2Q96A

E. coli methionine aminopeptidase mn-form with inhibitor a18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 82
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q96A00
1WBQA 1R5GA 2GA2A 2GU7A 3PKAA 2Q94A 3D27A 4KM3A 3IU8A 4FO8A 2G6PA 2GG8A 2EVCA 5CDEA 2BHDA 2GU5A 3FMQA 4U71A 5CIKA 4U6JA 5CE6A 2OKNA 2P9AA 4IKSA 3BITA 1YVMA 1MATA 2BHCA 2BH3A 3Q6DA 1WL6A 2MATA 2V3YA 4U6ZA 4U73A 2NQ7A 4A6WA 4IKUA 1YJ3A 2BWVA 1QXWA 1WL9A 3IG4A 2Q93A 3PKEA 1B6AA 2BWTA 5JI6A 4HXXA 1WKMA 1A16A 4U75A 3IU9A 2V3ZA 1XGSA 3TAVA 1KQ9A 2BWYA 2NQ6A 1QXYA 4U69A 4IDYA 1WLRA 4IKRA 4R60A 4U76A 1R58A 1WN1A 2BHBA 3CB5A 4ZNGA 3MR1A 5D6EA 1R5HA 2BWXA 4IU6A 1PV9A 2GG9A 3BIQA 1XGMA 4S00A 3FMRA 4FLIA 2BWWA 1KQ0A 4U70A 4FKCA 1C23A 2ZSGA 4A6VA 1CHMA 4B28A 5CLSA 2BWSA 2GGBA 2EA2A 1C24A 3FM3A 2B3HA 4S2TP 4ZWUA 3IU7A 4U6CA 1QZYA 5JFRA 1W7VA 1C27A 4FUKA 4RGZ1 2DFIA 3MATA 4OOKA 1M35A 5FCHA 5JHUA 1XGNA 1BN5A 2V6CA 3L7GA 2Q8KA 4IPAA 1Y1NA 3PKCA 1YW8A 2IW2A 1QXZA 3L24A 3PKBA 4S2RP 4FLLA 2GG5A 3MX6A 4RZZA 3RORA 4FO7A 1O0XA 5CDLA 1XGOA 2B3LA 2GU4A 4IECA 2B3KA 3TB5A 2GU6A 2Q96A 2GG0A 1KP0A 2GGCA 4QR8A 3CB6A 2EA4A 2BB7A 2P98A 4IF7A 4Z7MA 1C22A 5E5BA 2EVOA 3BIPA 4PNCA 4U1BA 5D6FA 3S6BA 2GZ5A 3PKDA 2HOWA 3RVAA 1B59A 1YW7A 2V3XA 5CNXA 4PV4A 2BN7A 4JUQA 4FLJA 4ZWPA 1BOAA 1W2MA 5CDVA 4ZWOA 2ADUA 1YW9A 2OAZA 4FLKA 2P99A 4S01A 5FCFA 1C21A 1XNZA 1WY2A 2Q95A 2EVMA 4MATA 1N51A 2BHAA 2GG2A 2BWUA 4IKTA 1JAWA 4U6WA 4U6EA 4RZYA 2GG3A 2Q92A 4EGEA 2GG7A 2GTXA 3CTZA
chains in the Genus database with same CATH superfamily
1WBQA 1R5GA 2GA2A 2GU7A 3PKAA 2Q94A 3D27A 4KM3A 3IU8A 4FO8A 2G6PA 2GG8A 2EVCA 5CDEA 2BHDA 2GU5A 3FMQA 4U71A 5CIKA 4U6JA 5CE6A 2OKNA 2P9AA 4IKSA 3BITA 1YVMA 1MATA 2BHCA 2BH3A 3Q6DA 1WL6A 2MATA 2V3YA 4U6ZA 4U73A 2NQ7A 4A6WA 4IKUA 1YJ3A 2BWVA 1QXWA 1WL9A 3IG4A 2Q93A 3PKEA 1B6AA 2BWTA 5JI6A 4HXXA 1WKMA 1A16A 4U75A 3IU9A 2V3ZA 1XGSA 3TAVA 1KQ9A 2BWYA 2NQ6A 1QXYA 4U69A 4IDYA 1WLRA 4IKRA 4R60A 4U76A 1R58A 1WN1A 2BHBA 3CB5A 4ZNGA 3MR1A 5D6EA 1R5HA 2BWXA 4IU6A 1PV9A 2GG9A 3BIQA 1XGMA 4S00A 