2GU6A

E. coli methionine aminopeptidase in complex with nlep, 1: 2, di-metalated
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu6A00
1PV9A 2GGCA 4U6EA 1A16A 4RZZA 1WKMA 2BHDA 1W7VA 4FLLA 5JFRA 2Q95A 2GG3A 1Y1NA 2BWVA 2GU4A 5CLSA 5D6EA 4MATA 1B6AA 1QXWA 3FMQA 4U69A 1WBQA 1KQ0A 1QXYA 4FKCA 4ZWUA 3PKBA 3CB5A 1WLRA 3RORA 1WY2A 2BWSA 3BIQA 2GZ5A 2Q94A 4IKUA 4QR8A 2GG5A 4IPAA 5CIKA 1C24A 2NQ7A 4S2TP 4ZWPA 1XGOA 2BHCA 2OKNA 3PKDA 1YJ3A 5CDVA 2EVMA 4IKSA 2GG9A 3L24A 3PKCA 2GU5A 4EGEA 1C23A 1QXZA 1XGSA 2GU7A 1N51A 1WL6A 4JUQA 2V3YA 3S6BA 3IG4A 4U1BA 2HOWA 2V3XA 4A6VA 4FLKA 3PKAA 1QZYA 2P98A 1BN5A 1R5HA 4PNCA 2BB7A 3BITA 4S00A 2G6PA 3FMRA 4U73A 1CHMA 4IKRA 1XGNA 2BWWA 5JHUA 1O0XA 2BWYA 2Q93A 1JAWA 2BWTA 2BHBA 4S2RP 4ZNGA 2MATA 4U76A 4U6JA 3MR1A 2B3HA 5CNXA 3IU8A 4IU6A 2IW2A 2BH3A 5D6FA 1BOAA 4IF7A 1XNZA 1WN1A 5CE6A 4OOKA 2BWXA 1WL9A 3IU7A 1M35A 5E5BA 3Q6DA 5CDLA 2Q8KA 4FLJA 2DFIA 4B28A 4U71A 2GGBA 3D27A 2Q92A 4R60A 2NQ6A 3RVAA 1KP0A 2EVCA 5CDEA 1C22A 3BIPA 4FLIA 2GTXA 4U6WA 2GG2A 2P9AA 1B59A 2GG7A 3MATA 1YVMA 4RGZ1 3MX6A 1YW9A 1XGMA 3TB5A 4FO7A 4HXXA 3PKEA 1MATA 4ZWOA 4Z7MA 1YW8A 1YW7A 2EA4A 4U70A 2BWUA 2GG0A 2GA2A 2V6CA 2P99A 3CTZA 2BN7A 5FCHA 4IECA 2EVOA 3FM3A 4FUKA 2ZSGA 4U6CA 4U75A 4U6ZA 4A6WA 4PV4A 5FCFA 4S01A 2OAZA 1C27A 4RZYA 2Q96A 2BHAA 5JI6A 3L7GA 3TAVA 4FO8A 1W2MA 3CB6A 2V3ZA 1C21A 4KM3A 3IU9A 2ADUA 1R5GA 4IDYA 1R58A 2EA2A 4IKTA 2B3LA 1KQ9A 2B3KA 2GG8A 2GU6A
chains in the Genus database with same CATH superfamily
1PV9A 2GGCA 4U6EA 1A16A 4RZZA 1WKMA 2BHDA 1W7VA 4FLLA 5JFRA 2Q95A 2GG3A 1Y1NA 2BWVA 2GU4A 5CLSA 5D6EA 4MATA 1B6AA 1QXWA 3FMQA 4U69A 1WBQA 1KQ0A 1QXYA 4FKCA 4ZWUA 3PKBA 3CB5A 1WLRA 3RORA 1WY2A 2BWSA 3BIQA 2GZ5A 2Q94A 4IKUA 4QR8A 2GG5A 4IPAA 5CIKA 1C24A 2NQ7A 4S2TP 4ZWPA 1XGOA 2BHCA 2OKNA 3PKDA 1YJ3A 5CDVA 2EVMA 4IKSA 2GG9A 3L24A 3PKCA 2GU5A 4EGEA 1C23A 1QXZA 1XGSA 2GU7A 1N51A 1WL6A 4JUQA 2V3YA 3S6BA 3IG4A 4U1BA 2HOWA 2V3XA 4A6VA 4FLKA 3PKAA 1QZYA 2P98A 1BN5A 1R5HA 4PNCA 2BB7A 3BITA 4S00A 2G6PA 3FMRA 4U73A 1CHMA 