2Q96A

E. coli methionine aminopeptidase mn-form with inhibitor a18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 82
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q96A00
1R58A 1YJ3A 4U75A 1C21A 1BOAA 1N51A 1WLRA 2BWXA 2P9AA 5CE6A 2BWUA 4IKRA 1KQ9A 4U76A 5CNXA 2ZSGA 2Q92A 4IKUA 2B3HA 2EA2A 1C27A 1WL9A 2BB7A 2BHDA 4R60A 2GZ5A 1XGMA 2DFIA 2BH3A 2ADUA 3CB5A 2BHAA 2V3XA 5D6EA 2GU4A 2GG8A 2GU6A 4IKTA 3IU9A 1QZYA 5CDLA 4IECA 2B3LA 4RZYA 2P98A 3FM3A 4Z7MA 1M35A 3MATA 2GTXA 1YW9A 1A16A 3RORA 1XNZA 2P99A 3D27A 4U6EA 4U6JA 1YVMA 3CTZA 4ZWUA 4RZZA 1KQ0A 3RVAA 1W2MA 1W7VA 3PKBA 5CDVA 1WL6A 4S2TP 4IF7A 4PNCA 4FLKA 5CDEA 4QR8A 4U73A 5FCHA 3PKEA 4B28A 4FO8A 1O0XA 2V3ZA 3IU8A 2EVCA 4IDYA 2OKNA 4ZNGA 4S2RP 1XGOA 2NQ6A 4ZWPA 3PKDA 3PKCA 2GG3A 1YW8A 1WY2A 2BWTA 3BITA 2BHCA 1Y1NA 2BWVA 4U6CA 4A6WA 2GU5A 4OOKA 5FCFA 2GU7A 2GG9A 2Q94A 5JFRA 4U6ZA 3L24A 4JUQA 5JI6A 1MATA 2BWYA 3BIQA 1R5HA 4KM3A 4A6VA 5E5BA 1CHMA 4FKCA 2EVMA 3IG4A 1C24A 2Q93A 1JAWA 4FLLA 1WBQA 3TAVA 4RGZ1 1B6AA 1WN1A 2GG7A 2NQ7A 2V6CA 1XGSA 3FMQA 1WKMA 4FLJA 1B59A 2GA2A 3TB5A 1KP0A 1PV9A 2Q95A 4S01A 2MATA 1QXWA 4HXXA 2GG5A 2BN7A 3MR1A 4U71A 2GGBA 2BWSA 3MX6A 3BIPA 2BWWA 4U69A 4IKSA 2HOWA 1BN5A 4PV4A 1XGNA 2Q96A 4IPAA 2GGCA 5JHUA 2Q8KA 2B3KA 4IU6A 4FLIA 4EGEA 1C23A 1QXZA 3FMRA 3S6BA 2EA4A 5D6FA 2EVOA 2V3YA 4ZWOA 4FO7A 1R5GA 3CB6A 3PKAA 2BHBA 4U1BA 1C22A 3L7GA 4MATA 1YW7A 4U70A 3IU7A 5CLSA 4S00A 2OAZA 2G6PA 1QXYA 2GG0A 2IW2A 4U6WA 5CIKA 4FUKA 2GG2A 3Q6DA
chains in the Genus database with same CATH superfamily
1R58A 1YJ3A 4U75A 1C21A 1BOAA 1N51A 1WLRA 2BWXA 2P9AA 5CE6A 2BWUA 4IKRA 1KQ9A 4U76A 5CNXA 2ZSGA 2Q92A 4IKUA 2B3HA 2EA2A 1C27A 1WL9A 2BB7A 2BHDA 4R60A 2GZ5A 1XGMA 2DFIA 2BH3A 2ADUA 3CB5A 2BHAA 2V3XA 5D6EA 2GU4A 2GG8A 2GU6A 4IKTA 3IU9A 1QZYA 5CDLA 4IECA 2B3LA 4RZYA 2P98A 3FM3A 4Z7MA 1M35A 3MATA 2GTXA 1YW9A 1A16A 3RORA 1XNZA 2P99A 3D27A 4U6EA 4U6JA 1YVMA 3CTZA 4ZWUA 4RZZA 1KQ0A 3RVAA 1W2MA 1W7VA 3PKBA 5CDVA 1WL6A 4S2TP 4IF7A 4PNCA 4FLKA 5CDEA 4QR8A 4U73A 5FCHA 3PKEA 4B28A 4FO8A 1O0XA 