2GU6A

E. coli methionine aminopeptidase in complex with nlep, 1: 2, di-metalated
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu6A00
1BOAA 4IKSA 1QZYA 2BWTA 4A6VA 2V6CA 3BIPA 4U1BA 4U75A 2EVOA 1XGNA 2Q95A 1QXWA 3IU9A 3Q6DA 4R60A 2MATA 1YW9A 2GG2A 4IF7A 3BIQA 1WLRA 4S01A 4FKCA 2GTXA 2G6PA 1XNZA 3S6BA 5CE6A 5D6FA 4IKTA 2GU6A 2NQ6A 2P98A 1R5GA 2EVMA 2V3ZA 1Y1NA 4IPAA 5JI6A 2Q93A 3PKCA 4U70A 2OAZA 2BWYA 1XGMA 2GG5A 2BHDA 2GU5A 3BITA 2BWXA 3PKAA 1PV9A 3FMRA 2V3XA 4IDYA 4RZZA 5CLSA 5CIKA 1M35A 3IU7A 2IW2A 2GG3A 3PKEA 2EVCA 2GG8A 4ZWUA 5CDEA 1CHMA 2GA2A 2ZSGA 4MATA 4FLLA 2GU7A 2EA4A 3CB6A 4FLJA 5FCHA 1KP0A 2P99A 4U6JA 4ZWOA 2GG7A 3L7GA 1C21A 2GGCA 4U6CA 1N51A 4ZNGA 3MX6A 4RZYA 1YW7A 1QXZA 3PKDA 2Q8KA 2GGBA 2B3LA 2Q92A 1A16A 1R5HA 2GG9A 3CTZA 1C23A 4HXXA 5D6EA 3TB5A 1YJ3A 3RORA 2BHAA 2OKNA 5FCFA 3IU8A 2ADUA 1B59A 2BHBA 4KM3A 4PV4A 2NQ7A 3FM3A 3L24A 3MR1A 2BN7A 1B6AA 4JUQA 4RGZ1 4A6WA 4EGEA 2EA2A 4S2TP 1WL6A 2BWWA 3IG4A 2Q94A 2P9AA 2BWUA 4S2RP 1W7VA 4IKUA 5JFRA 5JHUA 4U76A 1MATA 2GU4A 2BWVA 1C27A 4OOKA 5CDLA 3PKBA 1R58A 4Z7MA 1BN5A 1XGSA 1WL9A 1WY2A 1JAWA 1WN1A 1WBQA 2B3KA 4IECA 4FLKA 4PNCA 5CDVA 3CB5A 2BH3A 4U71A 3TAVA 1C24A 4U6WA 1C22A 4B28A 3FMQA 3RVAA 1WKMA 1YVMA 3D27A 4U6EA 1O0XA 1QXYA 4IKRA 4U73A 4FO8A 4FLIA 2Q96A 1XGOA 2DFIA 2GZ5A 2V3YA 2BHCA 2B3HA 4FO7A 1KQ0A 4ZWPA 5CNXA 4U69A 2HOWA 1W2MA 4FUKA 2GG0A 4S00A 2BWSA 3MATA 4QR8A 2BB7A 1KQ9A 1YW8A 5E5BA 4IU6A 4U6ZA
chains in the Genus database with same CATH superfamily
1BOAA 4IKSA 1QZYA 2BWTA 4A6VA 2V6CA 3BIPA 4U1BA 4U75A 2EVOA 1XGNA 2Q95A 1QXWA 3IU9A 3Q6DA 4R60A 2MATA 1YW9A 2GG2A 4IF7A 3BIQA 1WLRA 4S01A 4FKCA 2GTXA 2G6PA 1XNZA 3S6BA 5CE6A 5D6FA 4IKTA 2GU6A 2NQ6A 2P98A 1R5GA 2EVMA 2V3ZA 1Y1NA 4IPAA 5JI6A 2Q93A 3PKCA 4U70A 2OAZA 2BWYA 1XGMA 2GG5A 2BHDA 2GU5A 3BITA 2BWXA 3PKAA 1PV9A 3FMRA 2V3XA 4IDYA 4RZZA 5CLSA 5CIKA 1M35A 3IU7A 2IW2A 2GG3A 3PKEA 2EVCA 2GG8A 4ZWUA 5CDEA 1CHMA 2GA2A 2ZSGA 4MATA 4FLLA 2GU7A 2EA4A 3CB6A 4FLJA 5FCHA 1KP0A 2P99A 4U6JA 4ZWOA 2GG7A 3L7GA 1C21A 2GGCA 