4IKRA 1XGNA 2BWWA 5JHUA 1O0XA 2BWYA 2Q93A 1JAWA 2BWTA 2BHBA 4S2RP 4ZNGA 2MATA 4U76A 4U6JA 3MR1A 2B3HA 5CNXA 3IU8A 4IU6A 2IW2A 2BH3A 5D6FA 1BOAA 4IF7A 1XNZA 1WN1A 5CE6A 4OOKA 2BWXA 1WL9A 3IU7A 1M35A 5E5BA 3Q6DA 5CDLA 2Q8KA 4FLJA 2DFIA 4B28A 4U71A 2GGBA 3D27A 2Q92A 4R60A 2NQ6A 3RVAA 1KP0A 2EVCA 5CDEA 1C22A 3BIPA 4FLIA 2GTXA 4U6WA 2GG2A 2P9AA 1B59A 2GG7A 3MATA 1YVMA 4RGZ1 3MX6A 1YW9A 1XGMA 3TB5A 4FO7A 4HXXA 3PKEA 1MATA 4ZWOA 4Z7MA 1YW8A 1YW7A 2EA4A 4U70A 2BWUA 2GG0A 2GA2A 2V6CA 2P99A 3CTZA 2BN7A 5FCHA 4IECA 2EVOA 3FM3A 4FUKA 2ZSGA 4U6CA 4U75A 4U6ZA 4A6WA 4PV4A 5FCFA 4S01A 2OAZA 1C27A 4RZYA 2Q96A 2BHAA 5JI6A 3L7GA 3TAVA 4FO8A 1W2MA 3CB6A 2V3ZA 1C21A 4KM3A 3IU9A 2ADUA 1R5GA 4IDYA 1R58A 2EA2A 4IKTA 2B3LA 1KQ9A 2B3KA 2GG8A 2GU6A
chains in the Genus database with same CATH topology
1PV9A 2GGCA 4U6EA 1A16A 4RZZA 1WKMA 2BHDA 1W7VA 4FLLA 5JFRA 2Q95A 2GG3A 1Y1NA 2BWVA 2GU4A 5CLSA 5D6EA 4MATA 1B6AA 1QXWA 3FMQA 4U69A 1WBQA 1KQ0A 1QXYA 4FKCA 4ZWUA 3PKBA 3CB5A 1WLRA 3RORA 1WY2A 2BWSA 3BIQA 2GZ5A 2Q94A 4IKUA 4QR8A 2GG5A 4IPAA 5CIKA 1C24A 2NQ7A 4S2TP 4ZWPA 1XGOA 2BHCA 2OKNA 3PKDA 1YJ3A 5CDVA 2EVMA 4IKSA 2GG9A 3L24A 3PKCA 2GU5A 4EGEA 1C23A 1QXZA 1XGSA 2GU7A 1N51A 1WL6A 4JUQA 2V3YA 3S6BA 3IG4A 4U1BA 2HOWA 2V3XA 4A6VA 4FLKA 3PKAA 1QZYA 2P98A 1BN5A 1R5HA 4PNCA 2BB7A 3BITA 4S00A 2G6PA 3FMRA 4U73A 1CHMA 4IKRA 1XGNA 2BWWA 5JHUA 1O0XA 2BWYA 2Q93A 1JAWA 2BWTA 2BHBA 4S2RP 4ZNGA 2MATA 4U76A 4U6JA 3MR1A 2B3HA 5CNXA 3IU8A 4IU6A 2IW2A 2BH3A 5D6FA 1BOAA 4IF7A 1XNZA 1WN1A 5CE6A 4OOKA 2BWXA 1WL9A 3IU7A 1M35A 5E5BA 3Q6DA 5CDLA 2Q8KA 4FLJA 2DFIA 4B28A 4U71A 2GGBA 3D27A 2Q92A 4R60A 2NQ6A 3RVAA 1KP0A 2EVCA 5CDEA 1C22A 3BIPA 4FLIA 2GTXA 4U6WA 2GG2A 2P9AA 1B59A 2GG7A 3MATA 1YVMA 4RGZ1 3MX6A 1YW9A 1XGMA 3TB5A 4FO7A 4HXXA 3PKEA 1MATA 4ZWOA 4Z7MA 1YW8A 1YW7A 2EA4A 4U70A 2BWUA 2GG0A 2GA2A 2V6CA 2P99A 3CTZA 2BN7A 5FCHA 4IECA 2EVOA 3FM3A 4FUKA 2ZSGA 4U6CA 4U75A 4U6ZA 4A6WA 4PV4A 5FCFA 4S01A 2OAZA 1C27A 4RZYA 2Q96A 2BHAA 5JI6A 3L7GA 3TAVA 4FO8A 1W2MA 3CB6A 2V3ZA 1C21A 4KM3A 3IU9A 