2Q96A

E. coli methionine aminopeptidase mn-form with inhibitor a18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
total genus 82
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q96A00
2NQ6A 1XGMA 1M35A 1R58A 4FLJA 5CLSA 3IU7A 5CIKA 1C21A 4IECA 4IPAA 2BWWA 2EVOA 2IW2A 2GG3A 3PKEA 1YW9A 2BN7A 2DFIA 5JI6A 3MATA 4FLKA 2ADUA 2P98A 4U73A 2GG7A 1WKMA 4FO7A 4U6ZA 1O0XA 5FCHA 5CDLA 2GU7A 3D27A 1KQ9A 3RORA 1YVMA 1KP0A 2Q96A 2EVCA 2OKNA 5CNXA 5D6FA 1XGSA 4QR8A 2EVMA 4PV4A 5JFRA 4JUQA 1YW8A 3IU9A 4B28A 5JHUA 4U1BA 5CDVA 2BHCA 1XGNA 1BOAA 3MR1A 1WLRA 1C22A 2V3ZA 2B3LA 2GG8A 5CDEA 2Q8KA 1C27A 2MATA 4IF7A 3IU8A 1MATA 4A6VA 4IDYA 4PNCA 1CHMA 3FMRA 1BN5A 1QZYA 2BHAA 3PKCA 3PKBA 1A16A 3BIQA 4U6CA 2Q93A 1YJ3A 2GG9A 4U75A 4IKTA 2NQ7A 4S2TP 1XNZA 1WL6A 1KQ0A 3CTZA 2BWVA 1QXZA 4KM3A 3BIPA 4FO8A 1W7VA 3S6BA 2BH3A 2BWTA 2EA4A 2OAZA 2BB7A 1QXYA 4IKSA 4RGZ1 4OOKA 2P9AA 1QXWA 4S00A 3FMQA 4FKCA 4RZZA 5D6EA 1YW7A 2P99A 2Q95A 3PKDA 1XGOA 4ZWOA 4U70A 1WY2A 1R5GA 2GU6A 4A6WA 3RVAA 2BWYA 2GG0A 2Q94A 2V3XA 2GG5A 2GU5A 2BWXA 1B59A 2GGBA 4S2RP 3FM3A 3L24A 3BITA 2V3YA 3Q6DA 2BWSA 4EGEA 2HOWA 5FCFA 1Y1NA 2BWUA 1R5HA 1WBQA 4ZWPA 2ZSGA 2EA2A 4HXXA 2GTXA 4ZWUA 2Q92A 3L7GA 4FUKA 2GA2A 4IU6A 4U6WA 2V6CA 4R60A 4U6JA 2BHBA 2G6PA 2GU4A 1C23A 1N51A 1WN1A 1B6AA 3CB5A 2GZ5A 4IKUA 4S01A 4U6EA 4ZNGA 5CE6A 1JAWA 2B3KA 4U76A 2B3HA 1W2MA 2BHDA 3PKAA 4IKRA 3TAVA 4U71A 3TB5A 2GG2A 1WL9A 4Z7MA 1PV9A 4RZYA 3MX6A 2GGCA 3CB6A 4MATA 3IG4A 5E5BA 4FLIA 4U69A 1C24A 4FLLA
chains in the Genus database with same CATH superfamily
2NQ6A 1XGMA 1M35A 1R58A 4FLJA 5CLSA 3IU7A 5CIKA 1C21A 4IECA 4IPAA 2BWWA 2EVOA 2IW2A 2GG3A 3PKEA 1YW9A 2BN7A 2DFIA 5JI6A 3MATA 4FLKA 2ADUA 2P98A 4U73A 2GG7A 1WKMA 4FO7A 4U6ZA 1O0XA 5FCHA 5CDLA 2GU7A 3D27A 1KQ9A 3RORA 1YVMA 1KP0A 2Q96A 2EVCA 2OKNA 5CNXA 5D6FA 1XGSA 4QR8A 2EVMA 4PV4A 5JFRA 4JUQA 1YW8A 3IU9A 4B28A 5JHUA 4U1BA 5CDVA 2BHCA 1XGNA 1BOAA 3MR1A 1WLRA 1C22A 2V3ZA 2B3LA 2GG8A 5CDEA 2Q8KA 1C27A 2MATA 4IF7A 3IU8A 1MATA 4A6VA 4IDYA 4PNCA 1CHMA 3FMRA 1BN5A 1QZYA 2BHAA 