2V3ZA 3IU8A 2EVCA 4IDYA 2OKNA 4ZNGA 4S2RP 1XGOA 2NQ6A 4ZWPA 3PKDA 3PKCA 2GG3A 1YW8A 1WY2A 2BWTA 3BITA 2BHCA 1Y1NA 2BWVA 4U6CA 4A6WA 2GU5A 4OOKA 5FCFA 2GU7A 2GG9A 2Q94A 5JFRA 4U6ZA 3L24A 4JUQA 5JI6A 1MATA 2BWYA 3BIQA 1R5HA 4KM3A 4A6VA 5E5BA 1CHMA 4FKCA 2EVMA 3IG4A 1C24A 2Q93A 1JAWA 4FLLA 1WBQA 3TAVA 4RGZ1 1B6AA 1WN1A 2GG7A 2NQ7A 2V6CA 1XGSA 3FMQA 1WKMA 4FLJA 1B59A 2GA2A 3TB5A 1KP0A 1PV9A 2Q95A 4S01A 2MATA 1QXWA 4HXXA 2GG5A 2BN7A 3MR1A 4U71A 2GGBA 2BWSA 3MX6A 3BIPA 2BWWA 4U69A 4IKSA 2HOWA 1BN5A 4PV4A 1XGNA 2Q96A 4IPAA 2GGCA 5JHUA 2Q8KA 2B3KA 4IU6A 4FLIA 4EGEA 1C23A 1QXZA 3FMRA 3S6BA 2EA4A 5D6FA 2EVOA 2V3YA 4ZWOA 4FO7A 1R5GA 3CB6A 3PKAA 2BHBA 4U1BA 1C22A 3L7GA 4MATA 1YW7A 4U70A 3IU7A 5CLSA 4S00A 2OAZA 2G6PA 1QXYA 2GG0A 2IW2A 4U6WA 5CIKA 4FUKA 2GG2A 3Q6DA
chains in the Genus database with same CATH topology
1R58A 1YJ3A 4U75A 1C21A 1BOAA 1N51A 1WLRA 2BWXA 2P9AA 5CE6A 2BWUA 4IKRA 1KQ9A 4U76A 5CNXA 2ZSGA 2Q92A 4IKUA 2B3HA 2EA2A 1C27A 1WL9A 2BB7A 2BHDA 4R60A 2GZ5A 1XGMA 2DFIA 2BH3A 2ADUA 3CB5A 2BHAA 2V3XA 5D6EA 2GU4A 2GG8A 2GU6A 4IKTA 3IU9A 1QZYA 5CDLA 4IECA 2B3LA 4RZYA 2P98A 3FM3A 4Z7MA 1M35A 3MATA 2GTXA 1YW9A 1A16A 3RORA 1XNZA 2P99A 3D27A 4U6EA 4U6JA 1YVMA 3CTZA 4ZWUA 4RZZA 1KQ0A 3RVAA 1W2MA 1W7VA 3PKBA 5CDVA 1WL6A 4S2TP 4IF7A 4PNCA 4FLKA 5CDEA 4QR8A 4U73A 5FCHA 3PKEA 4B28A 4FO8A 1O0XA 2V3ZA 3IU8A 2EVCA 4IDYA 2OKNA 4ZNGA 4S2RP 1XGOA 2NQ6A 4ZWPA 3PKDA 3PKCA 2GG3A 1YW8A 1WY2A 2BWTA 3BITA 2BHCA 1Y1NA 2BWVA 4U6CA 4A6WA 2GU5A 4OOKA 5FCFA 2GU7A 2GG9A 2Q94A 5JFRA 4U6ZA 3L24A 4JUQA 5JI6A 1MATA 2BWYA 3BIQA 1R5HA 4KM3A 4A6VA 5E5BA 1CHMA 4FKCA 2EVMA 3IG4A 1C24A 2Q93A 1JAWA 4FLLA 1WBQA 3TAVA 4RGZ1 1B6AA 1WN1A 2GG7A 2NQ7A 2V6CA 1XGSA 3FMQA 1WKMA 4FLJA 1B59A 2GA2A 3TB5A 1KP0A 1PV9A 2Q95A 4S01A 2MATA 1QXWA 4HXXA 2GG5A 2BN7A 3MR1A 4U71A 2GGBA 2BWSA 3MX6A 3BIPA 2BWWA 4U69A 4IKSA 2HOWA 1BN5A 4PV4A 1XGNA 2Q96A 4IPAA 2GGCA 5JHUA 2Q8KA 2B3KA 4IU6A 4FLIA 4EGEA 1C23A 1QXZA 3FMRA 3S6BA 2EA4A 5D6FA 2EVOA 2V3YA 4ZWOA 4FO7A 1R5GA 3CB6A 3PKAA 2BHBA 4U1BA 1C22A 3L7GA 4MATA 