2ADUA 1R5GA 4IDYA 1R58A 2EA2A 4IKTA 2B3LA 1KQ9A 2B3KA 2GG8A 2GU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PV9 A;  2GGC A;  4U6E A;  1A16 A;  4RZZ A;  1WKM A;  2BHD A;  1W7V A;  4FLL A;  5JFR A;  2Q95 A;  2GG3 A;  1Y1N A;  2BWV A;  2GU4 A;  5CLS A;  5D6E A;  4MAT A;  1B6A A;  1QXW A;  3FMQ A;  4U69 A;  1WBQ A;  1KQ0 A;  1QXY A;  4FKC A;  4ZWU A;  3PKB A;  3CB5 A;  1WLR A;  3ROR A;  1WY2 A;  2BWS A;  3BIQ A;  2GZ5 A;  2Q94 A;  4IKU A;  4QR8 A;  2GG5 A;  4IPA A;  5CIK A;  1C24 A;  2NQ7 A;  4S2T P;  4ZWP A;  1XGO A;  2BHC A;  2OKN A;  3PKD A;  1YJ3 A;  5CDV A;  2EVM A;  4IKS A;  2GG9 A;  3L24 A;  3PKC A;  2GU5 A;  4EGE A;  1C23 A;  1QXZ A;  1XGS A;  2GU7 A;  1N51 A;  1WL6 A;  4JUQ A;  2V3Y A;  3S6B A;  3IG4 A;  4U1B A;  2HOW A;  2V3X A;  4A6V A;  4FLK A;  3PKA A;  1QZY A;  2P98 A;  1BN5 A;  1R5H A;  4PNC A;  2BB7 A;  3BIT A;  4S00 A;  2G6P A;  3FMR A;  4U73 A;  1CHM A;  4IKR A;  1XGN A;  2BWW A;  5JHU A;  1O0X A;  2BWY A;  2Q93 A;  1JAW A;  2BWT A;  2BHB A;  4S2R P;  4ZNG A;  2MAT A;  4U76 A;  4U6J A;  3MR1 A;  2B3H A;  5CNX A;  3IU8 A;  4IU6 A;  2IW2 A;  2BH3 A;  5D6F A;  1BOA A;  4IF7 A;  1XNZ A;  1WN1 A;  5CE6 A;  4OOK A;  2BWX A;  1WL9 A;  3IU7 A;  1M35 A;  5E5B A;  3Q6D A;  5CDL A;  2Q8K A;  4FLJ A;  2DFI A;  4B28 A;  4U71 A;  2GGB A;  3D27 A;  2Q92 A;  4R60 A;  2NQ6 A;  3RVA A;  1KP0 A;  2EVC A;  5CDE A;  1C22 A;  3BIP A;  4FLI A;  2GTX A;  4U6W A;  2GG2 A;  2P9A A;  1B59 A;  2GG7 A;  3MAT A;  1YVM A;  4RGZ 1;  3MX6 A;  1YW9 A;  1XGM A;  3TB5 A;  4FO7 A;  4HXX A;  3PKE A;  1MAT A;  4ZWO A;  4Z7M A;  1YW8 A;  1YW7 A;  2EA4 A;  4U70 A;  2BWU A;  2GG0 A;  2GA2 A;  2V6C A;  2P99 A;  3CTZ A;  2BN7 A;  5FCH A;  4IEC A;  2EVO A;  3FM3 A;  4FUK A;  2ZSG A;  4U6C A;  4U75 A;  4U6Z A;  4A6W A;  4PV4 A;  5FCF A;  4S01 A;  2OAZ A;  1C27 A;  4RZY A;  2Q96 A;  2BHA A;  5JI6 A;  3L7G A;  3TAV A;  4FO8 A;  1W2M A;  3CB6 A;  2V3Z A;  1C21 A;  4KM3 A;  3IU9 A;  2ADU A;  1R5G A;  4IDY A;  1R58 A;  2EA2 A;  4IKT A;  2B3L A;  1KQ9 A;  2B3K A;  2GG8 A;  2GU6 A; 
