2GU6A

E. coli methionine aminopeptidase in complex with nlep, 1: 2, di-metalated
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
b'SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
molecule tags Hydrolase
source organism Escherichia coli
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
total genus 92
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu6A00
3IU7A 1MATA 4RZZA 5CDVA 4FUKA 2B3LA 4IKUA 1R58A 1WY2A 1XGSA 2BB7A 3CB6A 1XGOA 1W2MA 4PNCA 3IU9A 2ZSGA 5CDLA 2G6PA 4FO8A 2P99A 2GZ5A 2P9AA 4FO7A 4FKCA 1XGMA 2B3KA 1WKMA 3MATA 1A16A 2P98A 4ZWOA 5JI6A 4U6CA 1C24A 1YVMA 5D6FA 1QZYA 4U75A 1B59A 2GTXA 4ZWPA 1KQ0A 2BWTA 4U69A 1YJ3A 2BHDA 1JAWA 1R5GA 1WBQA 2HOWA 3Q6DA 1WN1A 2BHBA 1C27A 5CE6A 4A6WA 4A6VA 4S01A 2BWVA 3PKCA 3PKAA 5CIKA 4RZYA 2GU6A 1C23A 2EVOA 1PV9A 2BHAA 1R5HA 2Q93A 4KM3A 3FMRA 2BWUA 5D6EA 4OOKA 4IPAA 4U76A 2Q8KA 2EVCA 5FCHA 2DFIA 4FLKA 4U71A 2ADUA 1M35A 4S2RP 3BIQA 4U6EA 5CLSA 4IDYA 2GU5A 4EGEA 2Q96A 5FCFA 3TAVA 4S2TP 1N51A 2B3HA 2GGCA 4QR8A 5JFRA 4MATA 4IKSA 1YW9A 2GU4A 4JUQA 1XNZA 3CTZA 1C22A 3PKDA 2BHCA 2GG8A 2MATA 4U70A 2EA4A 3FMQA 4IF7A 2BWSA 2Q95A 1BOAA 2GG3A 2GG7A 2EA2A 3RVAA 2V6CA 3BITA 2BWXA 1CHMA 2IW2A 2BN7A 1QXWA 1WL6A 2GG9A 5CDEA 2GGBA 2OKNA 2GG5A 3PKBA 4S00A 3RORA 1Y1NA 1W7VA 2V3XA 2BH3A 1QXZA 3D27A 3CB5A 2BWWA 4IKRA 3BIPA 2NQ7A 4IECA 2Q92A 3IG4A 5CNXA 5JHUA 4HXXA 4ZNGA 2OAZA 1WLRA 4FLLA 4U6JA 3TB5A 4Z7MA 1KQ9A 2GG0A 4U6WA 2GA2A 2V3ZA 4PV4A 1WL9A 5E5BA 3IU8A 3MX6A 4ZWUA 4FLJA 2GG2A 1B6AA 3L7GA 4U6ZA 1YW7A 2Q94A 4U1BA 1KP0A 3S6BA 1O0XA 4IKTA 4R60A 4B28A 1C21A 4FLIA 3FM3A 2V3YA 4U73A 2EVMA 1QXYA 1YW8A 3PKEA 1BN5A 1XGNA 2BWYA 4RGZ1 2GU7A 3MR1A 2NQ6A 3L24A 4IU6A
chains in the Genus database with same CATH superfamily
3IU7A 1MATA 4RZZA 5CDVA 4FUKA 2B3LA 4IKUA 1R58A 1WY2A 1XGSA 2BB7A 3CB6A 1XGOA 1W2MA 4PNCA 3IU9A 2ZSGA 5CDLA 2G6PA 4FO8A 2P99A 2GZ5A 2P9AA 4FO7A 4FKCA 1XGMA 2B3KA 1WKMA 3MATA 1A16A 2P98A 4ZWOA 5JI6A 4U6CA 1C24A 1YVMA 5D6FA 1QZYA 4U75A 1B59A 2GTXA 4ZWPA 1KQ0A 2BWTA 4U69A 1YJ3A 2BHDA 1JAWA 1R5GA 1WBQA 2HOWA 3Q6DA 1WN1A 2BHBA 1C27A 