2Q96A

E. coli methionine aminopeptidase mn-form with inhibitor a18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 82
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q96A00
1QXYA 4U71A 1QXZA 3CTZA 2BWWA 4FO7A 2BWYA 2GG9A 4EGEA 5FCFA 1XGOA 2BWXA 1QXWA 1KP0A 4S2RP 2BWVA 1R58A 1KQ9A 2Q95A 3IU8A 4PNCA 5JFRA 3BIPA 2P99A 4U69A 4S01A 3IG4A 4RGZ1 2MATA 4ZNGA 1WLRA 3PKCA 1W7VA 1C27A 5D6EA 3PKAA 3BIQA 1BOAA 2GU6A 2BN7A 4IKTA 4Z7MA 5JHUA 2GGBA 1YW7A 2BHDA 4JUQA 3TAVA 2P9AA 3PKDA 1W2MA 2GU5A 5CIKA 4FKCA 3Q6DA 4U70A 1C23A 1R5GA 2EVCA 4A6VA 1KQ0A 3S6BA 4R60A 2OAZA 4RZZA 5CDLA 2Q94A 4HXXA 1YW9A 4U6ZA 4PV4A 2GG5A 2EVMA 1JAWA 2BB7A 2HOWA 2IW2A 3PKBA 1WN1A 3MR1A 2Q96A 4IDYA 1A16A 2GG2A 1PV9A 2BWSA 4ZWUA 1O0XA 3FM3A 2GU7A 2GG3A 1C24A 1C22A 1CHMA 4ZWOA 1YW8A 3FMRA 1N51A 5CNXA 5CE6A 1WBQA 2GG8A 2BHCA 4IKRA 5CDEA 1C21A 2NQ6A 2BHBA 3IU9A 4IKSA 3D27A 4FLLA 2Q8KA 4FO8A 1XGNA 3PKEA 4U6WA 5E5BA 1B6AA 2BWUA 4QR8A 4U73A 4KM3A 1MATA 1XGMA 2Q92A 3L24A 2P98A 2NQ7A 2V3ZA 1BN5A 4FLJA 4IPAA 5FCHA 2ADUA 1B59A 5JI6A 4U1BA 2G6PA 4FUKA 2ZSGA 3CB6A 1WL9A 2BWTA 1WL6A 2GA2A 3FMQA 2EA4A 1QZYA 1WKMA 4FLKA 2BH3A 2B3HA 1YJ3A 1XGSA 3CB5A 5D6FA 4OOKA 2V3XA 2B3LA 3TB5A 4B28A 1XNZA 2B3KA 2EA2A 4MATA 1WY2A 2DFIA 3L7GA 2GG7A 4RZYA 5CLSA 3IU7A 2GZ5A 4IECA 2GU4A 3RVAA 2GGCA 2OKNA 2GTXA 4U6EA 1YVMA 4S00A 4IKUA 2BHAA 2V6CA 2Q93A 1M35A 4IU6A 4ZWPA 3MX6A 4U6JA 5CDVA 3RORA 1R5HA 4U6CA 2EVOA 4U75A 4IF7A 4FLIA 3MATA 1Y1NA 3BITA 4S2TP 4A6WA 4U76A 2V3YA 2GG0A
chains in the Genus database with same CATH superfamily
1QXYA 4U71A 1QXZA 3CTZA 2BWWA 4FO7A 2BWYA 2GG9A 4EGEA 5FCFA 1XGOA 2BWXA 1QXWA 1KP0A 4S2RP 2BWVA 1R58A 1KQ9A 2Q95A 3IU8A 4PNCA 5JFRA 3BIPA 2P99A 4U69A 4S01A 3IG4A 4RGZ1 2MATA 4ZNGA 1WLRA 3PKCA 1W7VA 1C27A 5D6EA 3PKAA 3BIQA 1BOAA 2GU6A 2BN7A 4IKTA 4Z7MA 5JHUA 2GGBA 1YW7A 2BHDA 4JUQA 3TAVA 2P9AA 3PKDA 1W2MA 2GU5A 5CIKA 4FKCA 3Q6DA 4U70A 1C23A 1R5GA 2EVCA 4A6VA 1KQ0A 3S6BA 4R60A 2OAZA 4RZZA 5CDLA 2Q94A 4HXXA 1YW9A 4U6ZA 4PV4A 2GG5A 2EVMA 1JAWA 2BB7A 2HOWA 2IW2A 3PKBA 1WN1A 3MR1A 2Q96A 