2GU6A

E. coli methionine aminopeptidase in complex with nlep, 1: 2, di-metalated
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
b'SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu6A00
2HOWA 2OAZA 4IKTA 3RVAA 4RGZ1 3IU9A 2BWXA 2EA4A 4OOKA 2OKNA 3CB6A 4HXXA 2V3YA 1W7VA 5FCHA 1KQ9A 3BIQA 2IW2A 2GZ5A 4U75A 2GU7A 4MATA 3FMRA 1JAWA 3MATA 4FLKA 4EGEA 3RORA 1YJ3A 2Q94A 1CHMA 2BHDA 2BWTA 3D27A 2NQ7A 4U6JA 2BH3A 2GGBA 3BIPA 4FLJA 2GU6A 1C27A 2NQ6A 2GG5A 1Y1NA 4U76A 2BWVA 1YW8A 2EVCA 2EVMA 3CTZA 1PV9A 3FMQA 3PKCA 1WL6A 4IDYA 1WKMA 4U6EA 4JUQA 2MATA 4S00A 1BN5A 4ZWUA 1YW9A 2BWWA 1QXZA 2GG2A 4U6CA 2Q93A 3CB5A 3PKAA 5CDEA 2V3XA 4ZWOA 3S6BA 4FLLA 3BITA 2BWSA 1WN1A 4FKCA 2BWYA 2BWUA 4R60A 2B3LA 2ADUA 2P98A 2G6PA 2GGCA 4FO8A 5CE6A 4IF7A 2BN7A 1WBQA 2BB7A 1B59A 1W2MA 2GU4A 3L24A 4IKSA 4S2RP 5JI6A 4ZNGA 4A6WA 2GG7A 3IG4A 2P99A 4S2TP 2GG9A 1B6AA 5D6EA 1MATA 1XNZA 2Q95A 1O0XA 3PKBA 1N51A 4U71A 3TB5A 1C21A 2P9AA 2B3HA 5JHUA 1WLRA 1M35A 3IU7A 2V3ZA 2DFIA 4IECA 3L7GA 1WL9A 1YVMA 2Q8KA 1XGNA 1C23A 5CNXA 1QXYA 4U73A 3FM3A 4RZZA 2B3KA 4KM3A 1C24A 2BHBA 1R5GA 1R58A 3Q6DA 4U69A 1KQ0A 1QXWA 5E5BA 1QZYA 1BOAA 5JFRA 2GG0A 3IU8A 4B28A 5CLSA 3PKEA 4RZYA 1XGSA 4IU6A 1C22A 2EVOA 4FUKA 4FLIA 4IKRA 4ZWPA 3PKDA 1KP0A 5CIKA 4U70A 1R5HA 2V6CA 2BHAA 2Q96A 5CDVA 4QR8A 2GA2A 4IKUA 4IPAA 5FCFA 5CDLA 1XGMA 2GG3A 2GTXA 4A6VA 3TAVA 4Z7MA 1YW7A 3MR1A 4PNCA 4FO7A 1A16A 4S01A 2ZSGA 2EA2A 2GG8A 3MX6A 2Q92A 4PV4A 1XGOA 4U1BA 2GU5A 4U6WA 5D6FA 2BHCA 4U6ZA 1WY2A
chains in the Genus database with same CATH superfamily
2HOWA 2OAZA 4IKTA 3RVAA 4RGZ1 3IU9A 2BWXA 2EA4A 4OOKA 2OKNA 3CB6A 4HXXA 2V3YA 1W7VA 5FCHA 1KQ9A 3BIQA 2IW2A 2GZ5A 4U75A 2GU7A 4MATA 3FMRA 1JAWA 3MATA 4FLKA 4EGEA 3RORA 1YJ3A 2Q94A 1CHMA 2BHDA 2BWTA 3D27A 2NQ7A 4U6JA 2BH3A 2GGBA 3BIPA 4FLJA 2GU6A 1C27A 2NQ6A 2GG5A 1Y1NA 4U76A 2BWVA 1YW8A 2EVCA 2EVMA 3CTZA 1PV9A 3FMQA 3PKCA 1WL6A 4IDYA 1WKMA 4U6EA 4JUQA 2MATA 4S00A 1BN5A 4ZWUA 1YW9A 2BWWA 1QXZA 2GG2A 4U6CA 2Q93A 3CB5A 3PKAA 5CDEA 2V3XA 4ZWOA 3S6BA 4FLLA 3BITA 2BWSA 1WN1A 