4IKTA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(5-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iktA00
4IF7A 1WL6A 1QXZA 1B6AA 1O0XA 2GTXA 2BHBA 4U6ZA 1R58A 2BWUA 2P99A 1QXYA 4R60A 4S00A 2B3LA 5CDVA 4IKUA 2GU6A 4U6EA 4U71A 4ZNGA 1WLRA 4FKCA 1JAWA 2GG0A 4RZZA 4FO7A 2Q93A 1C24A 3CB5A 5D6EA 3L7GA 4IPAA 1Y1NA 2GG7A 1PV9A 2P98A 4FLKA 2V6CA 1R5HA 1C21A 2GU4A 2Q94A 4S2RP 2G6PA 3IG4A 4FLJA 3BIPA 2GG5A 4U73A 2BHAA 5FCHA 4ZWPA 3L24A 4FUKA 4U6WA 4ZWOA 2BN7A 2BHCA 1YJ3A 2GGBA 4IDYA 4PV4A 4S01A 3MR1A 3BIQA 5CNXA 4A6WA 2GU7A 3PKCA 2NQ7A 5CIKA 5JHUA 3PKAA 4EGEA 4U70A 4FLIA 5JI6A 4RGZ1 1W7VA 2ADUA 4U6JA 1M35A 3TAVA 5CLSA 5CDEA 4HXXA 4IKTA 3BITA 1C22A 2BWTA 2OKNA 3MATA 3RORA 5CDLA 2Q95A 4MATA 1XGSA 3IU8A 2B3HA 1XGMA 2IW2A 1C27A 1BOAA 3D27A 5JFRA 4Z7MA 1KP0A 2BWVA 5D6FA 1WBQA 4U76A 3FM3A 5E5BA 2GZ5A 3CTZA 4PNCA 1B59A 2BWSA 2EA4A 2GG8A 1XNZA 2BWYA 5FCFA 2Q92A 5CE6A 1A16A 2DFIA 4ZWUA 2HOWA 1W2MA 1R5GA 1WY2A 2NQ6A 1KQ9A 4IU6A 2GG9A 1YW8A 1N51A 2GGCA 4S2TP 2V3YA 3PKDA 3MX6A 2EVCA 2MATA 1C23A 3IU9A 2BWWA 1XGOA 2GA2A 1XGNA 1YVMA 1KQ0A 3PKEA 2BHDA 4QR8A 4U1BA 4IKRA 3PKBA 1WKMA 2GU5A 1MATA 2BWXA 2GG2A 4U6CA 4FO8A 4U75A 3TB5A 1WL9A 2P9AA 3FMRA 2EVOA 3S6BA 1YW7A 2GG3A 2BH3A 2V3ZA 4A6VA 3Q6DA 1QXWA 4KM3A 4FLLA 4OOKA 3IU7A 2Q96A 1WN1A 4U69A 3FMQA 2Q8KA 2ZSGA 3RVAA 4IECA 1YW9A 4JUQA 2EVMA 3CB6A 4RZYA 2V3XA 4IKSA 1QZYA 2B3KA 4B28A 1CHMA 2OAZA 1BN5A 2BB7A 2EA2A
chains in the Genus database with same CATH superfamily
4IF7A 1WL6A 1QXZA 1B6AA 1O0XA 2GTXA 2BHBA 4U6ZA 1R58A 2BWUA 2P99A 1QXYA 4R60A 4S00A 2B3LA 5CDVA 4IKUA 2GU6A 4U6EA 4U71A 4ZNGA 1WLRA 4FKCA 1JAWA 2GG0A 4RZZA 4FO7A 2Q93A 1C24A 3CB5A 5D6EA 3L7GA 4IPAA 1Y1NA 2GG7A 1PV9A 2P98A 4FLKA 2V6CA 1R5HA 1C21A 2GU4A 2Q94A 4S2RP 2G6PA 3IG4A 4FLJA 3BIPA 2GG5A 4U73A 2BHAA 5FCHA 4ZWPA 3L24A 4FUKA 4U6WA 4ZWOA 2BN7A 2BHCA 1YJ3A 