5CE6A 4A6WA 4A6VA 4S01A 2BWVA 3PKCA 3PKAA 5CIKA 4RZYA 2GU6A 1C23A 2EVOA 1PV9A 2BHAA 1R5HA 2Q93A 4KM3A 3FMRA 2BWUA 5D6EA 4OOKA 4IPAA 4U76A 2Q8KA 2EVCA 5FCHA 2DFIA 4FLKA 4U71A 2ADUA 1M35A 4S2RP 3BIQA 4U6EA 5CLSA 4IDYA 2GU5A 4EGEA 2Q96A 5FCFA 3TAVA 4S2TP 1N51A 2B3HA 2GGCA 4QR8A 5JFRA 4MATA 4IKSA 1YW9A 2GU4A 4JUQA 1XNZA 3CTZA 1C22A 3PKDA 2BHCA 2GG8A 2MATA 4U70A 2EA4A 3FMQA 4IF7A 2BWSA 2Q95A 1BOAA 2GG3A 2GG7A 2EA2A 3RVAA 2V6CA 3BITA 2BWXA 1CHMA 2IW2A 2BN7A 1QXWA 1WL6A 2GG9A 5CDEA 2GGBA 2OKNA 2GG5A 3PKBA 4S00A 3RORA 1Y1NA 1W7VA 2V3XA 2BH3A 1QXZA 3D27A 3CB5A 2BWWA 4IKRA 3BIPA 2NQ7A 4IECA 2Q92A 3IG4A 5CNXA 5JHUA 4HXXA 4ZNGA 2OAZA 1WLRA 4FLLA 4U6JA 3TB5A 4Z7MA 1KQ9A 2GG0A 4U6WA 2GA2A 2V3ZA 4PV4A 1WL9A 5E5BA 3IU8A 3MX6A 4ZWUA 4FLJA 2GG2A 1B6AA 3L7GA 4U6ZA 1YW7A 2Q94A 4U1BA 1KP0A 3S6BA 1O0XA 4IKTA 4R60A 4B28A 1C21A 4FLIA 3FM3A 2V3YA 4U73A 2EVMA 1QXYA 1YW8A 3PKEA 1BN5A 1XGNA 2BWYA 4RGZ1 2GU7A 3MR1A 2NQ6A 3L24A 4IU6A
chains in the Genus database with same CATH topology
3IU7A 1MATA 4RZZA 5CDVA 4FUKA 2B3LA 4IKUA 1R58A 1WY2A 1XGSA 2BB7A 3CB6A 1XGOA 1W2MA 4PNCA 3IU9A 2ZSGA 5CDLA 2G6PA 4FO8A 2P99A 2GZ5A 2P9AA 4FO7A 4FKCA 1XGMA 2B3KA 1WKMA 3MATA 1A16A 2P98A 4ZWOA 5JI6A 4U6CA 1C24A 1YVMA 5D6FA 1QZYA 4U75A 1B59A 2GTXA 4ZWPA 1KQ0A 2BWTA 4U69A 1YJ3A 2BHDA 1JAWA 1R5GA 1WBQA 2HOWA 3Q6DA 1WN1A 2BHBA 1C27A 5CE6A 4A6WA 4A6VA 4S01A 2BWVA 3PKCA 3PKAA 5CIKA 4RZYA 2GU6A 1C23A 2EVOA 1PV9A 2BHAA 1R5HA 2Q93A 4KM3A 3FMRA 2BWUA 5D6EA 4OOKA 4IPAA 4U76A 2Q8KA 2EVCA 5FCHA 2DFIA 4FLKA 4U71A 2ADUA 1M35A 4S2RP 3BIQA 4U6EA 5CLSA 4IDYA 2GU5A 4EGEA 2Q96A 5FCFA 3TAVA 4S2TP 1N51A 2B3HA 2GGCA 4QR8A 5JFRA 4MATA 4IKSA 1YW9A 2GU4A 4JUQA 1XNZA 3CTZA 1C22A 3PKDA 2BHCA 2GG8A 2MATA 4U70A 2EA4A 3FMQA 4IF7A 2BWSA 2Q95A 1BOAA 2GG3A 2GG7A 2EA2A 3RVAA 2V6CA 3BITA 2BWXA 1CHMA 2IW2A 2BN7A 1QXWA 1WL6A 2GG9A 5CDEA 2GGBA 2OKNA 2GG5A 3PKBA 4S00A 3RORA 1Y1NA 1W7VA 2V3XA 2BH3A 1QXZA 3D27A 3CB5A 2BWWA 4IKRA 3BIPA 2NQ7A 4IECA 2Q92A 3IG4A 5CNXA 5JHUA 4HXXA 4ZNGA 2OAZA 1WLRA 4FLLA 4U6JA 3TB5A 4Z7MA 1KQ9A 2GG0A 4U6WA 2GA2A 2V3ZA 4PV4A 1WL9A 5E5BA 