4FKCA 2BWYA 2BWUA 4R60A 2B3LA 2ADUA 2P98A 2G6PA 2GGCA 4FO8A 5CE6A 4IF7A 2BN7A 1WBQA 2BB7A 1B59A 1W2MA 2GU4A 3L24A 4IKSA 4S2RP 5JI6A 4ZNGA 4A6WA 2GG7A 3IG4A 2P99A 4S2TP 2GG9A 1B6AA 5D6EA 1MATA 1XNZA 2Q95A 1O0XA 3PKBA 1N51A 4U71A 3TB5A 1C21A 2P9AA 2B3HA 5JHUA 1WLRA 1M35A 3IU7A 2V3ZA 2DFIA 4IECA 3L7GA 1WL9A 1YVMA 2Q8KA 1XGNA 1C23A 5CNXA 1QXYA 4U73A 3FM3A 4RZZA 2B3KA 4KM3A 1C24A 2BHBA 1R5GA 1R58A 3Q6DA 4U69A 1KQ0A 1QXWA 5E5BA 1QZYA 1BOAA 5JFRA 2GG0A 3IU8A 4B28A 5CLSA 3PKEA 4RZYA 1XGSA 4IU6A 1C22A 2EVOA 4FUKA 4FLIA 4IKRA 4ZWPA 3PKDA 1KP0A 5CIKA 4U70A 1R5HA 2V6CA 2BHAA 2Q96A 5CDVA 4QR8A 2GA2A 4IKUA 4IPAA 5FCFA 5CDLA 1XGMA 2GG3A 2GTXA 4A6VA 3TAVA 4Z7MA 1YW7A 3MR1A 4PNCA 4FO7A 1A16A 4S01A 2ZSGA 2EA2A 2GG8A 3MX6A 2Q92A 4PV4A 1XGOA 4U1BA 2GU5A 4U6WA 5D6FA 2BHCA 4U6ZA 1WY2A
chains in the Genus database with same CATH topology
2HOWA 2OAZA 4IKTA 3RVAA 4RGZ1 3IU9A 2BWXA 2EA4A 4OOKA 2OKNA 3CB6A 4HXXA 2V3YA 1W7VA 5FCHA 1KQ9A 3BIQA 2IW2A 2GZ5A 4U75A 2GU7A 4MATA 3FMRA 1JAWA 3MATA 4FLKA 4EGEA 3RORA 1YJ3A 2Q94A 1CHMA 2BHDA 2BWTA 3D27A 2NQ7A 4U6JA 2BH3A 2GGBA 3BIPA 4FLJA 2GU6A 1C27A 2NQ6A 2GG5A 1Y1NA 4U76A 2BWVA 1YW8A 2EVCA 2EVMA 3CTZA 1PV9A 3FMQA 3PKCA 1WL6A 4IDYA 1WKMA 4U6EA 4JUQA 2MATA 4S00A 1BN5A 4ZWUA 1YW9A 2BWWA 1QXZA 2GG2A 4U6CA 2Q93A 3CB5A 3PKAA 5CDEA 2V3XA 4ZWOA 3S6BA 4FLLA 3BITA 2BWSA 1WN1A 4FKCA 2BWYA 2BWUA 4R60A 2B3LA 2ADUA 2P98A 2G6PA 2GGCA 4FO8A 5CE6A 4IF7A 2BN7A 1WBQA 2BB7A 1B59A 1W2MA 2GU4A 3L24A 4IKSA 4S2RP 5JI6A 4ZNGA 4A6WA 2GG7A 3IG4A 2P99A 4S2TP 2GG9A 1B6AA 5D6EA 1MATA 1XNZA 2Q95A 1O0XA 3PKBA 1N51A 4U71A 3TB5A 1C21A 2P9AA 2B3HA 5JHUA 1WLRA 1M35A 3IU7A 2V3ZA 2DFIA 4IECA 3L7GA 1WL9A 1YVMA 2Q8KA 1XGNA 1C23A 5CNXA 1QXYA 4U73A 3FM3A 4RZZA 2B3KA 4KM3A 1C24A 2BHBA 1R5GA 1R58A 3Q6DA 4U69A 1KQ0A 1QXWA 5E5BA 1QZYA 1BOAA 5JFRA 2GG0A 3IU8A 4B28A 5CLSA 3PKEA 4RZYA 1XGSA 4IU6A 1C22A 2EVOA 4FUKA 4FLIA 4IKRA 4ZWPA 3PKDA 1KP0A 5CIKA 4U70A 1R5HA 2V6CA 2BHAA 2Q96A 5CDVA 4QR8A 2GA2A 4IKUA 4IPAA 5FCFA 5CDLA 1XGMA 2GG3A 2GTXA 4A6VA 3TAVA 4Z7MA 1YW7A 3MR1A 4PNCA 