2Q96A

E. coli methionine aminopeptidase mn-form with inhibitor a18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 82
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q96A00
2P98A 1QXYA 4Z7MA 4U6JA 3PKBA 2BHAA 2G6PA 1R5GA 4U6CA 4IU6A 1XGNA 4PNCA 1KQ0A 1WKMA 2Q96A 2GG0A 4JUQA 4QR8A 5FCFA 5CDEA 4EGEA 2MATA 5D6EA 1WLRA 3BITA 3TAVA 4S2TP 5CLSA 2GGBA 2BWXA 2BWVA 1C22A 2P99A 1B6AA 4ZNGA 2GG7A 1C27A 1W7VA 4FLIA 1B59A 4FUKA 2BB7A 4IKTA 4IKSA 4U71A 5CDVA 2GZ5A 1QXZA 1N51A 3IU9A 3FM3A 3CTZA 2BWYA 4FO7A 4IKRA 4U1BA 3RVAA 4ZWUA 2NQ6A 4U73A 4FLKA 2GU5A 1WN1A 2V3YA 3L24A 4MATA 5CNXA 4RGZ1 4IKUA 3S6BA 2EA4A 3BIQA 4FKCA 4ZWPA 1XGOA 2GU7A 3PKDA 1R58A 1R5HA 1WL9A 4IDYA 1YW7A 2EVMA 2B3LA 4S2RP 4U69A 2BWWA 4A6VA 4U76A 2GG5A 4U6ZA 3IU7A 3L7GA 1Y1NA 2P9AA 1C21A 2Q94A 4R60A 1C24A 1WL6A 1O0XA 2B3KA 2GG8A 1YJ3A 5CDLA 2BN7A 5CIKA 5E5BA 1BOAA 2BH3A 1MATA 3MR1A 3RORA 2BWTA 2Q8KA 1JAWA 2GU6A 1CHMA 4ZWOA 3MATA 4U70A 3PKAA 1BN5A 3D27A 3CB5A 4S01A 1YVMA 2Q92A 2DFIA 3IU8A 2GTXA 2NQ7A 5JHUA 2BHCA 2EVOA 2Q93A 1XGMA 2V3ZA 1YW9A 4FLLA 5FCHA 5JI6A 2Q95A 2BWUA 2V6CA 1C23A 1YW8A 4U6WA 2EVCA 3BIPA 3CB6A 5JFRA 4B28A 3TB5A 3PKEA 4IECA 4RZZA 2OAZA 2ZSGA 1WBQA 2B3HA 5D6FA 1PV9A 4S00A 2BHDA 2GU4A 1QXWA 1XGSA 2V3XA 1W2MA 4FO8A 3PKCA 3FMQA 4U75A 1M35A 2BWSA 5CE6A 4KM3A 2GA2A 3IG4A 1XNZA 4IF7A 4FLJA 2GG9A 2ADUA 1A16A 4A6WA 2EA2A 2HOWA 1QZYA 4HXXA 3Q6DA 4OOKA 2GG3A 2BHBA 2OKNA 1KQ9A 2IW2A 4IPAA 1WY2A 4RZYA 4U6EA 3MX6A 1KP0A 3FMRA 2GGCA 4PV4A 2GG2A
chains in the Genus database with same CATH superfamily
2P98A 1QXYA 4Z7MA 4U6JA 3PKBA 2BHAA 2G6PA 1R5GA 4U6CA 4IU6A 1XGNA 4PNCA 1KQ0A 1WKMA 2Q96A 2GG0A 4JUQA 4QR8A 5FCFA 5CDEA 4EGEA 2MATA 5D6EA 1WLRA 3BITA 3TAVA 4S2TP 5CLSA 2GGBA 2BWXA 2BWVA 1C22A 2P99A 1B6AA 4ZNGA 2GG7A 1C27A 1W7VA 4FLIA 1B59A 4FUKA 2BB7A 4IKTA 4IKSA 4U71A 5CDVA 2GZ5A 1QXZA 1N51A 3IU9A 3FM3A 3CTZA 2BWYA 4FO7A 4IKRA 4U1BA 3RVAA 4ZWUA 2NQ6A 4U73A 4FLKA 2GU5A 1WN1A 2V3YA 3L24A 4MATA 5CNXA 4RGZ1 4IKUA 3S6BA 2EA4A 3BIQA 4FKCA 4ZWPA 1XGOA 2GU7A 3PKDA 1R58A 1R5HA 1WL9A 4IDYA 