#chains in the Genus database with same CATH topology
 1PV9 A;  2GGC A;  4U6E A;  1A16 A;  4RZZ A;  1WKM A;  2BHD A;  1W7V A;  4FLL A;  5JFR A;  2Q95 A;  2GG3 A;  1Y1N A;  2BWV A;  2GU4 A;  5CLS A;  5D6E A;  4MAT A;  1B6A A;  1QXW A;  3FMQ A;  4U69 A;  1WBQ A;  1KQ0 A;  1QXY A;  4FKC A;  4ZWU A;  3PKB A;  3CB5 A;  1WLR A;  3ROR A;  1WY2 A;  2BWS A;  3BIQ A;  2GZ5 A;  2Q94 A;  4IKU A;  4QR8 A;  2GG5 A;  4IPA A;  5CIK A;  1C24 A;  2NQ7 A;  4S2T P;  4ZWP A;  1XGO A;  2BHC A;  2OKN A;  3PKD A;  1YJ3 A;  5CDV A;  2EVM A;  4IKS A;  2GG9 A;  3L24 A;  3PKC A;  2GU5 A;  4EGE A;  1C23 A;  1QXZ A;  1XGS A;  2GU7 A;  1N51 A;  1WL6 A;  4JUQ A;  2V3Y A;  3S6B A;  3IG4 A;  4U1B A;  2HOW A;  2V3X A;  4A6V A;  4FLK A;  3PKA A;  1QZY A;  2P98 A;  1BN5 A;  1R5H A;  4PNC A;  2BB7 A;  3BIT A;  4S00 A;  2G6P A;  3FMR A;  4U73 A;  1CHM A;  4IKR A;  1XGN A;  2BWW A;  5JHU A;  1O0X A;  2BWY A;  2Q93 A;  1JAW A;  2BWT A;  2BHB A;  4S2R P;  4ZNG A;  2MAT A;  4U76 A;  4U6J A;  3MR1 A;  2B3H A;  5CNX A;  3IU8 A;  4IU6 A;  2IW2 A;  2BH3 A;  5D6F A;  1BOA A;  4IF7 A;  1XNZ A;  1WN1 A;  5CE6 A;  4OOK A;  2BWX A;  1WL9 A;  3IU7 A;  1M35 A;  5E5B A;  3Q6D A;  5CDL A;  2Q8K A;  4FLJ A;  2DFI A;  4B28 A;  4U71 A;  2GGB A;  3D27 A;  2Q92 A;  4R60 A;  2NQ6 A;  3RVA A;  1KP0 A;  2EVC A;  5CDE A;  1C22 A;  3BIP A;  4FLI A;  2GTX A;  4U6W A;  2GG2 A;  2P9A A;  1B59 A;  2GG7 A;  3MAT A;  1YVM A;  4RGZ 1;  3MX6 A;  1YW9 A;  1XGM A;  3TB5 A;  4FO7 A;  4HXX A;  3PKE A;  1MAT A;  4ZWO A;  4Z7M A;  1YW8 A;  1YW7 A;  2EA4 A;  4U70 A;  2BWU A;  2GG0 A;  2GA2 A;  2V6C A;  2P99 A;  3CTZ A;  2BN7 A;  5FCH A;  4IEC A;  2EVO A;  3FM3 A;  4FUK A;  2ZSG A;  4U6C A;  4U75 A;  4U6Z A;  4A6W A;  4PV4 A;  5FCF A;  4S01 A;  2OAZ A;  1C27 A;  4RZY A;  2Q96 A;  2BHA A;  5JI6 A;  3L7G A;  3TAV A;  4FO8 A;  1W2M A;  3CB6 A;  2V3Z A;  1C21 A;  4KM3 A;  3IU9 A;  2ADU A;  1R5G A;  4IDY A;  1R58 A;  2EA2 A;  4IKT A;  2B3L A;  1KQ9 A;  2B3K A;  2GG8 A;  2GU6 A; 