2GGBA 4IDYA 4PV4A 4S01A 3MR1A 3BIQA 5CNXA 4A6WA 2GU7A 3PKCA 2NQ7A 5CIKA 5JHUA 3PKAA 4EGEA 4U70A 4FLIA 5JI6A 4RGZ1 1W7VA 2ADUA 4U6JA 1M35A 3TAVA 5CLSA 5CDEA 4HXXA 4IKTA 3BITA 1C22A 2BWTA 2OKNA 3MATA 3RORA 5CDLA 2Q95A 4MATA 1XGSA 3IU8A 2B3HA 1XGMA 2IW2A 1C27A 1BOAA 3D27A 5JFRA 4Z7MA 1KP0A 2BWVA 5D6FA 1WBQA 4U76A 3FM3A 5E5BA 2GZ5A 3CTZA 4PNCA 1B59A 2BWSA 2EA4A 2GG8A 1XNZA 2BWYA 5FCFA 2Q92A 5CE6A 1A16A 2DFIA 4ZWUA 2HOWA 1W2MA 1R5GA 1WY2A 2NQ6A 1KQ9A 4IU6A 2GG9A 1YW8A 1N51A 2GGCA 4S2TP 2V3YA 3PKDA 3MX6A 2EVCA 2MATA 1C23A 3IU9A 2BWWA 1XGOA 2GA2A 1XGNA 1YVMA 1KQ0A 3PKEA 2BHDA 4QR8A 4U1BA 4IKRA 3PKBA 1WKMA 2GU5A 1MATA 2BWXA 2GG2A 4U6CA 4FO8A 4U75A 3TB5A 1WL9A 2P9AA 3FMRA 2EVOA 3S6BA 1YW7A 2GG3A 2BH3A 2V3ZA 4A6VA 3Q6DA 1QXWA 4KM3A 4FLLA 4OOKA 3IU7A 2Q96A 1WN1A 4U69A 3FMQA 2Q8KA 2ZSGA 3RVAA 4IECA 1YW9A 4JUQA 2EVMA 3CB6A 4RZYA 2V3XA 4IKSA 1QZYA 2B3KA 4B28A 1CHMA 2OAZA 1BN5A 2BB7A 2EA2A
chains in the Genus database with same CATH topology
4IF7A 1WL6A 1QXZA 1B6AA 1O0XA 2GTXA 2BHBA 4U6ZA 1R58A 2BWUA 2P99A 1QXYA 4R60A 4S00A 2B3LA 5CDVA 4IKUA 2GU6A 4U6EA 4U71A 4ZNGA 1WLRA 4FKCA 1JAWA 2GG0A 4RZZA 4FO7A 2Q93A 1C24A 3CB5A 5D6EA 3L7GA 4IPAA 1Y1NA 2GG7A 1PV9A 2P98A 4FLKA 2V6CA 1R5HA 1C21A 2GU4A 2Q94A 4S2RP 2G6PA 3IG4A 4FLJA 3BIPA 2GG5A 4U73A 2BHAA 5FCHA 4ZWPA 3L24A 4FUKA 4U6WA 4ZWOA 2BN7A 2BHCA 1YJ3A 2GGBA 4IDYA 4PV4A 4S01A 3MR1A 3BIQA 5CNXA 4A6WA 2GU7A 3PKCA 2NQ7A 5CIKA 5JHUA 3PKAA 4EGEA 4U70A 4FLIA 5JI6A 4RGZ1 1W7VA 2ADUA 4U6JA 1M35A 3TAVA 5CLSA 5CDEA 4HXXA 4IKTA 3BITA 1C22A 2BWTA 2OKNA 3MATA 3RORA 5CDLA 2Q95A 4MATA 1XGSA 3IU8A 2B3HA 1XGMA 2IW2A 1C27A 1BOAA 3D27A 5JFRA 4Z7MA 1KP0A 2BWVA 5D6FA 1WBQA 4U76A 3FM3A 5E5BA 2GZ5A 3CTZA 4PNCA 1B59A 2BWSA 2EA4A 2GG8A 1XNZA 2BWYA 5FCFA 2Q92A 5CE6A 1A16A 2DFIA 4ZWUA 2HOWA 1W2MA 1R5GA 1WY2A 2NQ6A 1KQ9A 4IU6A 2GG9A 1YW8A 1N51A 2GGCA 4S2TP 