1YW7A 2EVMA 2B3LA 4S2RP 4U69A 2BWWA 4A6VA 4U76A 2GG5A 4U6ZA 3IU7A 3L7GA 1Y1NA 2P9AA 1C21A 2Q94A 4R60A 1C24A 1WL6A 1O0XA 2B3KA 2GG8A 1YJ3A 5CDLA 2BN7A 5CIKA 5E5BA 1BOAA 2BH3A 1MATA 3MR1A 3RORA 2BWTA 2Q8KA 1JAWA 2GU6A 1CHMA 4ZWOA 3MATA 4U70A 3PKAA 1BN5A 3D27A 3CB5A 4S01A 1YVMA 2Q92A 2DFIA 3IU8A 2GTXA 2NQ7A 5JHUA 2BHCA 2EVOA 2Q93A 1XGMA 2V3ZA 1YW9A 4FLLA 5FCHA 5JI6A 2Q95A 2BWUA 2V6CA 1C23A 1YW8A 4U6WA 2EVCA 3BIPA 3CB6A 5JFRA 4B28A 3TB5A 3PKEA 4IECA 4RZZA 2OAZA 2ZSGA 1WBQA 2B3HA 5D6FA 1PV9A 4S00A 2BHDA 2GU4A 1QXWA 1XGSA 2V3XA 1W2MA 4FO8A 3PKCA 3FMQA 4U75A 1M35A 2BWSA 5CE6A 4KM3A 2GA2A 3IG4A 1XNZA 4IF7A 4FLJA 2GG9A 2ADUA 1A16A 4A6WA 2EA2A 2HOWA 1QZYA 4HXXA 3Q6DA 4OOKA 2GG3A 2BHBA 2OKNA 1KQ9A 2IW2A 4IPAA 1WY2A 4RZYA 4U6EA 3MX6A 1KP0A 3FMRA 2GGCA 4PV4A 2GG2A
chains in the Genus database with same CATH topology
2P98A 1QXYA 4Z7MA 4U6JA 3PKBA 2BHAA 2G6PA 1R5GA 4U6CA 4IU6A 1XGNA 4PNCA 1KQ0A 1WKMA 2Q96A 2GG0A 4JUQA 4QR8A 5FCFA 5CDEA 4EGEA 2MATA 5D6EA 1WLRA 3BITA 3TAVA 4S2TP 5CLSA 2GGBA 2BWXA 2BWVA 1C22A 2P99A 1B6AA 4ZNGA 2GG7A 1C27A 1W7VA 4FLIA 1B59A 4FUKA 2BB7A 4IKTA 4IKSA 4U71A 5CDVA 2GZ5A 1QXZA 1N51A 3IU9A 3FM3A 3CTZA 2BWYA 4FO7A 4IKRA 4U1BA 3RVAA 4ZWUA 2NQ6A 4U73A 4FLKA 2GU5A 1WN1A 2V3YA 3L24A 4MATA 5CNXA 4RGZ1 4IKUA 3S6BA 2EA4A 3BIQA 4FKCA 4ZWPA 1XGOA 2GU7A 3PKDA 1R58A 1R5HA 1WL9A 4IDYA 1YW7A 2EVMA 2B3LA 4S2RP 4U69A 2BWWA 4A6VA 4U76A 2GG5A 4U6ZA 3IU7A 3L7GA 1Y1NA 2P9AA 1C21A 2Q94A 4R60A 1C24A 1WL6A 1O0XA 2B3KA 2GG8A 1YJ3A 5CDLA 2BN7A 5CIKA 5E5BA 1BOAA 2BH3A 1MATA 3MR1A 3RORA 2BWTA 2Q8KA 1JAWA 2GU6A 1CHMA 4ZWOA 3MATA 4U70A 3PKAA 1BN5A 3D27A 3CB5A 4S01A 1YVMA 2Q92A 2DFIA 3IU8A 2GTXA 2NQ7A 5JHUA 2BHCA 2EVOA 2Q93A 1XGMA 2V3ZA 1YW9A 4FLLA 5FCHA 5JI6A 2Q95A 2BWUA 2V6CA 1C23A 1YW8A 4U6WA 2EVCA 3BIPA 3CB6A 5JFRA 4B28A 3TB5A 3PKEA 4IECA 4RZZA 2OAZA 2ZSGA 1WBQA 2B3HA 5D6FA 1PV9A 4S00A 2BHDA 2GU4A 1QXWA 1XGSA 2V3XA 1W2MA 4FO8A 3PKCA 3FMQA 4U75A 1M35A 2BWSA 5CE6A 4KM3A 2GA2A 3IG4A 1XNZA 4IF7A 4FLJA 2GG9A 2ADUA 1A16A 4A6WA 2EA2A 2HOWA 1QZYA 4HXXA 3Q6DA 4OOKA 