3FMRA 4FLIA 2BWWA 1KQ0A 4U70A 4FKCA 1C23A 2ZSGA 4A6VA 1CHMA 4B28A 5CLSA 2BWSA 2GGBA 2EA2A 1C24A 3FM3A 2B3HA 4S2TP 4ZWUA 3IU7A 4U6CA 1QZYA 5JFRA 1W7VA 1C27A 4FUKA 4RGZ1 2DFIA 3MATA 4OOKA 1M35A 5FCHA 5JHUA 1XGNA 1BN5A 2V6CA 3L7GA 2Q8KA 4IPAA 1Y1NA 3PKCA 1YW8A 2IW2A 1QXZA 3L24A 3PKBA 4S2RP 4FLLA 2GG5A 3MX6A 4RZZA 3RORA 4FO7A 1O0XA 5CDLA 1XGOA 2B3LA 2GU4A 4IECA 2B3KA 3TB5A 2GU6A 2Q96A 2GG0A 1KP0A 2GGCA 4QR8A 3CB6A 2EA4A 2BB7A 2P98A 4IF7A 4Z7MA 1C22A 5E5BA 2EVOA 3BIPA 4PNCA 4U1BA 5D6FA 3S6BA 2GZ5A 3PKDA 2HOWA 3RVAA 1B59A 1YW7A 2V3XA 5CNXA 4PV4A 2BN7A 4JUQA 4FLJA 4ZWPA 1BOAA 1W2MA 5CDVA 4ZWOA 2ADUA 1YW9A 2OAZA 4FLKA 2P99A 4S01A 5FCFA 1C21A 1XNZA 1WY2A 2Q95A 2EVMA 4MATA 1N51A 2BHAA 2GG2A 2BWUA 4IKTA 1JAWA 4U6WA 4U6EA 4RZYA 2GG3A 2Q92A 4EGEA 2GG7A 2GTXA 3CTZA
chains in the Genus database with same CATH topology
1WBQA 1R5GA 2GA2A 2GU7A 3PKAA 2Q94A 3D27A 4KM3A 3IU8A 4FO8A 2G6PA 2GG8A 2EVCA 5CDEA 2BHDA 2GU5A 3FMQA 4U71A 5CIKA 4U6JA 5CE6A 2OKNA 2P9AA 4IKSA 3BITA 1YVMA 1MATA 2BHCA 2BH3A 3Q6DA 1WL6A 2MATA 2V3YA 4U6ZA 4U73A 2NQ7A 4A6WA 4IKUA 1YJ3A 2BWVA 1QXWA 1WL9A 3IG4A 2Q93A 3PKEA 1B6AA 2BWTA 5JI6A 4HXXA 1WKMA 1A16A 4U75A 3IU9A 2V3ZA 1XGSA 3TAVA 1KQ9A 2BWYA 2NQ6A 1QXYA 4U69A 4IDYA 1WLRA 4IKRA 4R60A 4U76A 1R58A 1WN1A 2BHBA 3CB5A 4ZNGA 3MR1A 5D6EA 1R5HA 2BWXA 4IU6A 1PV9A 2GG9A 3BIQA 1XGMA 4S00A 3FMRA 4FLIA 2BWWA 1KQ0A 4U70A 4FKCA 1C23A 2ZSGA 4A6VA 1CHMA 4B28A 5CLSA 2BWSA 2GGBA 2EA2A 1C24A 3FM3A 2B3HA 4S2TP 4ZWUA 3IU7A 4U6CA 1QZYA 5JFRA 1W7VA 1C27A 4FUKA 4RGZ1 2DFIA 3MATA 4OOKA 1M35A 5FCHA 5JHUA 1XGNA 1BN5A 2V6CA 3L7GA 2Q8KA 4IPAA 1Y1NA 3PKCA 1YW8A 2IW2A 1QXZA 3L24A 3PKBA 4S2RP 4FLLA 2GG5A 3MX6A 4RZZA 3RORA 4FO7A 1O0XA 5CDLA 1XGOA 2B3LA 2GU4A 4IECA 2B3KA 3TB5A 2GU6A 2Q96A 2GG0A 1KP0A 2GGCA 4QR8A 3CB6A 2EA4A 2BB7A 2P98A 4IF7A 4Z7MA 1C22A 5E5BA 2EVOA 3BIPA 4PNCA 4U1BA 5D6FA 3S6BA 2GZ5A 3PKDA 2HOWA 3RVAA 1B59A 1YW7A 2V3XA 5CNXA 4PV4A 2BN7A 4JUQA 4FLJA 4ZWPA 1BOAA 1W2MA 5CDVA 4ZWOA 2ADUA 1YW9A 2OAZA 4FLKA 2P99A 4S01A 5FCFA 1C21A 1XNZA 1WY2A 2Q95A 2EVMA 4MATA 