4IDYA 1A16A 2GG2A 1PV9A 2BWSA 4ZWUA 1O0XA 3FM3A 2GU7A 2GG3A 1C24A 1C22A 1CHMA 4ZWOA 1YW8A 3FMRA 1N51A 5CNXA 5CE6A 1WBQA 2GG8A 2BHCA 4IKRA 5CDEA 1C21A 2NQ6A 2BHBA 3IU9A 4IKSA 3D27A 4FLLA 2Q8KA 4FO8A 1XGNA 3PKEA 4U6WA 5E5BA 1B6AA 2BWUA 4QR8A 4U73A 4KM3A 1MATA 1XGMA 2Q92A 3L24A 2P98A 2NQ7A 2V3ZA 1BN5A 4FLJA 4IPAA 5FCHA 2ADUA 1B59A 5JI6A 4U1BA 2G6PA 4FUKA 2ZSGA 3CB6A 1WL9A 2BWTA 1WL6A 2GA2A 3FMQA 2EA4A 1QZYA 1WKMA 4FLKA 2BH3A 2B3HA 1YJ3A 1XGSA 3CB5A 5D6FA 4OOKA 2V3XA 2B3LA 3TB5A 4B28A 1XNZA 2B3KA 2EA2A 4MATA 1WY2A 2DFIA 3L7GA 2GG7A 4RZYA 5CLSA 3IU7A 2GZ5A 4IECA 2GU4A 3RVAA 2GGCA 2OKNA 2GTXA 4U6EA 1YVMA 4S00A 4IKUA 2BHAA 2V6CA 2Q93A 1M35A 4IU6A 4ZWPA 3MX6A 4U6JA 5CDVA 3RORA 1R5HA 4U6CA 2EVOA 4U75A 4IF7A 4FLIA 3MATA 1Y1NA 3BITA 4S2TP 4A6WA 4U76A 2V3YA 2GG0A
chains in the Genus database with same CATH topology
1QXYA 4U71A 1QXZA 3CTZA 2BWWA 4FO7A 2BWYA 2GG9A 4EGEA 5FCFA 1XGOA 2BWXA 1QXWA 1KP0A 4S2RP 2BWVA 1R58A 1KQ9A 2Q95A 3IU8A 4PNCA 5JFRA 3BIPA 2P99A 4U69A 4S01A 3IG4A 4RGZ1 2MATA 4ZNGA 1WLRA 3PKCA 1W7VA 1C27A 5D6EA 3PKAA 3BIQA 1BOAA 2GU6A 2BN7A 4IKTA 4Z7MA 5JHUA 2GGBA 1YW7A 2BHDA 4JUQA 3TAVA 2P9AA 3PKDA 1W2MA 2GU5A 5CIKA 4FKCA 3Q6DA 4U70A 1C23A 1R5GA 2EVCA 4A6VA 1KQ0A 3S6BA 4R60A 2OAZA 4RZZA 5CDLA 2Q94A 4HXXA 1YW9A 4U6ZA 4PV4A 2GG5A 2EVMA 1JAWA 2BB7A 2HOWA 2IW2A 3PKBA 1WN1A 3MR1A 2Q96A 4IDYA 1A16A 2GG2A 1PV9A 2BWSA 4ZWUA 1O0XA 3FM3A 2GU7A 2GG3A 1C24A 1C22A 1CHMA 4ZWOA 1YW8A 3FMRA 1N51A 5CNXA 5CE6A 1WBQA 2GG8A 2BHCA 4IKRA 5CDEA 1C21A 2NQ6A 2BHBA 3IU9A 4IKSA 3D27A 4FLLA 2Q8KA 4FO8A 1XGNA 3PKEA 4U6WA 5E5BA 1B6AA 2BWUA 4QR8A 4U73A 4KM3A 1MATA 1XGMA 2Q92A 3L24A 2P98A 2NQ7A 2V3ZA 1BN5A 4FLJA 4IPAA 5FCHA 2ADUA 1B59A 5JI6A 4U1BA 2G6PA 4FUKA 2ZSGA 3CB6A 1WL9A 2BWTA 1WL6A 2GA2A 3FMQA 2EA4A 1QZYA 1WKMA 4FLKA 2BH3A 2B3HA 1YJ3A 1XGSA 3CB5A 5D6FA 4OOKA 2V3XA 2B3LA 3TB5A 4B28A 1XNZA 2B3KA 2EA2A 4MATA 1WY2A 2DFIA 3L7GA 2GG7A 4RZYA 5CLSA 3IU7A 2GZ5A 4IECA 2GU4A 3RVAA 2GGCA 2OKNA 2GTXA 4U6EA 1YVMA 4S00A 4IKUA 2BHAA 2V6CA 2Q93A 1M35A 4IU6A 4ZWPA 3MX6A 4U6JA 5CDVA 