1YW7A 4U70A 3IU7A 5CLSA 4S00A 2OAZA 2G6PA 1QXYA 2GG0A 2IW2A 4U6WA 5CIKA 4FUKA 2GG2A 3Q6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R58 A;  1YJ3 A;  4U75 A;  1C21 A;  1BOA A;  1N51 A;  1WLR A;  2BWX A;  2P9A A;  5CE6 A;  2BWU A;  4IKR A;  1KQ9 A;  4U76 A;  5CNX A;  2ZSG A;  2Q92 A;  4IKU A;  2B3H A;  2EA2 A;  1C27 A;  1WL9 A;  2BB7 A;  2BHD A;  4R60 A;  2GZ5 A;  1XGM A;  2DFI A;  2BH3 A;  2ADU A;  3CB5 A;  2BHA A;  2V3X A;  5D6E A;  2GU4 A;  2GG8 A;  2GU6 A;  4IKT A;  3IU9 A;  1QZY A;  5CDL A;  4IEC A;  2B3L A;  4RZY A;  2P98 A;  3FM3 A;  4Z7M A;  1M35 A;  3MAT A;  2GTX A;  1YW9 A;  1A16 A;  3ROR A;  1XNZ A;  2P99 A;  3D27 A;  4U6E A;  4U6J A;  1YVM A;  3CTZ A;  4ZWU A;  4RZZ A;  1KQ0 A;  3RVA A;  1W2M A;  1W7V A;  3PKB A;  5CDV A;  1WL6 A;  4S2T P;  4IF7 A;  4PNC A;  4FLK A;  5CDE A;  4QR8 A;  4U73 A;  5FCH A;  3PKE A;  4B28 A;  4FO8 A;  1O0X A;  2V3Z A;  3IU8 A;  2EVC A;  4IDY A;  2OKN A;  4ZNG A;  4S2R P;  1XGO A;  2NQ6 A;  4ZWP A;  3PKD A;  3PKC A;  2GG3 A;  1YW8 A;  1WY2 A;  2BWT A;  3BIT A;  2BHC A;  1Y1N A;  2BWV A;  4U6C A;  4A6W A;  2GU5 A;  4OOK A;  5FCF A;  2GU7 A;  2GG9 A;  2Q94 A;  5JFR A;  4U6Z A;  3L24 A;  4JUQ A;  5JI6 A;  1MAT A;  2BWY A;  3BIQ A;  1R5H A;  4KM3 A;  4A6V A;  5E5B A;  1CHM A;  4FKC A;  2EVM A;  3IG4 A;  1C24 A;  2Q93 A;  1JAW A;  4FLL A;  1WBQ A;  3TAV A;  4RGZ 1;  1B6A A;  1WN1 A;  2GG7 A;  2NQ7 A;  2V6C A;  1XGS A;  3FMQ A;  1WKM A;  4FLJ A;  1B59 A;  2GA2 A;  3TB5 A;  1KP0 A;  1PV9 A;  2Q95 A;  4S01 A;  2MAT A;  1QXW A;  4HXX A;  2GG5 A;  2BN7 A;  3MR1 A;  4U71 A;  2GGB A;  2BWS A;  3MX6 A;  3BIP A;  2BWW A;  4U69 A;  4IKS A;  2HOW A;  1BN5 A;  4PV4 A;  1XGN A;  2Q96 A;  4IPA A;  2GGC A;  5JHU A;  2Q8K A;  2B3K A;  4IU6 A;  4FLI A;  4EGE A;  1C23 A;  1QXZ A;  3FMR A;  3S6B A;  2EA4 A;  5D6F A;  2EVO A;  2V3Y A;  4ZWO A;  4FO7 A;  1R5G A;  3CB6 A;  3PKA A;  2BHB A;  4U1B A;  1C22 A;  3L7G A;  4MAT A;  1YW7 A;  4U70 A;  3IU7 A;  5CLS A;  4S00 A;  2OAZ A;  2G6P A;  1QXY A;  2GG0 A;  2IW2 A;  4U6W A;  5CIK A;  4FUK A;  2GG2 A;  3Q6D A; 