2GG3A 2BHBA 2OKNA 1KQ9A 2IW2A 4IPAA 1WY2A 4RZYA 4U6EA 3MX6A 1KP0A 3FMRA 2GGCA 4PV4A 2GG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P98 A;  1QXY A;  4Z7M A;  4U6J A;  3PKB A;  2BHA A;  2G6P A;  1R5G A;  4U6C A;  4IU6 A;  1XGN A;  4PNC A;  1KQ0 A;  1WKM A;  2Q96 A;  2GG0 A;  4JUQ A;  4QR8 A;  5FCF A;  5CDE A;  4EGE A;  2MAT A;  5D6E A;  1WLR A;  3BIT A;  3TAV A;  4S2T P;  5CLS A;  2GGB A;  2BWX A;  2BWV A;  1C22 A;  2P99 A;  1B6A A;  4ZNG A;  2GG7 A;  1C27 A;  1W7V A;  4FLI A;  1B59 A;  4FUK A;  2BB7 A;  4IKT A;  4IKS A;  4U71 A;  5CDV A;  2GZ5 A;  1QXZ A;  1N51 A;  3IU9 A;  3FM3 A;  3CTZ A;  2BWY A;  4FO7 A;  4IKR A;  4U1B A;  3RVA A;  4ZWU A;  2NQ6 A;  4U73 A;  4FLK A;  2GU5 A;  1WN1 A;  2V3Y A;  3L24 A;  4MAT A;  5CNX A;  4RGZ 1;  4IKU A;  3S6B A;  2EA4 A;  3BIQ A;  4FKC A;  4ZWP A;  1XGO A;  2GU7 A;  3PKD A;  1R58 A;  1R5H A;  1WL9 A;  4IDY A;  1YW7 A;  2EVM A;  2B3L A;  4S2R P;  4U69 A;  2BWW A;  4A6V A;  4U76 A;  2GG5 A;  4U6Z A;  3IU7 A;  3L7G A;  1Y1N A;  2P9A A;  1C21 A;  2Q94 A;  4R60 A;  1C24 A;  1WL6 A;  1O0X A;  2B3K A;  2GG8 A;  1YJ3 A;  5CDL A;  2BN7 A;  5CIK A;  5E5B A;  1BOA A;  2BH3 A;  1MAT A;  3MR1 A;  3ROR A;  2BWT A;  2Q8K A;  1JAW A;  2GU6 A;  1CHM A;  4ZWO A;  3MAT A;  4U70 A;  3PKA A;  1BN5 A;  3D27 A;  3CB5 A;  4S01 A;  1YVM A;  2Q92 A;  2DFI A;  3IU8 A;  2GTX A;  2NQ7 A;  5JHU A;  2BHC A;  2EVO A;  2Q93 A;  1XGM A;  2V3Z A;  1YW9 A;  4FLL A;  5FCH A;  5JI6 A;  2Q95 A;  2BWU A;  2V6C A;  1C23 A;  1YW8 A;  4U6W A;  2EVC A;  3BIP A;  3CB6 A;  5JFR A;  4B28 A;  3TB5 A;  3PKE A;  4IEC A;  4RZZ A;  2OAZ A;  2ZSG A;  1WBQ A;  2B3H A;  5D6F A;  1PV9 A;  4S00 A;  2BHD A;  2GU4 A;  1QXW A;  1XGS A;  2V3X A;  1W2M A;  4FO8 A;  3PKC A;  3FMQ A;  4U75 A;  1M35 A;  2BWS A;  5CE6 A;  4KM3 A;  2GA2 A;  3IG4 A;  1XNZ A;  4IF7 A;  4FLJ A;  2GG9 A;  2ADU A;  1A16 A;  4A6W A;  2EA2 A;  2HOW A;  1QZY A;  4HXX A;  3Q6D A;  4OOK A;  2GG3 A;  2BHB A;  2OKN A;  1KQ9 A;  2IW2 A;  4IPA A;  1WY2 A;  4RZY A;  4U6E A;  3MX6 A;  1KP0 A;  3FMR A;  2GGC A;  4PV4 A;  2GG2 A; 