#chains in the Genus database with same CATH homology
 1PV9 A;  2GGC A;  4U6E A;  1A16 A;  4RZZ A;  1WKM A;  2BHD A;  1W7V A;  4FLL A;  5JFR A;  2Q95 A;  2GG3 A;  1Y1N A;  2BWV A;  2GU4 A;  5CLS A;  5D6E A;  4MAT A;  1B6A A;  1QXW A;  3FMQ A;  4U69 A;  1WBQ A;  1KQ0 A;  1QXY A;  4FKC A;  4ZWU A;  3PKB A;  3CB5 A;  1WLR A;  3ROR A;  1WY2 A;  2BWS A;  3BIQ A;  2GZ5 A;  2Q94 A;  4IKU A;  4QR8 A;  2GG5 A;  4IPA A;  5CIK A;  1C24 A;  2NQ7 A;  4S2T P;  4ZWP A;  1XGO A;  2BHC A;  2OKN A;  3PKD A;  1YJ3 A;  5CDV A;  2EVM A;  4IKS A;  2GG9 A;  3L24 A;  3PKC A;  2GU5 A;  4EGE A;  1C23 A;  1QXZ A;  1XGS A;  2GU7 A;  1N51 A;  1WL6 A;  4JUQ A;  2V3Y A;  3S6B A;  3IG4 A;  4U1B A;  2HOW A;  2V3X A;  4A6V A;  4FLK A;  3PKA A;  1QZY A;  2P98 A;  1BN5 A;  1R5H A;  4PNC A;  2BB7 A;  3BIT A;  4S00 A;  2G6P A;  3FMR A;  4U73 A;  1CHM A;  4IKR A;  1XGN A;  2BWW A;  5JHU A;  1O0X A;  2BWY A;  2Q93 A;  1JAW A;  2BWT A;  2BHB A;  4S2R P;  4ZNG A;  2MAT A;  4U76 A;  4U6J A;  3MR1 A;  2B3H A;  5CNX A;  3IU8 A;  4IU6 A;  2IW2 A;  2BH3 A;  5D6F A;  1BOA A;  4IF7 A;  1XNZ A;  1WN1 A;  5CE6 A;  4OOK A;  2BWX A;  1WL9 A;  3IU7 A;  1M35 A;  5E5B A;  3Q6D A;  5CDL A;  2Q8K A;  4FLJ A;  2DFI A;  4B28 A;  4U71 A;  2GGB A;  3D27 A;  2Q92 A;  4R60 A;  2NQ6 A;  3RVA A;  1KP0 A;  2EVC A;  5CDE A;  1C22 A;  3BIP A;  4FLI A;  2GTX A;  4U6W A;  2GG2 A;  2P9A A;  1B59 A;  2GG7 A;  3MAT A;  1YVM A;  4RGZ 1;  3MX6 A;  1YW9 A;  1XGM A;  3TB5 A;  4FO7 A;  4HXX A;  3PKE A;  1MAT A;  4ZWO A;  4Z7M A;  1YW8 A;  1YW7 A;  2EA4 A;  4U70 A;  2BWU A;  2GG0 A;  2GA2 A;  2V6C A;  2P99 A;  3CTZ A;  2BN7 A;  5FCH A;  4IEC A;  2EVO A;  3FM3 A;  4FUK A;  2ZSG A;  4U6C A;  4U75 A;  4U6Z A;  4A6W A;  4PV4 A;  5FCF A;  4S01 A;  2OAZ A;  1C27 A;  4RZY A;  2Q96 A;  2BHA A;  5JI6 A;  3L7G A;  3TAV A;  4FO8 A;  1W2M A;  3CB6 A;  2V3Z A;  1C21 A;  4KM3 A;  3IU9 A;  2ADU A;  1R5G A;  4IDY A;  1R58 A;  2EA2 A;  4IKT A;  2B3L A;  1KQ9 A;  2B3K A;  2GG8 A;  2GU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...