1N51A 2BHAA 2GG2A 2BWUA 4IKTA 1JAWA 4U6WA 4U6EA 4RZYA 2GG3A 2Q92A 4EGEA 2GG7A 2GTXA 3CTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WBQ A;  1R5G A;  2GA2 A;  2GU7 A;  3PKA A;  2Q94 A;  3D27 A;  4KM3 A;  3IU8 A;  4FO8 A;  2G6P A;  2GG8 A;  2EVC A;  5CDE A;  2BHD A;  2GU5 A;  3FMQ A;  4U71 A;  5CIK A;  4U6J A;  5CE6 A;  2OKN A;  2P9A A;  4IKS A;  3BIT A;  1YVM A;  1MAT A;  2BHC A;  2BH3 A;  3Q6D A;  1WL6 A;  2MAT A;  2V3Y A;  4U6Z A;  4U73 A;  2NQ7 A;  4A6W A;  4IKU A;  1YJ3 A;  2BWV A;  1QXW A;  1WL9 A;  3IG4 A;  2Q93 A;  3PKE A;  1B6A A;  2BWT A;  5JI6 A;  4HXX A;  1WKM A;  1A16 A;  4U75 A;  3IU9 A;  2V3Z A;  1XGS A;  3TAV A;  1KQ9 A;  2BWY A;  2NQ6 A;  1QXY A;  4U69 A;  4IDY A;  1WLR A;  4IKR A;  4R60 A;  4U76 A;  1R58 A;  1WN1 A;  2BHB A;  3CB5 A;  4ZNG A;  3MR1 A;  5D6E A;  1R5H A;  2BWX A;  4IU6 A;  1PV9 A;  2GG9 A;  3BIQ A;  1XGM A;  4S00 A;  3FMR A;  4FLI A;  2BWW A;  1KQ0 A;  4U70 A;  4FKC A;  1C23 A;  2ZSG A;  4A6V A;  1CHM A;  4B28 A;  5CLS A;  2BWS A;  2GGB A;  2EA2 A;  1C24 A;  3FM3 A;  2B3H A;  4S2T P;  4ZWU A;  3IU7 A;  4U6C A;  1QZY A;  5JFR A;  1W7V A;  1C27 A;  4FUK A;  4RGZ 1;  2DFI A;  3MAT A;  4OOK A;  1M35 A;  5FCH A;  5JHU A;  1XGN A;  1BN5 A;  2V6C A;  3L7G A;  2Q8K A;  4IPA A;  1Y1N A;  3PKC A;  1YW8 A;  2IW2 A;  1QXZ A;  3L24 A;  3PKB A;  4S2R P;  4FLL A;  2GG5 A;  3MX6 A;  4RZZ A;  3ROR A;  4FO7 A;  1O0X A;  5CDL A;  1XGO A;  2B3L A;  2GU4 A;  4IEC A;  2B3K A;  3TB5 A;  2GU6 A;  2Q96 A;  2GG0 A;  1KP0 A;  2GGC A;  4QR8 A;  3CB6 A;  2EA4 A;  2BB7 A;  2P98 A;  4IF7 A;  4Z7M A;  1C22 A;  5E5B A;  2EVO A;  3BIP A;  4PNC A;  4U1B A;  5D6F A;  3S6B A;  2GZ5 A;  3PKD A;  2HOW A;  3RVA A;  1B59 A;  1YW7 A;  2V3X A;  5CNX A;  4PV4 A;  2BN7 A;  4JUQ A;  4FLJ A;  4ZWP A;  1BOA A;  1W2M A;  5CDV A;  4ZWO A;  2ADU A;  1YW9 A;  2OAZ A;  4FLK A;  2P99 A;  4S01 A;  5FCF A;  1C21 A;  1XNZ A;  1WY2 A;  2Q95 A;  2EVM A;  4MAT A;  1N51 A;  2BHA A;  2GG2 A;  2BWU A;  4IKT A;  1JAW A;  4U6W A;  4U6E A;  4RZY A;  2GG3 A;  2Q92 A;  4EGE A;  2GG7 A;  2GTX A;  3CTZ A; 