4FO7A 1A16A 4S01A 2ZSGA 2EA2A 2GG8A 3MX6A 2Q92A 4PV4A 1XGOA 4U1BA 2GU5A 4U6WA 5D6FA 2BHCA 4U6ZA 1WY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOW A;  2OAZ A;  4IKT A;  3RVA A;  4RGZ 1;  3IU9 A;  2BWX A;  2EA4 A;  4OOK A;  2OKN A;  3CB6 A;  4HXX A;  2V3Y A;  1W7V A;  5FCH A;  1KQ9 A;  3BIQ A;  2IW2 A;  2GZ5 A;  4U75 A;  2GU7 A;  4MAT A;  3FMR A;  1JAW A;  3MAT A;  4FLK A;  4EGE A;  3ROR A;  1YJ3 A;  2Q94 A;  1CHM A;  2BHD A;  2BWT A;  3D27 A;  2NQ7 A;  4U6J A;  2BH3 A;  2GGB A;  3BIP A;  4FLJ A;  2GU6 A;  1C27 A;  2NQ6 A;  2GG5 A;  1Y1N A;  4U76 A;  2BWV A;  1YW8 A;  2EVC A;  2EVM A;  3CTZ A;  1PV9 A;  3FMQ A;  3PKC A;  1WL6 A;  4IDY A;  1WKM A;  4U6E A;  4JUQ A;  2MAT A;  4S00 A;  1BN5 A;  4ZWU A;  1YW9 A;  2BWW A;  1QXZ A;  2GG2 A;  4U6C A;  2Q93 A;  3CB5 A;  3PKA A;  5CDE A;  2V3X A;  4ZWO A;  3S6B A;  4FLL A;  3BIT A;  2BWS A;  1WN1 A;  4FKC A;  2BWY A;  2BWU A;  4R60 A;  2B3L A;  2ADU A;  2P98 A;  2G6P A;  2GGC A;  4FO8 A;  5CE6 A;  4IF7 A;  2BN7 A;  1WBQ A;  2BB7 A;  1B59 A;  1W2M A;  2GU4 A;  3L24 A;  4IKS A;  4S2R P;  5JI6 A;  4ZNG A;  4A6W A;  2GG7 A;  3IG4 A;  2P99 A;  4S2T P;  2GG9 A;  1B6A A;  5D6E A;  1MAT A;  1XNZ A;  2Q95 A;  1O0X A;  3PKB A;  1N51 A;  4U71 A;  3TB5 A;  1C21 A;  2P9A A;  2B3H A;  5JHU A;  1WLR A;  1M35 A;  3IU7 A;  2V3Z A;  2DFI A;  4IEC A;  3L7G A;  1WL9 A;  1YVM A;  2Q8K A;  1XGN A;  1C23 A;  5CNX A;  1QXY A;  4U73 A;  3FM3 A;  4RZZ A;  2B3K A;  4KM3 A;  1C24 A;  2BHB A;  1R5G A;  1R58 A;  3Q6D A;  4U69 A;  1KQ0 A;  1QXW A;  5E5B A;  1QZY A;  1BOA A;  5JFR A;  2GG0 A;  3IU8 A;  4B28 A;  5CLS A;  3PKE A;  4RZY A;  1XGS A;  4IU6 A;  1C22 A;  2EVO A;  4FUK A;  4FLI A;  4IKR A;  4ZWP A;  3PKD A;  1KP0 A;  5CIK A;  4U70 A;  1R5H A;  2V6C A;  2BHA A;  2Q96 A;  5CDV A;  4QR8 A;  2GA2 A;  4IKU A;  4IPA A;  5FCF A;  5CDL A;  1XGM A;  2GG3 A;  2GTX A;  4A6V A;  3TAV A;  4Z7M A;  1YW7 A;  3MR1 A;  4PNC A;  4FO7 A;  1A16 A;  4S01 A;  2ZSG A;  2EA2 A;  2GG8 A;  3MX6 A;  2Q92 A;  4PV4 A;  1XGO A;  4U1B A;  2GU5 A;  4U6W A;  5D6F A;  2BHC A;  4U6Z A;  1WY2 A; 