#chains in the Genus database with same CATH topology
 2P98 A;  1QXY A;  4Z7M A;  4U6J A;  3PKB A;  2BHA A;  2G6P A;  1R5G A;  4U6C A;  4IU6 A;  1XGN A;  4PNC A;  1KQ0 A;  1WKM A;  2Q96 A;  2GG0 A;  4JUQ A;  4QR8 A;  5FCF A;  5CDE A;  4EGE A;  2MAT A;  5D6E A;  1WLR A;  3BIT A;  3TAV A;  4S2T P;  5CLS A;  2GGB A;  2BWX A;  2BWV A;  1C22 A;  2P99 A;  1B6A A;  4ZNG A;  2GG7 A;  1C27 A;  1W7V A;  4FLI A;  1B59 A;  4FUK A;  2BB7 A;  4IKT A;  4IKS A;  4U71 A;  5CDV A;  2GZ5 A;  1QXZ A;  1N51 A;  3IU9 A;  3FM3 A;  3CTZ A;  2BWY A;  4FO7 A;  4IKR A;  4U1B A;  3RVA A;  4ZWU A;  2NQ6 A;  4U73 A;  4FLK A;  2GU5 A;  1WN1 A;  2V3Y A;  3L24 A;  4MAT A;  5CNX A;  4RGZ 1;  4IKU A;  3S6B A;  2EA4 A;  3BIQ A;  4FKC A;  4ZWP A;  1XGO A;  2GU7 A;  3PKD A;  1R58 A;  1R5H A;  1WL9 A;  4IDY A;  1YW7 A;  2EVM A;  2B3L A;  4S2R P;  4U69 A;  2BWW A;  4A6V A;  4U76 A;  2GG5 A;  4U6Z A;  3IU7 A;  3L7G A;  1Y1N A;  2P9A A;  1C21 A;  2Q94 A;  4R60 A;  1C24 A;  1WL6 A;  1O0X A;  2B3K A;  2GG8 A;  1YJ3 A;  5CDL A;  2BN7 A;  5CIK A;  5E5B A;  1BOA A;  2BH3 A;  1MAT A;  3MR1 A;  3ROR A;  2BWT A;  2Q8K A;  1JAW A;  2GU6 A;  1CHM A;  4ZWO A;  3MAT A;  4U70 A;  3PKA A;  1BN5 A;  3D27 A;  3CB5 A;  4S01 A;  1YVM A;  2Q92 A;  2DFI A;  3IU8 A;  2GTX A;  2NQ7 A;  5JHU A;  2BHC A;  2EVO A;  2Q93 A;  1XGM A;  2V3Z A;  1YW9 A;  4FLL A;  5FCH A;  5JI6 A;  2Q95 A;  2BWU A;  2V6C A;  1C23 A;  1YW8 A;  4U6W A;  2EVC A;  3BIP A;  3CB6 A;  5JFR A;  4B28 A;  3TB5 A;  3PKE A;  4IEC A;  4RZZ A;  2OAZ A;  2ZSG A;  1WBQ A;  2B3H A;  5D6F A;  1PV9 A;  4S00 A;  2BHD A;  2GU4 A;  1QXW A;  1XGS A;  2V3X A;  1W2M A;  4FO8 A;  3PKC A;  3FMQ A;  4U75 A;  1M35 A;  2BWS A;  5CE6 A;  4KM3 A;  2GA2 A;  3IG4 A;  1XNZ A;  4IF7 A;  4FLJ A;  2GG9 A;  2ADU A;  1A16 A;  4A6W A;  2EA2 A;  2HOW A;  1QZY A;  4HXX A;  3Q6D A;  4OOK A;  2GG3 A;  2BHB A;  2OKN A;  1KQ9 A;  2IW2 A;  4IPA A;  1WY2 A;  4RZY A;  4U6E A;  3MX6 A;  1KP0 A;  3FMR A;  2GGC A;  4PV4 A;  2GG2 A; 