3PKCA 3PKBA 1A16A 3BIQA 4U6CA 2Q93A 1YJ3A 2GG9A 4U75A 4IKTA 2NQ7A 4S2TP 1XNZA 1WL6A 1KQ0A 3CTZA 2BWVA 1QXZA 4KM3A 3BIPA 4FO8A 1W7VA 3S6BA 2BH3A 2BWTA 2EA4A 2OAZA 2BB7A 1QXYA 4IKSA 4RGZ1 4OOKA 2P9AA 1QXWA 4S00A 3FMQA 4FKCA 4RZZA 5D6EA 1YW7A 2P99A 2Q95A 3PKDA 1XGOA 4ZWOA 4U70A 1WY2A 1R5GA 2GU6A 4A6WA 3RVAA 2BWYA 2GG0A 2Q94A 2V3XA 2GG5A 2GU5A 2BWXA 1B59A 2GGBA 4S2RP 3FM3A 3L24A 3BITA 2V3YA 3Q6DA 2BWSA 4EGEA 2HOWA 5FCFA 1Y1NA 2BWUA 1R5HA 1WBQA 4ZWPA 2ZSGA 2EA2A 4HXXA 2GTXA 4ZWUA 2Q92A 3L7GA 4FUKA 2GA2A 4IU6A 4U6WA 2V6CA 4R60A 4U6JA 2BHBA 2G6PA 2GU4A 1C23A 1N51A 1WN1A 1B6AA 3CB5A 2GZ5A 4IKUA 4S01A 4U6EA 4ZNGA 5CE6A 1JAWA 2B3KA 4U76A 2B3HA 1W2MA 2BHDA 3PKAA 4IKRA 3TAVA 4U71A 3TB5A 2GG2A 1WL9A 4Z7MA 1PV9A 4RZYA 3MX6A 2GGCA 3CB6A 4MATA 3IG4A 5E5BA 4FLIA 4U69A 1C24A 4FLLA
chains in the Genus database with same CATH topology
2NQ6A 1XGMA 1M35A 1R58A 4FLJA 5CLSA 3IU7A 5CIKA 1C21A 4IECA 4IPAA 2BWWA 2EVOA 2IW2A 2GG3A 3PKEA 1YW9A 2BN7A 2DFIA 5JI6A 3MATA 4FLKA 2ADUA 2P98A 4U73A 2GG7A 1WKMA 4FO7A 4U6ZA 1O0XA 5FCHA 5CDLA 2GU7A 3D27A 1KQ9A 3RORA 1YVMA 1KP0A 2Q96A 2EVCA 2OKNA 5CNXA 5D6FA 1XGSA 4QR8A 2EVMA 4PV4A 5JFRA 4JUQA 1YW8A 3IU9A 4B28A 5JHUA 4U1BA 5CDVA 2BHCA 1XGNA 1BOAA 3MR1A 1WLRA 1C22A 2V3ZA 2B3LA 2GG8A 5CDEA 2Q8KA 1C27A 2MATA 4IF7A 3IU8A 1MATA 4A6VA 4IDYA 4PNCA 1CHMA 3FMRA 1BN5A 1QZYA 2BHAA 3PKCA 3PKBA 1A16A 3BIQA 4U6CA 2Q93A 1YJ3A 2GG9A 4U75A 4IKTA 2NQ7A 4S2TP 1XNZA 1WL6A 1KQ0A 3CTZA 2BWVA 1QXZA 4KM3A 3BIPA 4FO8A 1W7VA 3S6BA 2BH3A 2BWTA 2EA4A 2OAZA 2BB7A 1QXYA 4IKSA 4RGZ1 4OOKA 2P9AA 1QXWA 4S00A 3FMQA 4FKCA 4RZZA 5D6EA 1YW7A 2P99A 2Q95A 3PKDA 1XGOA 4ZWOA 4U70A 1WY2A 1R5GA 2GU6A 4A6WA 3RVAA 2BWYA 2GG0A 2Q94A 2V3XA 2GG5A 2GU5A 2BWXA 1B59A 2GGBA 4S2RP 3FM3A 3L24A 3BITA 2V3YA 3Q6DA 2BWSA 4EGEA 2HOWA 5FCFA 1Y1NA 2BWUA 1R5HA 1WBQA 4ZWPA 2ZSGA 2EA2A 4HXXA 2GTXA 4ZWUA 2Q92A 3L7GA 4FUKA 2GA2A 4IU6A 4U6WA 2V6CA 4R60A 4U6JA 2BHBA 2G6PA 2GU4A 1C23A 1N51A 1WN1A 1B6AA 3CB5A 2GZ5A 4IKUA 4S01A 4U6EA 4ZNGA 5CE6A 1JAWA 2B3KA 4U76A 2B3HA 1W2MA 2BHDA 3PKAA 4IKRA 3TAVA 