4U6CA 1N51A 4ZNGA 3MX6A 4RZYA 1YW7A 1QXZA 3PKDA 2Q8KA 2GGBA 2B3LA 2Q92A 1A16A 1R5HA 2GG9A 3CTZA 1C23A 4HXXA 5D6EA 3TB5A 1YJ3A 3RORA 2BHAA 2OKNA 5FCFA 3IU8A 2ADUA 1B59A 2BHBA 4KM3A 4PV4A 2NQ7A 3FM3A 3L24A 3MR1A 2BN7A 1B6AA 4JUQA 4RGZ1 4A6WA 4EGEA 2EA2A 4S2TP 1WL6A 2BWWA 3IG4A 2Q94A 2P9AA 2BWUA 4S2RP 1W7VA 4IKUA 5JFRA 5JHUA 4U76A 1MATA 2GU4A 2BWVA 1C27A 4OOKA 5CDLA 3PKBA 1R58A 4Z7MA 1BN5A 1XGSA 1WL9A 1WY2A 1JAWA 1WN1A 1WBQA 2B3KA 4IECA 4FLKA 4PNCA 5CDVA 3CB5A 2BH3A 4U71A 3TAVA 1C24A 4U6WA 1C22A 4B28A 3FMQA 3RVAA 1WKMA 1YVMA 3D27A 4U6EA 1O0XA 1QXYA 4IKRA 4U73A 4FO8A 4FLIA 2Q96A 1XGOA 2DFIA 2GZ5A 2V3YA 2BHCA 2B3HA 4FO7A 1KQ0A 4ZWPA 5CNXA 4U69A 2HOWA 1W2MA 4FUKA 2GG0A 4S00A 2BWSA 3MATA 4QR8A 2BB7A 1KQ9A 1YW8A 5E5BA 4IU6A 4U6ZA
chains in the Genus database with same CATH topology
1BOAA 4IKSA 1QZYA 2BWTA 4A6VA 2V6CA 3BIPA 4U1BA 4U75A 2EVOA 1XGNA 2Q95A 1QXWA 3IU9A 3Q6DA 4R60A 2MATA 1YW9A 2GG2A 4IF7A 3BIQA 1WLRA 4S01A 4FKCA 2GTXA 2G6PA 1XNZA 3S6BA 5CE6A 5D6FA 4IKTA 2GU6A 2NQ6A 2P98A 1R5GA 2EVMA 2V3ZA 1Y1NA 4IPAA 5JI6A 2Q93A 3PKCA 4U70A 2OAZA 2BWYA 1XGMA 2GG5A 2BHDA 2GU5A 3BITA 2BWXA 3PKAA 1PV9A 3FMRA 2V3XA 4IDYA 4RZZA 5CLSA 5CIKA 1M35A 3IU7A 2IW2A 2GG3A 3PKEA 2EVCA 2GG8A 4ZWUA 5CDEA 1CHMA 2GA2A 2ZSGA 4MATA 4FLLA 2GU7A 2EA4A 3CB6A 4FLJA 5FCHA 1KP0A 2P99A 4U6JA 4ZWOA 2GG7A 3L7GA 1C21A 2GGCA 4U6CA 1N51A 4ZNGA 3MX6A 4RZYA 1YW7A 1QXZA 3PKDA 2Q8KA 2GGBA 2B3LA 2Q92A 1A16A 1R5HA 2GG9A 3CTZA 1C23A 4HXXA 5D6EA 3TB5A 1YJ3A 3RORA 2BHAA 2OKNA 5FCFA 3IU8A 2ADUA 1B59A 2BHBA 4KM3A 4PV4A 2NQ7A 3FM3A 3L24A 3MR1A 2BN7A 1B6AA 4JUQA 4RGZ1 4A6WA 4EGEA 2EA2A 4S2TP 1WL6A 2BWWA 3IG4A 2Q94A 2P9AA 2BWUA 4S2RP 1W7VA 4IKUA 5JFRA 5JHUA 4U76A 1MATA 2GU4A 2BWVA 1C27A 4OOKA 5CDLA 3PKBA 1R58A 4Z7MA 1BN5A 1XGSA 1WL9A 1WY2A 1JAWA 1WN1A 1WBQA 2B3KA 4IECA 4FLKA 4PNCA 5CDVA 3CB5A 2BH3A 4U71A 3TAVA 1C24A 4U6WA 1C22A 4B28A 3FMQA 3RVAA 1WKMA 1YVMA 3D27A 4U6EA 1O0XA 1QXYA 4IKRA 4U73A 4FO8A 4FLIA 2Q96A 1XGOA 2DFIA 2GZ5A 2V3YA 2BHCA 2B3HA 4FO7A 1KQ0A 4ZWPA 5CNXA 4U69A 2HOWA 1W2MA 4FUKA 