C6YA 2FMLA 1OKRA 1O3RA 5E1XA 3WODF 1B9MA 1FBSA 4LG0B 4I0BA 1ULYA 1ZYRF 2G6PA 4M9SA 1KQ9A 1XSVA 2FMYA 1XCVA 2VXZA 2BN7A 1XB4A 2L4AA 4HQMA 4OMZA 1I6XA 1YQAA 2FE3A 3FMQA 2HWVA 5A2QZ 3ML6A 1USTA 1T0FA 1Y1NA 3V4GA 1BI0A 5DD4A 2K27A 4U0YA 3KP4A 2A07F 2DO7A 3GEZA 4EJOA 1KYZA 3E6MA 4RAZA 3WTXC 3DXJF 3IU8A 3WTVC 2J5OA 4KMUX 2MBFA 4L5JA 1XGSA 2Y75A 5HDKA 3CO7C 5ICFA 4BYYA 2EWNA 2A6HF 1WRJA 2GU4A 2JSCA 2P99A 1XN7A 2A3SA 2EA2A 1JHFA 4U7DA 2HKOA 3ELKA 4HZFA 1LDDA 3U1DA 2HS5A 1K7AA 2PJPA 2GG9A 1OYYA 2QVOA 4U6CA 5CNXA 5FFZA 3HSRA 1UB9A 2VBYA 1L3LA 5IT9Z 1P2FA 3C1DA 1ZN2A 3B02A 4RB0A 1J9IA 4UXNA 2Z3YA 2O3FA 1PV9A 3FXRA 4I02A 4KUMA 3HHHA 2ZJ2A 2MH9A 3JTGA 3JTHA 4HBLA 5DD8A 4HLYA 4JBAA 3LAPA 4CXFA 2VOOA 4U73A 4LGWA 1YW9A 2H09A 4L9JA 5E17F 4AD9A 3DPLC 5HS7A 4TV7A 4BNCA 2NNNA 4A6EA 4WXCA 2OA4A 1HW5A 3WU0A 2GGBA 4Q47A 1I5ZA 4IPAA 5ILVA 1HKTA 3RPUA 3FWEA 2ZNYA 6PAXA 3IRRA 4XLNF 3U9GA 2YU3A 5ERIA 2ZO4A 2OAZA 2BEOA 3C7JA 4YFNF 3M8FA 5JFRA 4RB1A 2XV4S 2HKXA 3ZP5A 2OQRA 5K1YA 2YX7A 3F6OA 5BPIA 1T39A 1TNSA 4I98B 3CDHA