#chains in the Genus database with same CATH topology
 1WBQ A;  1R5G A;  2GA2 A;  2GU7 A;  3PKA A;  2Q94 A;  3D27 A;  4KM3 A;  3IU8 A;  4FO8 A;  2G6P A;  2GG8 A;  2EVC A;  5CDE A;  2BHD A;  2GU5 A;  3FMQ A;  4U71 A;  5CIK A;  4U6J A;  5CE6 A;  2OKN A;  2P9A A;  4IKS A;  3BIT A;  1YVM A;  1MAT A;  2BHC A;  2BH3 A;  3Q6D A;  1WL6 A;  2MAT A;  2V3Y A;  4U6Z A;  4U73 A;  2NQ7 A;  4A6W A;  4IKU A;  1YJ3 A;  2BWV A;  1QXW A;  1WL9 A;  3IG4 A;  2Q93 A;  3PKE A;  1B6A A;  2BWT A;  5JI6 A;  4HXX A;  1WKM A;  1A16 A;  4U75 A;  3IU9 A;  2V3Z A;  1XGS A;  3TAV A;  1KQ9 A;  2BWY A;  2NQ6 A;  1QXY A;  4U69 A;  4IDY A;  1WLR A;  4IKR A;  4R60 A;  4U76 A;  1R58 A;  1WN1 A;  2BHB A;  3CB5 A;  4ZNG A;  3MR1 A;  5D6E A;  1R5H A;  2BWX A;  4IU6 A;  1PV9 A;  2GG9 A;  3BIQ A;  1XGM A;  4S00 A;  3FMR A;  4FLI A;  2BWW A;  1KQ0 A;  4U70 A;  4FKC A;  1C23 A;  2ZSG A;  4A6V A;  1CHM A;  4B28 A;  5CLS A;  2BWS A;  2GGB A;  2EA2 A;  1C24 A;  3FM3 A;  2B3H A;  4S2T P;  4ZWU A;  3IU7 A;  4U6C A;  1QZY A;  5JFR A;  1W7V A;  1C27 A;  4FUK A;  4RGZ 1;  2DFI A;  3MAT A;  4OOK A;  1M35 A;  5FCH A;  5JHU A;  1XGN A;  1BN5 A;  2V6C A;  3L7G A;  2Q8K A;  4IPA A;  1Y1N A;  3PKC A;  1YW8 A;  2IW2 A;  1QXZ A;  3L24 A;  3PKB A;  4S2R P;  4FLL A;  2GG5 A;  3MX6 A;  4RZZ A;  3ROR A;  4FO7 A;  1O0X A;  5CDL A;  1XGO A;  2B3L A;  2GU4 A;  4IEC A;  2B3K A;  3TB5 A;  2GU6 A;  2Q96 A;  2GG0 A;  1KP0 A;  2GGC A;  4QR8 A;  3CB6 A;  2EA4 A;  2BB7 A;  2P98 A;  4IF7 A;  4Z7M A;  1C22 A;  5E5B A;  2EVO A;  3BIP A;  4PNC A;  4U1B A;  5D6F A;  3S6B A;  2GZ5 A;  3PKD A;  2HOW A;  3RVA A;  1B59 A;  1YW7 A;  2V3X A;  5CNX A;  4PV4 A;  2BN7 A;  4JUQ A;  4FLJ A;  4ZWP A;  1BOA A;  1W2M A;  5CDV A;  4ZWO A;  2ADU A;  1YW9 A;  2OAZ A;  4FLK A;  2P99 A;  4S01 A;  5FCF A;  1C21 A;  1XNZ A;  1WY2 A;  2Q95 A;  2EVM A;  4MAT A;  1N51 A;  2BHA A;  2GG2 A;  2BWU A;  4IKT A;  1JAW A;  4U6W A;  4U6E A;  4RZY A;  2GG3 A;  2Q92 A;  4EGE A;  2GG7 A;  2GTX A;  3CTZ A; 