2GG0A 4S00A 2BWSA 3MATA 4QR8A 2BB7A 1KQ9A 1YW8A 5E5BA 4IU6A 4U6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOA A;  4IKS A;  1QZY A;  2BWT A;  4A6V A;  2V6C A;  3BIP A;  4U1B A;  4U75 A;  2EVO A;  1XGN A;  2Q95 A;  1QXW A;  3IU9 A;  3Q6D A;  4R60 A;  2MAT A;  1YW9 A;  2GG2 A;  4IF7 A;  3BIQ A;  1WLR A;  4S01 A;  4FKC A;  2GTX A;  2G6P A;  1XNZ A;  3S6B A;  5CE6 A;  5D6F A;  4IKT A;  2GU6 A;  2NQ6 A;  2P98 A;  1R5G A;  2EVM A;  2V3Z A;  1Y1N A;  4IPA A;  5JI6 A;  2Q93 A;  3PKC A;  4U70 A;  2OAZ A;  2BWY A;  1XGM A;  2GG5 A;  2BHD A;  2GU5 A;  3BIT A;  2BWX A;  3PKA A;  1PV9 A;  3FMR A;  2V3X A;  4IDY A;  4RZZ A;  5CLS A;  5CIK A;  1M35 A;  3IU7 A;  2IW2 A;  2GG3 A;  3PKE A;  2EVC A;  2GG8 A;  4ZWU A;  5CDE A;  1CHM A;  2GA2 A;  2ZSG A;  4MAT A;  4FLL A;  2GU7 A;  2EA4 A;  3CB6 A;  4FLJ A;  5FCH A;  1KP0 A;  2P99 A;  4U6J A;  4ZWO A;  2GG7 A;  3L7G A;  1C21 A;  2GGC A;  4U6C A;  1N51 A;  4ZNG A;  3MX6 A;  4RZY A;  1YW7 A;  1QXZ A;  3PKD A;  2Q8K A;  2GGB A;  2B3L A;  2Q92 A;  1A16 A;  1R5H A;  2GG9 A;  3CTZ A;  1C23 A;  4HXX A;  5D6E A;  3TB5 A;  1YJ3 A;  3ROR A;  2BHA A;  2OKN A;  5FCF A;  3IU8 A;  2ADU A;  1B59 A;  2BHB A;  4KM3 A;  4PV4 A;  2NQ7 A;  3FM3 A;  3L24 A;  3MR1 A;  2BN7 A;  1B6A A;  4JUQ A;  4RGZ 1;  4A6W A;  4EGE A;  2EA2 A;  4S2T P;  1WL6 A;  2BWW A;  3IG4 A;  2Q94 A;  2P9A A;  2BWU A;  4S2R P;  1W7V A;  4IKU A;  5JFR A;  5JHU A;  4U76 A;  1MAT A;  2GU4 A;  2BWV A;  1C27 A;  4OOK A;  5CDL A;  3PKB A;  1R58 A;  4Z7M A;  1BN5 A;  1XGS A;  1WL9 A;  1WY2 A;  1JAW A;  1WN1 A;  1WBQ A;  2B3K A;  4IEC A;  4FLK A;  4PNC A;  5CDV A;  3CB5 A;  2BH3 A;  4U71 A;  3TAV A;  1C24 A;  4U6W A;  1C22 A;  4B28 A;  3FMQ A;  3RVA A;  1WKM A;  1YVM A;  3D27 A;  4U6E A;  1O0X A;  1QXY A;  4IKR A;  4U73 A;  4FO8 A;  4FLI A;  2Q96 A;  1XGO A;  2DFI A;  2GZ5 A;  2V3Y A;  2BHC A;  2B3H A;  4FO7 A;  1KQ0 A;  4ZWP A;  5CNX A;  4U69 A;  2HOW A;  1W2M A;  4FUK A;  2GG0 A;  4S00 A;  2BWS A;  3MAT A;  4QR8 A;  2BB7 A;  1KQ9 A;  1YW8 A;  5E5B A;  4IU6 A;  4U6Z A; 