#chains in the Genus database with same CATH topology
 2HOW A;  2OAZ A;  4IKT A;  3RVA A;  4RGZ 1;  3IU9 A;  2BWX A;  2EA4 A;  4OOK A;  2OKN A;  3CB6 A;  4HXX A;  2V3Y A;  1W7V A;  5FCH A;  1KQ9 A;  3BIQ A;  2IW2 A;  2GZ5 A;  4U75 A;  2GU7 A;  4MAT A;  3FMR A;  1JAW A;  3MAT A;  4FLK A;  4EGE A;  3ROR A;  1YJ3 A;  2Q94 A;  1CHM A;  2BHD A;  2BWT A;  3D27 A;  2NQ7 A;  4U6J A;  2BH3 A;  2GGB A;  3BIP A;  4FLJ A;  2GU6 A;  1C27 A;  2NQ6 A;  2GG5 A;  1Y1N A;  4U76 A;  2BWV A;  1YW8 A;  2EVC A;  2EVM A;  3CTZ A;  1PV9 A;  3FMQ A;  3PKC A;  1WL6 A;  4IDY A;  1WKM A;  4U6E A;  4JUQ A;  2MAT A;  4S00 A;  1BN5 A;  4ZWU A;  1YW9 A;  2BWW A;  1QXZ A;  2GG2 A;  4U6C A;  2Q93 A;  3CB5 A;  3PKA A;  5CDE A;  2V3X A;  4ZWO A;  3S6B A;  4FLL A;  3BIT A;  2BWS A;  1WN1 A;  4FKC A;  2BWY A;  2BWU A;  4R60 A;  2B3L A;  2ADU A;  2P98 A;  2G6P A;  2GGC A;  4FO8 A;  5CE6 A;  4IF7 A;  2BN7 A;  1WBQ A;  2BB7 A;  1B59 A;  1W2M A;  2GU4 A;  3L24 A;  4IKS A;  4S2R P;  5JI6 A;  4ZNG A;  4A6W A;  2GG7 A;  3IG4 A;  2P99 A;  4S2T P;  2GG9 A;  1B6A A;  5D6E A;  1MAT A;  1XNZ A;  2Q95 A;  1O0X A;  3PKB A;  1N51 A;  4U71 A;  3TB5 A;  1C21 A;  2P9A A;  2B3H A;  5JHU A;  1WLR A;  1M35 A;  3IU7 A;  2V3Z A;  2DFI A;  4IEC A;  3L7G A;  1WL9 A;  1YVM A;  2Q8K A;  1XGN A;  1C23 A;  5CNX A;  1QXY A;  4U73 A;  3FM3 A;  4RZZ A;  2B3K A;  4KM3 A;  1C24 A;  2BHB A;  1R5G A;  1R58 A;  3Q6D A;  4U69 A;  1KQ0 A;  1QXW A;  5E5B A;  1QZY A;  1BOA A;  5JFR A;  2GG0 A;  3IU8 A;  4B28 A;  5CLS A;  3PKE A;  4RZY A;  1XGS A;  4IU6 A;  1C22 A;  2EVO A;  4FUK A;  4FLI A;  4IKR A;  4ZWP A;  3PKD A;  1KP0 A;  5CIK A;  4U70 A;  1R5H A;  2V6C A;  2BHA A;  2Q96 A;  5CDV A;  4QR8 A;  2GA2 A;  4IKU A;  4IPA A;  5FCF A;  5CDL A;  1XGM A;  2GG3 A;  2GTX A;  4A6V A;  3TAV A;  4Z7M A;  1YW7 A;  3MR1 A;  4PNC A;  4FO7 A;  1A16 A;  4S01 A;  2ZSG A;  2EA2 A;  2GG8 A;  3MX6 A;  2Q92 A;  4PV4 A;  1XGO A;  4U1B A;  2GU5 A;  4U6W A;  5D6F A;  2BHC A;  4U6Z A;  1WY2 A; 