#chains in the Genus database with same CATH topology
 1R58 A;  1YJ3 A;  4U75 A;  1C21 A;  1BOA A;  1N51 A;  1WLR A;  2BWX A;  2P9A A;  5CE6 A;  2BWU A;  4IKR A;  1KQ9 A;  4U76 A;  5CNX A;  2ZSG A;  2Q92 A;  4IKU A;  2B3H A;  2EA2 A;  1C27 A;  1WL9 A;  2BB7 A;  2BHD A;  4R60 A;  2GZ5 A;  1XGM A;  2DFI A;  2BH3 A;  2ADU A;  3CB5 A;  2BHA A;  2V3X A;  5D6E A;  2GU4 A;  2GG8 A;  2GU6 A;  4IKT A;  3IU9 A;  1QZY A;  5CDL A;  4IEC A;  2B3L A;  4RZY A;  2P98 A;  3FM3 A;  4Z7M A;  1M35 A;  3MAT A;  2GTX A;  1YW9 A;  1A16 A;  3ROR A;  1XNZ A;  2P99 A;  3D27 A;  4U6E A;  4U6J A;  1YVM A;  3CTZ A;  4ZWU A;  4RZZ A;  1KQ0 A;  3RVA A;  1W2M A;  1W7V A;  3PKB A;  5CDV A;  1WL6 A;  4S2T P;  4IF7 A;  4PNC A;  4FLK A;  5CDE A;  4QR8 A;  4U73 A;  5FCH A;  3PKE A;  4B28 A;  4FO8 A;  1O0X A;  2V3Z A;  3IU8 A;  2EVC A;  4IDY A;  2OKN A;  4ZNG A;  4S2R P;  1XGO A;  2NQ6 A;  4ZWP A;  3PKD A;  3PKC A;  2GG3 A;  1YW8 A;  1WY2 A;  2BWT A;  3BIT A;  2BHC A;  1Y1N A;  2BWV A;  4U6C A;  4A6W A;  2GU5 A;  4OOK A;  5FCF A;  2GU7 A;  2GG9 A;  2Q94 A;  5JFR A;  4U6Z A;  3L24 A;  4JUQ A;  5JI6 A;  1MAT A;  2BWY A;  3BIQ A;  1R5H A;  4KM3 A;  4A6V A;  5E5B A;  1CHM A;  4FKC A;  2EVM A;  3IG4 A;  1C24 A;  2Q93 A;  1JAW A;  4FLL A;  1WBQ A;  3TAV A;  4RGZ 1;  1B6A A;  1WN1 A;  2GG7 A;  2NQ7 A;  2V6C A;  1XGS A;  3FMQ A;  1WKM A;  4FLJ A;  1B59 A;  2GA2 A;  3TB5 A;  1KP0 A;  1PV9 A;  2Q95 A;  4S01 A;  2MAT A;  1QXW A;  4HXX A;  2GG5 A;  2BN7 A;  3MR1 A;  4U71 A;  2GGB A;  2BWS A;  3MX6 A;  3BIP A;  2BWW A;  4U69 A;  4IKS A;  2HOW A;  1BN5 A;  4PV4 A;  1XGN A;  2Q96 A;  4IPA A;  2GGC A;  5JHU A;  2Q8K A;  2B3K A;  4IU6 A;  4FLI A;  4EGE A;  1C23 A;  1QXZ A;  3FMR A;  3S6B A;  2EA4 A;  5D6F A;  2EVO A;  2V3Y A;  4ZWO A;  4FO7 A;  1R5G A;  3CB6 A;  3PKA A;  2BHB A;  4U1B A;  1C22 A;  3L7G A;  4MAT A;  1YW7 A;  4U70 A;  3IU7 A;  5CLS A;  4S00 A;  2OAZ A;  2G6P A;  1QXY A;  2GG0 A;  2IW2 A;  4U6W A;  5CIK A;  4FUK A;  2GG2 A;  3Q6D A; 