#chains in the Genus database with same CATH topology
 1BOA A;  4IKS A;  1QZY A;  2BWT A;  4A6V A;  2V6C A;  3BIP A;  4U1B A;  4U75 A;  2EVO A;  1XGN A;  2Q95 A;  1QXW A;  3IU9 A;  3Q6D A;  4R60 A;  2MAT A;  1YW9 A;  2GG2 A;  4IF7 A;  3BIQ A;  1WLR A;  4S01 A;  4FKC A;  2GTX A;  2G6P A;  1XNZ A;  3S6B A;  5CE6 A;  5D6F A;  4IKT A;  2GU6 A;  2NQ6 A;  2P98 A;  1R5G A;  2EVM A;  2V3Z A;  1Y1N A;  4IPA A;  5JI6 A;  2Q93 A;  3PKC A;  4U70 A;  2OAZ A;  2BWY A;  1XGM A;  2GG5 A;  2BHD A;  2GU5 A;  3BIT A;  2BWX A;  3PKA A;  1PV9 A;  3FMR A;  2V3X A;  4IDY A;  4RZZ A;  5CLS A;  5CIK A;  1M35 A;  3IU7 A;  2IW2 A;  2GG3 A;  3PKE A;  2EVC A;  2GG8 A;  4ZWU A;  5CDE A;  1CHM A;  2GA2 A;  2ZSG A;  4MAT A;  4FLL A;  2GU7 A;  2EA4 A;  3CB6 A;  4FLJ A;  5FCH A;  1KP0 A;  2P99 A;  4U6J A;  4ZWO A;  2GG7 A;  3L7G A;  1C21 A;  2GGC A;  4U6C A;  1N51 A;  4ZNG A;  3MX6 A;  4RZY A;  1YW7 A;  1QXZ A;  3PKD A;  2Q8K A;  2GGB A;  2B3L A;  2Q92 A;  1A16 A;  1R5H A;  2GG9 A;  3CTZ A;  1C23 A;  4HXX A;  5D6E A;  3TB5 A;  1YJ3 A;  3ROR A;  2BHA A;  2OKN A;  5FCF A;  3IU8 A;  2ADU A;  1B59 A;  2BHB A;  4KM3 A;  4PV4 A;  2NQ7 A;  3FM3 A;  3L24 A;  3MR1 A;  2BN7 A;  1B6A A;  4JUQ A;  4RGZ 1;  4A6W A;  4EGE A;  2EA2 A;  4S2T P;  1WL6 A;  2BWW A;  3IG4 A;  2Q94 A;  2P9A A;  2BWU A;  4S2R P;  1W7V A;  4IKU A;  5JFR A;  5JHU A;  4U76 A;  1MAT A;  2GU4 A;  2BWV A;  1C27 A;  4OOK A;  5CDL A;  3PKB A;  1R58 A;  4Z7M A;  1BN5 A;  1XGS A;  1WL9 A;  1WY2 A;  1JAW A;  1WN1 A;  1WBQ A;  2B3K A;  4IEC A;  4FLK A;  4PNC A;  5CDV A;  3CB5 A;  2BH3 A;  4U71 A;  3TAV A;  1C24 A;  4U6W A;  1C22 A;  4B28 A;  3FMQ A;  3RVA A;  1WKM A;  1YVM A;  3D27 A;  4U6E A;  1O0X A;  1QXY A;  4IKR A;  4U73 A;  4FO8 A;  4FLI A;  2Q96 A;  1XGO A;  2DFI A;  2GZ5 A;  2V3Y A;  2BHC A;  2B3H A;  4FO7 A;  1KQ0 A;  4ZWP A;  5CNX A;  4U69 A;  2HOW A;  1W2M A;  4FUK A;  2GG0 A;  4S00 A;  2BWS A;  3MAT A;  4QR8 A;  2BB7 A;  1KQ9 A;  1YW8 A;  5E5B A;  4IU6 A;  4U6Z A; 