4U71A 3TB5A 2GG2A 1WL9A 4Z7MA 1PV9A 4RZYA 3MX6A 2GGCA 3CB6A 4MATA 3IG4A 5E5BA 4FLIA 4U69A 1C24A 4FLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQ6 A;  1XGM A;  1M35 A;  1R58 A;  4FLJ A;  5CLS A;  3IU7 A;  5CIK A;  1C21 A;  4IEC A;  4IPA A;  2BWW A;  2EVO A;  2IW2 A;  2GG3 A;  3PKE A;  1YW9 A;  2BN7 A;  2DFI A;  5JI6 A;  3MAT A;  4FLK A;  2ADU A;  2P98 A;  4U73 A;  2GG7 A;  1WKM A;  4FO7 A;  4U6Z A;  1O0X A;  5FCH A;  5CDL A;  2GU7 A;  3D27 A;  1KQ9 A;  3ROR A;  1YVM A;  1KP0 A;  2Q96 A;  2EVC A;  2OKN A;  5CNX A;  5D6F A;  1XGS A;  4QR8 A;  2EVM A;  4PV4 A;  5JFR A;  4JUQ A;  1YW8 A;  3IU9 A;  4B28 A;  5JHU A;  4U1B A;  5CDV A;  2BHC A;  1XGN A;  1BOA A;  3MR1 A;  1WLR A;  1C22 A;  2V3Z A;  2B3L A;  2GG8 A;  5CDE A;  2Q8K A;  1C27 A;  2MAT A;  4IF7 A;  3IU8 A;  1MAT A;  4A6V A;  4IDY A;  4PNC A;  1CHM A;  3FMR A;  1BN5 A;  1QZY A;  2BHA A;  3PKC A;  3PKB A;  1A16 A;  3BIQ A;  4U6C A;  2Q93 A;  1YJ3 A;  2GG9 A;  4U75 A;  4IKT A;  2NQ7 A;  4S2T P;  1XNZ A;  1WL6 A;  1KQ0 A;  3CTZ A;  2BWV A;  1QXZ A;  4KM3 A;  3BIP A;  4FO8 A;  1W7V A;  3S6B A;  2BH3 A;  2BWT A;  2EA4 A;  2OAZ A;  2BB7 A;  1QXY A;  4IKS A;  4RGZ 1;  4OOK A;  2P9A A;  1QXW A;  4S00 A;  3FMQ A;  4FKC A;  4RZZ A;  5D6E A;  1YW7 A;  2P99 A;  2Q95 A;  3PKD A;  1XGO A;  4ZWO A;  4U70 A;  1WY2 A;  1R5G A;  2GU6 A;  4A6W A;  3RVA A;  2BWY A;  2GG0 A;  2Q94 A;  2V3X A;  2GG5 A;  2GU5 A;  2BWX A;  1B59 A;  2GGB A;  4S2R P;  3FM3 A;  3L24 A;  3BIT A;  2V3Y A;  3Q6D A;  2BWS A;  4EGE A;  2HOW A;  5FCF A;  1Y1N A;  2BWU A;  1R5H A;  1WBQ A;  4ZWP A;  2ZSG A;  2EA2 A;  4HXX A;  2GTX A;  4ZWU A;  2Q92 A;  3L7G A;  4FUK A;  2GA2 A;  4IU6 A;  4U6W A;  2V6C A;  4R60 A;  4U6J A;  2BHB A;  2G6P A;  2GU4 A;  1C23 A;  1N51 A;  1WN1 A;  1B6A A;  3CB5 A;  2GZ5 A;  4IKU A;  4S01 A;  4U6E A;  4ZNG A;  5CE6 A;  1JAW A;  2B3K A;  4U76 A;  2B3H A;  1W2M A;  2BHD A;  3PKA A;  4IKR A;  3TAV A;  4U71 A;  3TB5 A;  2GG2 A;  1WL9 A;  4Z7M A;  1PV9 A;  4RZY A;  3MX6 A;  2GGC A;  3CB6 A;  4MAT A;  3IG4 A;  5E5B A;  4FLI A;  4U69 A;  1C24 A;  4FLL A; 