#chains in the Genus database with same CATH homology
 1R58 A;  1YJ3 A;  4U75 A;  1C21 A;  1BOA A;  1N51 A;  1WLR A;  2BWX A;  2P9A A;  5CE6 A;  2BWU A;  4IKR A;  1KQ9 A;  4U76 A;  5CNX A;  2ZSG A;  2Q92 A;  4IKU A;  2B3H A;  2EA2 A;  1C27 A;  1WL9 A;  2BB7 A;  2BHD A;  4R60 A;  2GZ5 A;  1XGM A;  2DFI A;  2BH3 A;  2ADU A;  3CB5 A;  2BHA A;  2V3X A;  5D6E A;  2GU4 A;  2GG8 A;  2GU6 A;  4IKT A;  3IU9 A;  1QZY A;  5CDL A;  4IEC A;  2B3L A;  4RZY A;  2P98 A;  3FM3 A;  4Z7M A;  1M35 A;  3MAT A;  2GTX A;  1YW9 A;  1A16 A;  3ROR A;  1XNZ A;  2P99 A;  3D27 A;  4U6E A;  4U6J A;  1YVM A;  3CTZ A;  4ZWU A;  4RZZ A;  1KQ0 A;  3RVA A;  1W2M A;  1W7V A;  3PKB A;  5CDV A;  1WL6 A;  4S2T P;  4IF7 A;  4PNC A;  4FLK A;  5CDE A;  4QR8 A;  4U73 A;  5FCH A;  3PKE A;  4B28 A;  4FO8 A;  1O0X A;  2V3Z A;  3IU8 A;  2EVC A;  4IDY A;  2OKN A;  4ZNG A;  4S2R P;  1XGO A;  2NQ6 A;  4ZWP A;  3PKD A;  3PKC A;  2GG3 A;  1YW8 A;  1WY2 A;  2BWT A;  3BIT A;  2BHC A;  1Y1N A;  2BWV A;  4U6C A;  4A6W A;  2GU5 A;  4OOK A;  5FCF A;  2GU7 A;  2GG9 A;  2Q94 A;  5JFR A;  4U6Z A;  3L24 A;  4JUQ A;  5JI6 A;  1MAT A;  2BWY A;  3BIQ A;  1R5H A;  4KM3 A;  4A6V A;  5E5B A;  1CHM A;  4FKC A;  2EVM A;  3IG4 A;  1C24 A;  2Q93 A;  1JAW A;  4FLL A;  1WBQ A;  3TAV A;  4RGZ 1;  1B6A A;  1WN1 A;  2GG7 A;  2NQ7 A;  2V6C A;  1XGS A;  3FMQ A;  1WKM A;  4FLJ A;  1B59 A;  2GA2 A;  3TB5 A;  1KP0 A;  1PV9 A;  2Q95 A;  4S01 A;  2MAT A;  1QXW A;  4HXX A;  2GG5 A;  2BN7 A;  3MR1 A;  4U71 A;  2GGB A;  2BWS A;  3MX6 A;  3BIP A;  2BWW A;  4U69 A;  4IKS A;  2HOW A;  1BN5 A;  4PV4 A;  1XGN A;  2Q96 A;  4IPA A;  2GGC A;  5JHU A;  2Q8K A;  2B3K A;  4IU6 A;  4FLI A;  4EGE A;  1C23 A;  1QXZ A;  3FMR A;  3S6B A;  2EA4 A;  5D6F A;  2EVO A;  2V3Y A;  4ZWO A;  4FO7 A;  1R5G A;  3CB6 A;  3PKA A;  2BHB A;  4U1B A;  1C22 A;  3L7G A;  4MAT A;  1YW7 A;  4U70 A;  3IU7 A;  5CLS A;  4S00 A;  2OAZ A;  2G6P A;  1QXY A;  2GG0 A;  2IW2 A;  4U6W A;  5CIK A;  4FUK A;  2GG2 A;  3Q6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...