#chains in the Genus database with same CATH homology
 2P98 A;  1QXY A;  4Z7M A;  4U6J A;  3PKB A;  2BHA A;  2G6P A;  1R5G A;  4U6C A;  4IU6 A;  1XGN A;  4PNC A;  1KQ0 A;  1WKM A;  2Q96 A;  2GG0 A;  4JUQ A;  4QR8 A;  5FCF A;  5CDE A;  4EGE A;  2MAT A;  5D6E A;  1WLR A;  3BIT A;  3TAV A;  4S2T P;  5CLS A;  2GGB A;  2BWX A;  2BWV A;  1C22 A;  2P99 A;  1B6A A;  4ZNG A;  2GG7 A;  1C27 A;  1W7V A;  4FLI A;  1B59 A;  4FUK A;  2BB7 A;  4IKT A;  4IKS A;  4U71 A;  5CDV A;  2GZ5 A;  1QXZ A;  1N51 A;  3IU9 A;  3FM3 A;  3CTZ A;  2BWY A;  4FO7 A;  4IKR A;  4U1B A;  3RVA A;  4ZWU A;  2NQ6 A;  4U73 A;  4FLK A;  2GU5 A;  1WN1 A;  2V3Y A;  3L24 A;  4MAT A;  5CNX A;  4RGZ 1;  4IKU A;  3S6B A;  2EA4 A;  3BIQ A;  4FKC A;  4ZWP A;  1XGO A;  2GU7 A;  3PKD A;  1R58 A;  1R5H A;  1WL9 A;  4IDY A;  1YW7 A;  2EVM A;  2B3L A;  4S2R P;  4U69 A;  2BWW A;  4A6V A;  4U76 A;  2GG5 A;  4U6Z A;  3IU7 A;  3L7G A;  1Y1N A;  2P9A A;  1C21 A;  2Q94 A;  4R60 A;  1C24 A;  1WL6 A;  1O0X A;  2B3K A;  2GG8 A;  1YJ3 A;  5CDL A;  2BN7 A;  5CIK A;  5E5B A;  1BOA A;  2BH3 A;  1MAT A;  3MR1 A;  3ROR A;  2BWT A;  2Q8K A;  1JAW A;  2GU6 A;  1CHM A;  4ZWO A;  3MAT A;  4U70 A;  3PKA A;  1BN5 A;  3D27 A;  3CB5 A;  4S01 A;  1YVM A;  2Q92 A;  2DFI A;  3IU8 A;  2GTX A;  2NQ7 A;  5JHU A;  2BHC A;  2EVO A;  2Q93 A;  1XGM A;  2V3Z A;  1YW9 A;  4FLL A;  5FCH A;  5JI6 A;  2Q95 A;  2BWU A;  2V6C A;  1C23 A;  1YW8 A;  4U6W A;  2EVC A;  3BIP A;  3CB6 A;  5JFR A;  4B28 A;  3TB5 A;  3PKE A;  4IEC A;  4RZZ A;  2OAZ A;  2ZSG A;  1WBQ A;  2B3H A;  5D6F A;  1PV9 A;  4S00 A;  2BHD A;  2GU4 A;  1QXW A;  1XGS A;  2V3X A;  1W2M A;  4FO8 A;  3PKC A;  3FMQ A;  4U75 A;  1M35 A;  2BWS A;  5CE6 A;  4KM3 A;  2GA2 A;  3IG4 A;  1XNZ A;  4IF7 A;  4FLJ A;  2GG9 A;  2ADU A;  1A16 A;  4A6W A;  2EA2 A;  2HOW A;  1QZY A;  4HXX A;  3Q6D A;  4OOK A;  2GG3 A;  2BHB A;  2OKN A;  1KQ9 A;  2IW2 A;  4IPA A;  1WY2 A;  4RZY A;  4U6E A;  3MX6 A;  1KP0 A;  3FMR A;  2GGC A;  4PV4 A;  2GG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...