2V3YA 3PKDA 3MX6A 2EVCA 2MATA 1C23A 3IU9A 2BWWA 1XGOA 2GA2A 1XGNA 1YVMA 1KQ0A 3PKEA 2BHDA 4QR8A 4U1BA 4IKRA 3PKBA 1WKMA 2GU5A 1MATA 2BWXA 2GG2A 4U6CA 4FO8A 4U75A 3TB5A 1WL9A 2P9AA 3FMRA 2EVOA 3S6BA 1YW7A 2GG3A 2BH3A 2V3ZA 4A6VA 3Q6DA 1QXWA 4KM3A 4FLLA 4OOKA 3IU7A 2Q96A 1WN1A 4U69A 3FMQA 2Q8KA 2ZSGA 3RVAA 4IECA 1YW9A 4JUQA 2EVMA 3CB6A 4RZYA 2V3XA 4IKSA 1QZYA 2B3KA 4B28A 1CHMA 2OAZA 1BN5A 2BB7A 2EA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IF7 A;  1WL6 A;  1QXZ A;  1B6A A;  1O0X A;  2GTX A;  2BHB A;  4U6Z A;  1R58 A;  2BWU A;  2P99 A;  1QXY A;  4R60 A;  4S00 A;  2B3L A;  5CDV A;  4IKU A;  2GU6 A;  4U6E A;  4U71 A;  4ZNG A;  1WLR A;  4FKC A;  1JAW A;  2GG0 A;  4RZZ A;  4FO7 A;  2Q93 A;  1C24 A;  3CB5 A;  5D6E A;  3L7G A;  4IPA A;  1Y1N A;  2GG7 A;  1PV9 A;  2P98 A;  4FLK A;  2V6C A;  1R5H A;  1C21 A;  2GU4 A;  2Q94 A;  4S2R P;  2G6P A;  3IG4 A;  4FLJ A;  3BIP A;  2GG5 A;  4U73 A;  2BHA A;  5FCH A;  4ZWP A;  3L24 A;  4FUK A;  4U6W A;  4ZWO A;  2BN7 A;  2BHC A;  1YJ3 A;  2GGB A;  4IDY A;  4PV4 A;  4S01 A;  3MR1 A;  3BIQ A;  5CNX A;  4A6W A;  2GU7 A;  3PKC A;  2NQ7 A;  5CIK A;  5JHU A;  3PKA A;  4EGE A;  4U70 A;  4FLI A;  5JI6 A;  4RGZ 1;  1W7V A;  2ADU A;  4U6J A;  1M35 A;  3TAV A;  5CLS A;  5CDE A;  4HXX A;  4IKT A;  3BIT A;  1C22 A;  2BWT A;  2OKN A;  3MAT A;  3ROR A;  5CDL A;  2Q95 A;  4MAT A;  1XGS A;  3IU8 A;  2B3H A;  1XGM A;  2IW2 A;  1C27 A;  1BOA A;  3D27 A;  5JFR A;  4Z7M A;  1KP0 A;  2BWV A;  5D6F A;  1WBQ A;  4U76 A;  3FM3 A;  5E5B A;  2GZ5 A;  3CTZ A;  4PNC A;  1B59 A;  2BWS A;  2EA4 A;  2GG8 A;  1XNZ A;  2BWY A;  5FCF A;  2Q92 A;  5CE6 A;  1A16 A;  2DFI A;  4ZWU A;  2HOW A;  1W2M A;  1R5G A;  1WY2 A;  2NQ6 A;  1KQ9 A;  4IU6 A;  2GG9 A;  1YW8 A;  1N51 A;  2GGC A;  4S2T P;  2V3Y A;  3PKD A;  3MX6 A;  2EVC A;  2MAT A;  1C23 A;  3IU9 A;  