#chains in the Genus database with same CATH homology
 1WBQ A;  1R5G A;  2GA2 A;  2GU7 A;  3PKA A;  2Q94 A;  3D27 A;  4KM3 A;  3IU8 A;  4FO8 A;  2G6P A;  2GG8 A;  2EVC A;  5CDE A;  2BHD A;  2GU5 A;  3FMQ A;  4U71 A;  5CIK A;  4U6J A;  5CE6 A;  2OKN A;  2P9A A;  4IKS A;  3BIT A;  1YVM A;  1MAT A;  2BHC A;  2BH3 A;  3Q6D A;  1WL6 A;  2MAT A;  2V3Y A;  4U6Z A;  4U73 A;  2NQ7 A;  4A6W A;  4IKU A;  1YJ3 A;  2BWV A;  1QXW A;  1WL9 A;  3IG4 A;  2Q93 A;  3PKE A;  1B6A A;  2BWT A;  5JI6 A;  4HXX A;  1WKM A;  1A16 A;  4U75 A;  3IU9 A;  2V3Z A;  1XGS A;  3TAV A;  1KQ9 A;  2BWY A;  2NQ6 A;  1QXY A;  4U69 A;  4IDY A;  1WLR A;  4IKR A;  4R60 A;  4U76 A;  1R58 A;  1WN1 A;  2BHB A;  3CB5 A;  4ZNG A;  3MR1 A;  5D6E A;  1R5H A;  2BWX A;  4IU6 A;  1PV9 A;  2GG9 A;  3BIQ A;  1XGM A;  4S00 A;  3FMR A;  4FLI A;  2BWW A;  1KQ0 A;  4U70 A;  4FKC A;  1C23 A;  2ZSG A;  4A6V A;  1CHM A;  4B28 A;  5CLS A;  2BWS A;  2GGB A;  2EA2 A;  1C24 A;  3FM3 A;  2B3H A;  4S2T P;  4ZWU A;  3IU7 A;  4U6C A;  1QZY A;  5JFR A;  1W7V A;  1C27 A;  4FUK A;  4RGZ 1;  2DFI A;  3MAT A;  4OOK A;  1M35 A;  5FCH A;  5JHU A;  1XGN A;  1BN5 A;  2V6C A;  3L7G A;  2Q8K A;  4IPA A;  1Y1N A;  3PKC A;  1YW8 A;  2IW2 A;  1QXZ A;  3L24 A;  3PKB A;  4S2R P;  4FLL A;  2GG5 A;  3MX6 A;  4RZZ A;  3ROR A;  4FO7 A;  1O0X A;  5CDL A;  1XGO A;  2B3L A;  2GU4 A;  4IEC A;  2B3K A;  3TB5 A;  2GU6 A;  2Q96 A;  2GG0 A;  1KP0 A;  2GGC A;  4QR8 A;  3CB6 A;  2EA4 A;  2BB7 A;  2P98 A;  4IF7 A;  4Z7M A;  1C22 A;  5E5B A;  2EVO A;  3BIP A;  4PNC A;  4U1B A;  5D6F A;  3S6B A;  2GZ5 A;  3PKD A;  2HOW A;  3RVA A;  1B59 A;  1YW7 A;  2V3X A;  5CNX A;  4PV4 A;  2BN7 A;  4JUQ A;  4FLJ A;  4ZWP A;  1BOA A;  1W2M A;  5CDV A;  4ZWO A;  2ADU A;  1YW9 A;  2OAZ A;  4FLK A;  2P99 A;  4S01 A;  5FCF A;  1C21 A;  1XNZ A;  1WY2 A;  2Q95 A;  2EVM A;  4MAT A;  1N51 A;  2BHA A;  2GG2 A;  2BWU A;  4IKT A;  1JAW A;  4U6W A;  4U6E A;  4RZY A;  2GG3 A;  2Q92 A;  4EGE A;  2GG7 A;  2GTX A;  3CTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...