#chains in the Genus database with same CATH topology
 2NQ6 A;  1XGM A;  1M35 A;  1R58 A;  4FLJ A;  5CLS A;  3IU7 A;  5CIK A;  1C21 A;  4IEC A;  4IPA A;  2BWW A;  2EVO A;  2IW2 A;  2GG3 A;  3PKE A;  1YW9 A;  2BN7 A;  2DFI A;  5JI6 A;  3MAT A;  4FLK A;  2ADU A;  2P98 A;  4U73 A;  2GG7 A;  1WKM A;  4FO7 A;  4U6Z A;  1O0X A;  5FCH A;  5CDL A;  2GU7 A;  3D27 A;  1KQ9 A;  3ROR A;  1YVM A;  1KP0 A;  2Q96 A;  2EVC A;  2OKN A;  5CNX A;  5D6F A;  1XGS A;  4QR8 A;  2EVM A;  4PV4 A;  5JFR A;  4JUQ A;  1YW8 A;  3IU9 A;  4B28 A;  5JHU A;  4U1B A;  5CDV A;  2BHC A;  1XGN A;  1BOA A;  3MR1 A;  1WLR A;  1C22 A;  2V3Z A;  2B3L A;  2GG8 A;  5CDE A;  2Q8K A;  1C27 A;  2MAT A;  4IF7 A;  3IU8 A;  1MAT A;  4A6V A;  4IDY A;  4PNC A;  1CHM A;  3FMR A;  1BN5 A;  1QZY A;  2BHA A;  3PKC A;  3PKB A;  1A16 A;  3BIQ A;  4U6C A;  2Q93 A;  1YJ3 A;  2GG9 A;  4U75 A;  4IKT A;  2NQ7 A;  4S2T P;  1XNZ A;  1WL6 A;  1KQ0 A;  3CTZ A;  2BWV A;  1QXZ A;  4KM3 A;  3BIP A;  4FO8 A;  1W7V A;  3S6B A;  2BH3 A;  2BWT A;  2EA4 A;  2OAZ A;  2BB7 A;  1QXY A;  4IKS A;  4RGZ 1;  4OOK A;  2P9A A;  1QXW A;  4S00 A;  3FMQ A;  4FKC A;  4RZZ A;  5D6E A;  1YW7 A;  2P99 A;  2Q95 A;  3PKD A;  1XGO A;  4ZWO A;  4U70 A;  1WY2 A;  1R5G A;  2GU6 A;  4A6W A;  3RVA A;  2BWY A;  2GG0 A;  2Q94 A;  2V3X A;  2GG5 A;  2GU5 A;  2BWX A;  1B59 A;  2GGB A;  4S2R P;  3FM3 A;  3L24 A;  3BIT A;  2V3Y A;  3Q6D A;  2BWS A;  4EGE A;  2HOW A;  5FCF A;  1Y1N A;  2BWU A;  1R5H A;  1WBQ A;  4ZWP A;  2ZSG A;  2EA2 A;  4HXX A;  2GTX A;  4ZWU A;  2Q92 A;  3L7G A;  4FUK A;  2GA2 A;  4IU6 A;  4U6W A;  2V6C A;  4R60 A;  4U6J A;  2BHB A;  2G6P A;  2GU4 A;  1C23 A;  1N51 A;  1WN1 A;  1B6A A;  3CB5 A;  2GZ5 A;  4IKU A;  4S01 A;  4U6E A;  4ZNG A;  5CE6 A;  1JAW A;  2B3K A;  4U76 A;  2B3H A;  1W2M A;  2BHD A;  3PKA A;  4IKR A;  3TAV A;  4U71 A;  3TB5 A;  2GG2 A;  1WL9 A;  4Z7M A;  1PV9 A;  4RZY A;  3MX6 A;  2GGC A;  3CB6 A;  4MAT A;  3IG4 A;  5E5B A;  4FLI A;  4U69 A;  1C24 A;  4FLL A; 