3IU8A 3MX6A 4ZWUA 4FLJA 2GG2A 1B6AA 3L7GA 4U6ZA 1YW7A 2Q94A 4U1BA 1KP0A 3S6BA 1O0XA 4IKTA 4R60A 4B28A 1C21A 4FLIA 3FM3A 2V3YA 4U73A 2EVMA 1QXYA 1YW8A 3PKEA 1BN5A 1XGNA 2BWYA 4RGZ1 2GU7A 3MR1A 2NQ6A 3L24A 4IU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU7 A;  1MAT A;  4RZZ A;  5CDV A;  4FUK A;  2B3L A;  4IKU A;  1R58 A;  1WY2 A;  1XGS A;  2BB7 A;  3CB6 A;  1XGO A;  1W2M A;  4PNC A;  3IU9 A;  2ZSG A;  5CDL A;  2G6P A;  4FO8 A;  2P99 A;  2GZ5 A;  2P9A A;  4FO7 A;  4FKC A;  1XGM A;  2B3K A;  1WKM A;  3MAT A;  1A16 A;  2P98 A;  4ZWO A;  5JI6 A;  4U6C A;  1C24 A;  1YVM A;  5D6F A;  1QZY A;  4U75 A;  1B59 A;  2GTX A;  4ZWP A;  1KQ0 A;  2BWT A;  4U69 A;  1YJ3 A;  2BHD A;  1JAW A;  1R5G A;  1WBQ A;  2HOW A;  3Q6D A;  1WN1 A;  2BHB A;  1C27 A;  5CE6 A;  4A6W A;  4A6V A;  4S01 A;  2BWV A;  3PKC A;  3PKA A;  5CIK A;  4RZY A;  2GU6 A;  1C23 A;  2EVO A;  1PV9 A;  2BHA A;  1R5H A;  2Q93 A;  4KM3 A;  3FMR A;  2BWU A;  5D6E A;  4OOK A;  4IPA A;  4U76 A;  2Q8K A;  2EVC A;  5FCH A;  2DFI A;  4FLK A;  4U71 A;  2ADU A;  1M35 A;  4S2R P;  3BIQ A;  4U6E A;  5CLS A;  4IDY A;  2GU5 A;  4EGE A;  2Q96 A;  5FCF A;  3TAV A;  4S2T P;  1N51 A;  2B3H A;  2GGC A;  4QR8 A;  5JFR A;  4MAT A;  4IKS A;  1YW9 A;  2GU4 A;  4JUQ A;  1XNZ A;  3CTZ A;  1C22 A;  3PKD A;  2BHC A;  2GG8 A;  2MAT A;  4U70 A;  2EA4 A;  3FMQ A;  4IF7 A;  2BWS A;  2Q95 A;  1BOA A;  2GG3 A;  2GG7 A;  2EA2 A;  3RVA A;  2V6C A;  3BIT A;  2BWX A;  1CHM A;  2IW2 A;  2BN7 A;  1QXW A;  1WL6 A;  2GG9 A;  5CDE A;  2GGB A;  2OKN A;  2GG5 A;  3PKB A;  4S00 A;  3ROR A;  1Y1N A;  1W7V A;  2V3X A;  2BH3 A;  1QXZ A;  3D27 A;  3CB5 A;  2BWW A;  4IKR A;  3BIP A;  2NQ7 A;  4IEC A;  2Q92 A;  3IG4 A;  5CNX A;  5JHU A;  4HXX A;  4ZNG A;  2OAZ A;  1WLR A;  4FLL A;  4U6J A;  3TB5 A;  4Z7M A;  1KQ9 A;  2GG0 A;  4U6W A;  2GA2 A;  2V3Z A;  4PV4 A;  1WL9 A;  5E5B A;  3IU8 A;  3MX6 A;  4ZWU A;  4FLJ A;  2GG2 A;  1B6A A;  3L7G A;  4U6Z A;  1YW7 A;  2Q94 A;  4U1B A;  1KP0 A;  3S6B A;  1O0X A;  4IKT A;  4R60 A;  4B28 A;  1C21 A;  4FLI A;  3FM3 A;  2V3Y A;  4U73 A;  2EVM A;  1QXY A;  1YW8 A;  3PKE A;  1BN5 A;  1XGN A;  2BWY A;  4RGZ 1;  2GU7 A;  3MR1 A;  2NQ6 A;  3L24 A;  4IU6 A; 