3RORA 1R5HA 4U6CA 2EVOA 4U75A 4IF7A 4FLIA 3MATA 1Y1NA 3BITA 4S2TP 4A6WA 4U76A 2V3YA 2GG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXY A;  4U71 A;  1QXZ A;  3CTZ A;  2BWW A;  4FO7 A;  2BWY A;  2GG9 A;  4EGE A;  5FCF A;  1XGO A;  2BWX A;  1QXW A;  1KP0 A;  4S2R P;  2BWV A;  1R58 A;  1KQ9 A;  2Q95 A;  3IU8 A;  4PNC A;  5JFR A;  3BIP A;  2P99 A;  4U69 A;  4S01 A;  3IG4 A;  4RGZ 1;  2MAT A;  4ZNG A;  1WLR A;  3PKC A;  1W7V A;  1C27 A;  5D6E A;  3PKA A;  3BIQ A;  1BOA A;  2GU6 A;  2BN7 A;  4IKT A;  4Z7M A;  5JHU A;  2GGB A;  1YW7 A;  2BHD A;  4JUQ A;  3TAV A;  2P9A A;  3PKD A;  1W2M A;  2GU5 A;  5CIK A;  4FKC A;  3Q6D A;  4U70 A;  1C23 A;  1R5G A;  2EVC A;  4A6V A;  1KQ0 A;  3S6B A;  4R60 A;  2OAZ A;  4RZZ A;  5CDL A;  2Q94 A;  4HXX A;  1YW9 A;  4U6Z A;  4PV4 A;  2GG5 A;  2EVM A;  1JAW A;  2BB7 A;  2HOW A;  2IW2 A;  3PKB A;  1WN1 A;  3MR1 A;  2Q96 A;  4IDY A;  1A16 A;  2GG2 A;  1PV9 A;  2BWS A;  4ZWU A;  1O0X A;  3FM3 A;  2GU7 A;  2GG3 A;  1C24 A;  1C22 A;  1CHM A;  4ZWO A;  1YW8 A;  3FMR A;  1N51 A;  5CNX A;  5CE6 A;  1WBQ A;  2GG8 A;  2BHC A;  4IKR A;  5CDE A;  1C21 A;  2NQ6 A;  2BHB A;  3IU9 A;  4IKS A;  3D27 A;  4FLL A;  2Q8K A;  4FO8 A;  1XGN A;  3PKE A;  4U6W A;  5E5B A;  1B6A A;  2BWU A;  4QR8 A;  4U73 A;  4KM3 A;  1MAT A;  1XGM A;  2Q92 A;  3L24 A;  2P98 A;  2NQ7 A;  2V3Z A;  1BN5 A;  4FLJ A;  4IPA A;  5FCH A;  2ADU A;  1B59 A;  5JI6 A;  4U1B A;  2G6P A;  4FUK A;  2ZSG A;  3CB6 A;  1WL9 A;  2BWT A;  1WL6 A;  2GA2 A;  3FMQ A;  2EA4 A;  1QZY A;  1WKM A;  4FLK A;  2BH3 A;  2B3H A;  1YJ3 A;  1XGS A;  3CB5 A;  5D6F A;  4OOK A;  2V3X A;  2B3L A;  3TB5 A;  4B28 A;  1XNZ A;  2B3K A;  2EA2 A;  4MAT A;  1WY2 A;  2DFI A;  3L7G A;  2GG7 A;  4RZY A;  5CLS A;  3IU7 A;  2GZ5 A;  4IEC A;  2GU4 A;  3RVA A;  2GGC A;  2OKN A;  2GTX A;  4U6E A;  1YVM A;  4S00 A;  4IKU A;  2BHA A;  2V6C A;  2Q93 A;  1M35 A;  4IU6 A;  4ZWP A;  3MX6 A;  4U6J A;  5CDV A;  3ROR A;  1R5H A;  4U6C A;  2EVO A;  4U75 A;  4IF7 A;  4FLI A;  3MAT A;  1Y1N A;  3BIT A;  4S2T P;  4A6W A;  4U76 A;  2V3Y A;  2GG0 A; 