#chains in the Genus database with same CATH homology
 2NQ6 A;  1XGM A;  1M35 A;  1R58 A;  4FLJ A;  5CLS A;  3IU7 A;  5CIK A;  1C21 A;  4IEC A;  4IPA A;  2BWW A;  2EVO A;  2IW2 A;  2GG3 A;  3PKE A;  1YW9 A;  2BN7 A;  2DFI A;  5JI6 A;  3MAT A;  4FLK A;  2ADU A;  2P98 A;  4U73 A;  2GG7 A;  1WKM A;  4FO7 A;  4U6Z A;  1O0X A;  5FCH A;  5CDL A;  2GU7 A;  3D27 A;  1KQ9 A;  3ROR A;  1YVM A;  1KP0 A;  2Q96 A;  2EVC A;  2OKN A;  5CNX A;  5D6F A;  1XGS A;  4QR8 A;  2EVM A;  4PV4 A;  5JFR A;  4JUQ A;  1YW8 A;  3IU9 A;  4B28 A;  5JHU A;  4U1B A;  5CDV A;  2BHC A;  1XGN A;  1BOA A;  3MR1 A;  1WLR A;  1C22 A;  2V3Z A;  2B3L A;  2GG8 A;  5CDE A;  2Q8K A;  1C27 A;  2MAT A;  4IF7 A;  3IU8 A;  1MAT A;  4A6V A;  4IDY A;  4PNC A;  1CHM A;  3FMR A;  1BN5 A;  1QZY A;  2BHA A;  3PKC A;  3PKB A;  1A16 A;  3BIQ A;  4U6C A;  2Q93 A;  1YJ3 A;  2GG9 A;  4U75 A;  4IKT A;  2NQ7 A;  4S2T P;  1XNZ A;  1WL6 A;  1KQ0 A;  3CTZ A;  2BWV A;  1QXZ A;  4KM3 A;  3BIP A;  4FO8 A;  1W7V A;  3S6B A;  2BH3 A;  2BWT A;  2EA4 A;  2OAZ A;  2BB7 A;  1QXY A;  4IKS A;  4RGZ 1;  4OOK A;  2P9A A;  1QXW A;  4S00 A;  3FMQ A;  4FKC A;  4RZZ A;  5D6E A;  1YW7 A;  2P99 A;  2Q95 A;  3PKD A;  1XGO A;  4ZWO A;  4U70 A;  1WY2 A;  1R5G A;  2GU6 A;  4A6W A;  3RVA A;  2BWY A;  2GG0 A;  2Q94 A;  2V3X A;  2GG5 A;  2GU5 A;  2BWX A;  1B59 A;  2GGB A;  4S2R P;  3FM3 A;  3L24 A;  3BIT A;  2V3Y A;  3Q6D A;  2BWS A;  4EGE A;  2HOW A;  5FCF A;  1Y1N A;  2BWU A;  1R5H A;  1WBQ A;  4ZWP A;  2ZSG A;  2EA2 A;  4HXX A;  2GTX A;  4ZWU A;  2Q92 A;  3L7G A;  4FUK A;  2GA2 A;  4IU6 A;  4U6W A;  2V6C A;  4R60 A;  4U6J A;  2BHB A;  2G6P A;  2GU4 A;  1C23 A;  1N51 A;  1WN1 A;  1B6A A;  3CB5 A;  2GZ5 A;  4IKU A;  4S01 A;  4U6E A;  4ZNG A;  5CE6 A;  1JAW A;  2B3K A;  4U76 A;  2B3H A;  1W2M A;  2BHD A;  3PKA A;  4IKR A;  3TAV A;  4U71 A;  3TB5 A;  2GG2 A;  1WL9 A;  4Z7M A;  1PV9 A;  4RZY A;  3MX6 A;  2GGC A;  3CB6 A;  4MAT A;  3IG4 A;  5E5B A;  4FLI A;  4U69 A;  1C24 A;  4FLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...