2BWW A;  1XGO A;  2GA2 A;  1XGN A;  1YVM A;  1KQ0 A;  3PKE A;  2BHD A;  4QR8 A;  4U1B A;  4IKR A;  3PKB A;  1WKM A;  2GU5 A;  1MAT A;  2BWX A;  2GG2 A;  4U6C A;  4FO8 A;  4U75 A;  3TB5 A;  1WL9 A;  2P9A A;  3FMR A;  2EVO A;  3S6B A;  1YW7 A;  2GG3 A;  2BH3 A;  2V3Z A;  4A6V A;  3Q6D A;  1QXW A;  4KM3 A;  4FLL A;  4OOK A;  3IU7 A;  2Q96 A;  1WN1 A;  4U69 A;  3FMQ A;  2Q8K A;  2ZSG A;  3RVA A;  4IEC A;  1YW9 A;  4JUQ A;  2EVM A;  3CB6 A;  4RZY A;  2V3X A;  4IKS A;  1QZY A;  2B3K A;  4B28 A;  1CHM A;  2OAZ A;  1BN5 A;  2BB7 A;  2EA2 A; 
#chains in the Genus database with same CATH topology
 4IF7 A;  1WL6 A;  1QXZ A;  1B6A A;  1O0X A;  2GTX A;  2BHB A;  4U6Z A;  1R58 A;  2BWU A;  2P99 A;  1QXY A;  4R60 A;  4S00 A;  2B3L A;  5CDV A;  4IKU A;  2GU6 A;  4U6E A;  4U71 A;  4ZNG A;  1WLR A;  4FKC A;  1JAW A;  2GG0 A;  4RZZ A;  4FO7 A;  2Q93 A;  1C24 A;  3CB5 A;  5D6E A;  3L7G A;  4IPA A;  1Y1N A;  2GG7 A;  1PV9 A;  2P98 A;  4FLK A;  2V6C A;  1R5H A;  1C21 A;  2GU4 A;  2Q94 A;  4S2R P;  2G6P A;  3IG4 A;  4FLJ A;  3BIP A;  2GG5 A;  4U73 A;  2BHA A;  5FCH A;  4ZWP A;  3L24 A;  4FUK A;  4U6W A;  4ZWO A;  2BN7 A;  2BHC A;  1YJ3 A;  2GGB A;  4IDY A;  4PV4 A;  4S01 A;  3MR1 A;  3BIQ A;  5CNX A;  4A6W A;  2GU7 A;  3PKC A;  2NQ7 A;  5CIK A;  5JHU A;  3PKA A;  4EGE A;  4U70 A;  4FLI A;  5JI6 A;  4RGZ 1;  1W7V A;  2ADU A;  4U6J A;  1M35 A;  3TAV A;  5CLS A;  5CDE A;  4HXX A;  4IKT A;  3BIT A;  1C22 A;  2BWT A;  2OKN A;  3MAT A;  3ROR A;  5CDL A;  2Q95 A;  4MAT A;  1XGS A;  3IU8 A;  2B3H A;  1XGM A;  2IW2 A;  1C27 A;  1BOA A;  3D27 A;  5JFR A;  4Z7M A;  1KP0 A;  2BWV A;  5D6F A;  1WBQ A;  4U76 A;  3FM3 A;  5E5B A;  2GZ5 A;  3CTZ A;  4PNC A;  1B59 A;  2BWS A;  2EA4 A;  2GG8 A;  1XNZ A;  2BWY A;  5FCF A;  2Q92 A;  5CE6 A;  1A16 A;  2DFI A;  4ZWU A;  2HOW A;  1W2M A;  1R5G A;  1WY2 