#chains in the Genus database with same CATH topology
 1QXY A;  4U71 A;  1QXZ A;  3CTZ A;  2BWW A;  4FO7 A;  2BWY A;  2GG9 A;  4EGE A;  5FCF A;  1XGO A;  2BWX A;  1QXW A;  1KP0 A;  4S2R P;  2BWV A;  1R58 A;  1KQ9 A;  2Q95 A;  3IU8 A;  4PNC A;  5JFR A;  3BIP A;  2P99 A;  4U69 A;  4S01 A;  3IG4 A;  4RGZ 1;  2MAT A;  4ZNG A;  1WLR A;  3PKC A;  1W7V A;  1C27 A;  5D6E A;  3PKA A;  3BIQ A;  1BOA A;  2GU6 A;  2BN7 A;  4IKT A;  4Z7M A;  5JHU A;  2GGB A;  1YW7 A;  2BHD A;  4JUQ A;  3TAV A;  2P9A A;  3PKD A;  1W2M A;  2GU5 A;  5CIK A;  4FKC A;  3Q6D A;  4U70 A;  1C23 A;  1R5G A;  2EVC A;  4A6V A;  1KQ0 A;  3S6B A;  4R60 A;  2OAZ A;  4RZZ A;  5CDL A;  2Q94 A;  4HXX A;  1YW9 A;  4U6Z A;  4PV4 A;  2GG5 A;  2EVM A;  1JAW A;  2BB7 A;  2HOW A;  2IW2 A;  3PKB A;  1WN1 A;  3MR1 A;  2Q96 A;  4IDY A;  1A16 A;  2GG2 A;  1PV9 A;  2BWS A;  4ZWU A;  1O0X A;  3FM3 A;  2GU7 A;  2GG3 A;  1C24 A;  1C22 A;  1CHM A;  4ZWO A;  1YW8 A;  3FMR A;  1N51 A;  5CNX A;  5CE6 A;  1WBQ A;  2GG8 A;  2BHC A;  4IKR A;  5CDE A;  1C21 A;  2NQ6 A;  2BHB A;  3IU9 A;  4IKS A;  3D27 A;  4FLL A;  2Q8K A;  4FO8 A;  1XGN A;  3PKE A;  4U6W A;  5E5B A;  1B6A A;  2BWU A;  4QR8 A;  4U73 A;  4KM3 A;  1MAT A;  1XGM A;  2Q92 A;  3L24 A;  2P98 A;  2NQ7 A;  2V3Z A;  1BN5 A;  4FLJ A;  4IPA A;  5FCH A;  2ADU A;  1B59 A;  5JI6 A;  4U1B A;  2G6P A;  4FUK A;  2ZSG A;  3CB6 A;  1WL9 A;  2BWT A;  1WL6 A;  2GA2 A;  3FMQ A;  2EA4 A;  1QZY A;  1WKM A;  4FLK A;  2BH3 A;  2B3H A;  1YJ3 A;  1XGS A;  3CB5 A;  5D6F A;  4OOK A;  2V3X A;  2B3L A;  3TB5 A;  4B28 A;  1XNZ A;  2B3K A;  2EA2 A;  4MAT A;  1WY2 A;  2DFI A;  3L7G A;  2GG7 A;  4RZY A;  5CLS A;  3IU7 A;  2GZ5 A;  4IEC A;  2GU4 A;  3RVA A;  2GGC A;  2OKN A;  2GTX A;  4U6E A;  1YVM A;  4S00 A;  4IKU A;  2BHA A;  2V6C A;  2Q93 A;  1M35 A;  4IU6 A;  4ZWP A;  3MX6 A;  4U6J A;  5CDV A;  3ROR A;  1R5H A;  4U6C A;  2EVO A;  4U75 A;  4IF7 A;  4FLI A;  3MAT A;  1Y1N A;  3BIT A;  4S2T P;  4A6W A;  4U76 A;  2V3Y A;  2GG0 A; 