#chains in the Genus database with same CATH homology
 1BOA A;  4IKS A;  1QZY A;  2BWT A;  4A6V A;  2V6C A;  3BIP A;  4U1B A;  4U75 A;  2EVO A;  1XGN A;  2Q95 A;  1QXW A;  3IU9 A;  3Q6D A;  4R60 A;  2MAT A;  1YW9 A;  2GG2 A;  4IF7 A;  3BIQ A;  1WLR A;  4S01 A;  4FKC A;  2GTX A;  2G6P A;  1XNZ A;  3S6B A;  5CE6 A;  5D6F A;  4IKT A;  2GU6 A;  2NQ6 A;  2P98 A;  1R5G A;  2EVM A;  2V3Z A;  1Y1N A;  4IPA A;  5JI6 A;  2Q93 A;  3PKC A;  4U70 A;  2OAZ A;  2BWY A;  1XGM A;  2GG5 A;  2BHD A;  2GU5 A;  3BIT A;  2BWX A;  3PKA A;  1PV9 A;  3FMR A;  2V3X A;  4IDY A;  4RZZ A;  5CLS A;  5CIK A;  1M35 A;  3IU7 A;  2IW2 A;  2GG3 A;  3PKE A;  2EVC A;  2GG8 A;  4ZWU A;  5CDE A;  1CHM A;  2GA2 A;  2ZSG A;  4MAT A;  4FLL A;  2GU7 A;  2EA4 A;  3CB6 A;  4FLJ A;  5FCH A;  1KP0 A;  2P99 A;  4U6J A;  4ZWO A;  2GG7 A;  3L7G A;  1C21 A;  2GGC A;  4U6C A;  1N51 A;  4ZNG A;  3MX6 A;  4RZY A;  1YW7 A;  1QXZ A;  3PKD A;  2Q8K A;  2GGB A;  2B3L A;  2Q92 A;  1A16 A;  1R5H A;  2GG9 A;  3CTZ A;  1C23 A;  4HXX A;  5D6E A;  3TB5 A;  1YJ3 A;  3ROR A;  2BHA A;  2OKN A;  5FCF A;  3IU8 A;  2ADU A;  1B59 A;  2BHB A;  4KM3 A;  4PV4 A;  2NQ7 A;  3FM3 A;  3L24 A;  3MR1 A;  2BN7 A;  1B6A A;  4JUQ A;  4RGZ 1;  4A6W A;  4EGE A;  2EA2 A;  4S2T P;  1WL6 A;  2BWW A;  3IG4 A;  2Q94 A;  2P9A A;  2BWU A;  4S2R P;  1W7V A;  4IKU A;  5JFR A;  5JHU A;  4U76 A;  1MAT A;  2GU4 A;  2BWV A;  1C27 A;  4OOK A;  5CDL A;  3PKB A;  1R58 A;  4Z7M A;  1BN5 A;  1XGS A;  1WL9 A;  1WY2 A;  1JAW A;  1WN1 A;  1WBQ A;  2B3K A;  4IEC A;  4FLK A;  4PNC A;  5CDV A;  3CB5 A;  2BH3 A;  4U71 A;  3TAV A;  1C24 A;  4U6W A;  1C22 A;  4B28 A;  3FMQ A;  3RVA A;  1WKM A;  1YVM A;  3D27 A;  4U6E A;  1O0X A;  1QXY A;  4IKR A;  4U73 A;  4FO8 A;  4FLI A;  2Q96 A;  1XGO A;  2DFI A;  2GZ5 A;  2V3Y A;  2BHC A;  2B3H A;  4FO7 A;  1KQ0 A;  4ZWP A;  5CNX A;  4U69 A;  2HOW A;  1W2M A;  4FUK A;  2GG0 A;  4S00 A;  2BWS A;  3MAT A;  4QR8 A;  2BB7 A;  1KQ9 A;  1YW8 A;  5E5B A;  4IU6 A;  4U6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...