#chains in the Genus database with same CATH topology
 3IU7 A;  1MAT A;  4RZZ A;  5CDV A;  4FUK A;  2B3L A;  4IKU A;  1R58 A;  1WY2 A;  1XGS A;  2BB7 A;  3CB6 A;  1XGO A;  1W2M A;  4PNC A;  3IU9 A;  2ZSG A;  5CDL A;  2G6P A;  4FO8 A;  2P99 A;  2GZ5 A;  2P9A A;  4FO7 A;  4FKC A;  1XGM A;  2B3K A;  1WKM A;  3MAT A;  1A16 A;  2P98 A;  4ZWO A;  5JI6 A;  4U6C A;  1C24 A;  1YVM A;  5D6F A;  1QZY A;  4U75 A;  1B59 A;  2GTX A;  4ZWP A;  1KQ0 A;  2BWT A;  4U69 A;  1YJ3 A;  2BHD A;  1JAW A;  1R5G A;  1WBQ A;  2HOW A;  3Q6D A;  1WN1 A;  2BHB A;  1C27 A;  5CE6 A;  4A6W A;  4A6V A;  4S01 A;  2BWV A;  3PKC A;  3PKA A;  5CIK A;  4RZY A;  2GU6 A;  1C23 A;  2EVO A;  1PV9 A;  2BHA A;  1R5H A;  2Q93 A;  4KM3 A;  3FMR A;  2BWU A;  5D6E A;  4OOK A;  4IPA A;  4U76 A;  2Q8K A;  2EVC A;  5FCH A;  2DFI A;  4FLK A;  4U71 A;  2ADU A;  1M35 A;  4S2R P;  3BIQ A;  4U6E A;  5CLS A;  4IDY A;  2GU5 A;  4EGE A;  2Q96 A;  5FCF A;  3TAV A;  4S2T P;  1N51 A;  2B3H A;  2GGC A;  4QR8 A;  5JFR A;  4MAT A;  4IKS A;  1YW9 A;  2GU4 A;  4JUQ A;  1XNZ A;  3CTZ A;  1C22 A;  3PKD A;  2BHC A;  2GG8 A;  2MAT A;  4U70 A;  2EA4 A;  3FMQ A;  4IF7 A;  2BWS A;  2Q95 A;  1BOA A;  2GG3 A;  2GG7 A;  2EA2 A;  3RVA A;  2V6C A;  3BIT A;  2BWX A;  1CHM A;  2IW2 A;  2BN7 A;  1QXW A;  1WL6 A;  2GG9 A;  5CDE A;  2GGB A;  2OKN A;  2GG5 A;  3PKB A;  4S00 A;  3ROR A;  1Y1N A;  1W7V A;  2V3X A;  2BH3 A;  1QXZ A;  3D27 A;  3CB5 A;  2BWW A;  4IKR A;  3BIP A;  2NQ7 A;  4IEC A;  2Q92 A;  3IG4 A;  5CNX A;  5JHU A;  4HXX A;  4ZNG A;  2OAZ A;  1WLR A;  4FLL A;  4U6J A;  3TB5 A;  4Z7M A;  1KQ9 A;  2GG0 A;  4U6W A;  2GA2 A;  2V3Z A;  4PV4 A;  1WL9 A;  5E5B A;  3IU8 A;  3MX6 A;  4ZWU A;  4FLJ A;  2GG2 A;  1B6A A;  3L7G A;  4U6Z A;  1YW7 A;  2Q94 A;  4U1B A;  1KP0 A;  3S6B A;  1O0X A;  4IKT A;  4R60 A;  4B28 A;  1C21 A;  4FLI A;  3FM3 A;  2V3Y A;  4U73 A;  2EVM A;  1QXY A;  1YW8 A;  3PKE A;  1BN5 A;  1XGN A;  2BWY A;  4RGZ 1;  2GU7 A;  3MR1 A;  2NQ6 A;  3L24 A;  4IU6 A; 