#chains in the Genus database with same CATH homology
 1QXY A;  4U71 A;  1QXZ A;  3CTZ A;  2BWW A;  4FO7 A;  2BWY A;  2GG9 A;  4EGE A;  5FCF A;  1XGO A;  2BWX A;  1QXW A;  1KP0 A;  4S2R P;  2BWV A;  1R58 A;  1KQ9 A;  2Q95 A;  3IU8 A;  4PNC A;  5JFR A;  3BIP A;  2P99 A;  4U69 A;  4S01 A;  3IG4 A;  4RGZ 1;  2MAT A;  4ZNG A;  1WLR A;  3PKC A;  1W7V A;  1C27 A;  5D6E A;  3PKA A;  3BIQ A;  1BOA A;  2GU6 A;  2BN7 A;  4IKT A;  4Z7M A;  5JHU A;  2GGB A;  1YW7 A;  2BHD A;  4JUQ A;  3TAV A;  2P9A A;  3PKD A;  1W2M A;  2GU5 A;  5CIK A;  4FKC A;  3Q6D A;  4U70 A;  1C23 A;  1R5G A;  2EVC A;  4A6V A;  1KQ0 A;  3S6B A;  4R60 A;  2OAZ A;  4RZZ A;  5CDL A;  2Q94 A;  4HXX A;  1YW9 A;  4U6Z A;  4PV4 A;  2GG5 A;  2EVM A;  1JAW A;  2BB7 A;  2HOW A;  2IW2 A;  3PKB A;  1WN1 A;  3MR1 A;  2Q96 A;  4IDY A;  1A16 A;  2GG2 A;  1PV9 A;  2BWS A;  4ZWU A;  1O0X A;  3FM3 A;  2GU7 A;  2GG3 A;  1C24 A;  1C22 A;  1CHM A;  4ZWO A;  1YW8 A;  3FMR A;  1N51 A;  5CNX A;  5CE6 A;  1WBQ A;  2GG8 A;  2BHC A;  4IKR A;  5CDE A;  1C21 A;  2NQ6 A;  2BHB A;  3IU9 A;  4IKS A;  3D27 A;  4FLL A;  2Q8K A;  4FO8 A;  1XGN A;  3PKE A;  4U6W A;  5E5B A;  1B6A A;  2BWU A;  4QR8 A;  4U73 A;  4KM3 A;  1MAT A;  1XGM A;  2Q92 A;  3L24 A;  2P98 A;  2NQ7 A;  2V3Z A;  1BN5 A;  4FLJ A;  4IPA A;  5FCH A;  2ADU A;  1B59 A;  5JI6 A;  4U1B A;  2G6P A;  4FUK A;  2ZSG A;  3CB6 A;  1WL9 A;  2BWT A;  1WL6 A;  2GA2 A;  3FMQ A;  2EA4 A;  1QZY A;  1WKM A;  4FLK A;  2BH3 A;  2B3H A;  1YJ3 A;  1XGS A;  3CB5 A;  5D6F A;  4OOK A;  2V3X A;  2B3L A;  3TB5 A;  4B28 A;  1XNZ A;  2B3K A;  2EA2 A;  4MAT A;  1WY2 A;  2DFI A;  3L7G A;  2GG7 A;  4RZY A;  5CLS A;  3IU7 A;  2GZ5 A;  4IEC A;  2GU4 A;  3RVA A;  2GGC A;  2OKN A;  2GTX A;  4U6E A;  1YVM A;  4S00 A;  4IKU A;  2BHA A;  2V6C A;  2Q93 A;  1M35 A;  4IU6 A;  4ZWP A;  3MX6 A;  4U6J A;  5CDV A;  3ROR A;  1R5H A;  4U6C A;  2EVO A;  4U75 A;  4IF7 A;  4FLI A;  3MAT A;  1Y1N A;  3BIT A;  4S2T P;  4A6W A;  4U76 A;  2V3Y A;  2GG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...