#chains in the Genus database with same CATH homology
 2HOW A;  2OAZ A;  4IKT A;  3RVA A;  4RGZ 1;  3IU9 A;  2BWX A;  2EA4 A;  4OOK A;  2OKN A;  3CB6 A;  4HXX A;  2V3Y A;  1W7V A;  5FCH A;  1KQ9 A;  3BIQ A;  2IW2 A;  2GZ5 A;  4U75 A;  2GU7 A;  4MAT A;  3FMR A;  1JAW A;  3MAT A;  4FLK A;  4EGE A;  3ROR A;  1YJ3 A;  2Q94 A;  1CHM A;  2BHD A;  2BWT A;  3D27 A;  2NQ7 A;  4U6J A;  2BH3 A;  2GGB A;  3BIP A;  4FLJ A;  2GU6 A;  1C27 A;  2NQ6 A;  2GG5 A;  1Y1N A;  4U76 A;  2BWV A;  1YW8 A;  2EVC A;  2EVM A;  3CTZ A;  1PV9 A;  3FMQ A;  3PKC A;  1WL6 A;  4IDY A;  1WKM A;  4U6E A;  4JUQ A;  2MAT A;  4S00 A;  1BN5 A;  4ZWU A;  1YW9 A;  2BWW A;  1QXZ A;  2GG2 A;  4U6C A;  2Q93 A;  3CB5 A;  3PKA A;  5CDE A;  2V3X A;  4ZWO A;  3S6B A;  4FLL A;  3BIT A;  2BWS A;  1WN1 A;  4FKC A;  2BWY A;  2BWU A;  4R60 A;  2B3L A;  2ADU A;  2P98 A;  2G6P A;  2GGC A;  4FO8 A;  5CE6 A;  4IF7 A;  2BN7 A;  1WBQ A;  2BB7 A;  1B59 A;  1W2M A;  2GU4 A;  3L24 A;  4IKS A;  4S2R P;  5JI6 A;  4ZNG A;  4A6W A;  2GG7 A;  3IG4 A;  2P99 A;  4S2T P;  2GG9 A;  1B6A A;  5D6E A;  1MAT A;  1XNZ A;  2Q95 A;  1O0X A;  3PKB A;  1N51 A;  4U71 A;  3TB5 A;  1C21 A;  2P9A A;  2B3H A;  5JHU A;  1WLR A;  1M35 A;  3IU7 A;  2V3Z A;  2DFI A;  4IEC A;  3L7G A;  1WL9 A;  1YVM A;  2Q8K A;  1XGN A;  1C23 A;  5CNX A;  1QXY A;  4U73 A;  3FM3 A;  4RZZ A;  2B3K A;  4KM3 A;  1C24 A;  2BHB A;  1R5G A;  1R58 A;  3Q6D A;  4U69 A;  1KQ0 A;  1QXW A;  5E5B A;  1QZY A;  1BOA A;  5JFR A;  2GG0 A;  3IU8 A;  4B28 A;  5CLS A;  3PKE A;  4RZY A;  1XGS A;  4IU6 A;  1C22 A;  2EVO A;  4FUK A;  4FLI A;  4IKR A;  4ZWP A;  3PKD A;  1KP0 A;  5CIK A;  4U70 A;  1R5H A;  2V6C A;  2BHA A;  2Q96 A;  5CDV A;  4QR8 A;  2GA2 A;  4IKU A;  4IPA A;  5FCF A;  5CDL A;  1XGM A;  2GG3 A;  2GTX A;  4A6V A;  3TAV A;  4Z7M A;  1YW7 A;  3MR1 A;  4PNC A;  4FO7 A;  1A16 A;  4S01 A;  2ZSG A;  2EA2 A;  2GG8 A;  3MX6 A;  2Q92 A;  4PV4 A;  1XGO A;  4U1B A;  2GU5 A;  4U6W A;  5D6F A;  2BHC A;  4U6Z A;  1WY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...