#chains in the Genus database with same CATH homology
 3IU7 A;  1MAT A;  4RZZ A;  5CDV A;  4FUK A;  2B3L A;  4IKU A;  1R58 A;  1WY2 A;  1XGS A;  2BB7 A;  3CB6 A;  1XGO A;  1W2M A;  4PNC A;  3IU9 A;  2ZSG A;  5CDL A;  2G6P A;  4FO8 A;  2P99 A;  2GZ5 A;  2P9A A;  4FO7 A;  4FKC A;  1XGM A;  2B3K A;  1WKM A;  3MAT A;  1A16 A;  2P98 A;  4ZWO A;  5JI6 A;  4U6C A;  1C24 A;  1YVM A;  5D6F A;  1QZY A;  4U75 A;  1B59 A;  2GTX A;  4ZWP A;  1KQ0 A;  2BWT A;  4U69 A;  1YJ3 A;  2BHD A;  1JAW A;  1R5G A;  1WBQ A;  2HOW A;  3Q6D A;  1WN1 A;  2BHB A;  1C27 A;  5CE6 A;  4A6W A;  4A6V A;  4S01 A;  2BWV A;  3PKC A;  3PKA A;  5CIK A;  4RZY A;  2GU6 A;  1C23 A;  2EVO A;  1PV9 A;  2BHA A;  1R5H A;  2Q93 A;  4KM3 A;  3FMR A;  2BWU A;  5D6E A;  4OOK A;  4IPA A;  4U76 A;  2Q8K A;  2EVC A;  5FCH A;  2DFI A;  4FLK A;  4U71 A;  2ADU A;  1M35 A;  4S2R P;  3BIQ A;  4U6E A;  5CLS A;  4IDY A;  2GU5 A;  4EGE A;  2Q96 A;  5FCF A;  3TAV A;  4S2T P;  1N51 A;  2B3H A;  2GGC A;  4QR8 A;  5JFR A;  4MAT A;  4IKS A;  1YW9 A;  2GU4 A;  4JUQ A;  1XNZ A;  3CTZ A;  1C22 A;  3PKD A;  2BHC A;  2GG8 A;  2MAT A;  4U70 A;  2EA4 A;  3FMQ A;  4IF7 A;  2BWS A;  2Q95 A;  1BOA A;  2GG3 A;  2GG7 A;  2EA2 A;  3RVA A;  2V6C A;  3BIT A;  2BWX A;  1CHM A;  2IW2 A;  2BN7 A;  1QXW A;  1WL6 A;  2GG9 A;  5CDE A;  2GGB A;  2OKN A;  2GG5 A;  3PKB A;  4S00 A;  3ROR A;  1Y1N A;  1W7V A;  2V3X A;  2BH3 A;  1QXZ A;  3D27 A;  3CB5 A;  2BWW A;  4IKR A;  3BIP A;  2NQ7 A;  4IEC A;  2Q92 A;  3IG4 A;  5CNX A;  5JHU A;  4HXX A;  4ZNG A;  2OAZ A;  1WLR A;  4FLL A;  4U6J A;  3TB5 A;  4Z7M A;  1KQ9 A;  2GG0 A;  4U6W A;  2GA2 A;  2V3Z A;  4PV4 A;  1WL9 A;  5E5B A;  3IU8 A;  3MX6 A;  4ZWU A;  4FLJ A;  2GG2 A;  1B6A A;  3L7G A;  4U6Z A;  1YW7 A;  2Q94 A;  4U1B A;  1KP0 A;  3S6B A;  1O0X A;  4IKT A;  4R60 A;  4B28 A;  1C21 A;  4FLI A;  3FM3 A;  2V3Y A;  4U73 A;  2EVM A;  1QXY A;  1YW8 A;  3PKE A;  1BN5 A;  1XGN A;  2BWY A;  4RGZ 1;  2GU7 A;  3MR1 A;  2NQ6 A;  3L24 A;  4IU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...