A;  2NQ6 A;  1KQ9 A;  4IU6 A;  2GG9 A;  1YW8 A;  1N51 A;  2GGC A;  4S2T P;  2V3Y A;  3PKD A;  3MX6 A;  2EVC A;  2MAT A;  1C23 A;  3IU9 A;  2BWW A;  1XGO A;  2GA2 A;  1XGN A;  1YVM A;  1KQ0 A;  3PKE A;  2BHD A;  4QR8 A;  4U1B A;  4IKR A;  3PKB A;  1WKM A;  2GU5 A;  1MAT A;  2BWX A;  2GG2 A;  4U6C A;  4FO8 A;  4U75 A;  3TB5 A;  1WL9 A;  2P9A A;  3FMR A;  2EVO A;  3S6B A;  1YW7 A;  2GG3 A;  2BH3 A;  2V3Z A;  4A6V A;  3Q6D A;  1QXW A;  4KM3 A;  4FLL A;  4OOK A;  3IU7 A;  2Q96 A;  1WN1 A;  4U69 A;  3FMQ A;  2Q8K A;  2ZSG A;  3RVA A;  4IEC A;  1YW9 A;  4JUQ A;  2EVM A;  3CB6 A;  4RZY A;  2V3X A;  4IKS A;  1QZY A;  2B3K A;  4B28 A;  1CHM A;  2OAZ A;  1BN5 A;  2BB7 A;  2EA2 A; 
#chains in the Genus database with same CATH homology
 4IF7 A;  1WL6 A;  1QXZ A;  1B6A A;  1O0X A;  2GTX A;  2BHB A;  4U6Z A;  1R58 A;  2BWU A;  2P99 A;  1QXY A;  4R60 A;  4S00 A;  2B3L A;  5CDV A;  4IKU A;  2GU6 A;  4U6E A;  4U71 A;  4ZNG A;  1WLR A;  4FKC A;  1JAW A;  2GG0 A;  4RZZ A;  4FO7 A;  2Q93 A;  1C24 A;  3CB5 A;  5D6E A;  3L7G A;  4IPA A;  1Y1N A;  2GG7 A;  1PV9 A;  2P98 A;  4FLK A;  2V6C A;  1R5H A;  1C21 A;  2GU4 A;  2Q94 A;  4S2R P;  2G6P A;  3IG4 A;  4FLJ A;  3BIP A;  2GG5 A;  4U73 A;  2BHA A;  5FCH A;  4ZWP A;  3L24 A;  4FUK A;  4U6W A;  4ZWO A;  2BN7 A;  2BHC A;  1YJ3 A;  2GGB A;  4IDY A;  4PV4 A;  4S01 A;  3MR1 A;  3BIQ A;  5CNX A;  4A6W A;  2GU7 A;  3PKC A;  2NQ7 A;  5CIK A;  5JHU A;  3PKA A;  4EGE A;  4U70 A;  4FLI A;  5JI6 A;  4RGZ 1;  1W7V A;  2ADU A;  4U6J A;  1M35 A;  3TAV A;  5CLS A;  5CDE A;  4HXX A;  4IKT A;  3BIT A;  1C22 A;  2BWT A;  2OKN A;  3MAT A;  3ROR A;  5CDL A;  2Q95 A;  4MAT A;  1XGS A;  3IU8 A;  2B3H A;  1XGM A;  2IW2 A;  1C27 A;  1BOA A;  3D27 A;  5JFR A;  4Z7M A;  1KP0 A;  2BWV A;  5D6F A;  1WBQ A;  4U76 A;  3FM3 A;  5E5B A;  2GZ5 A;  3CTZ A;  4PNC A;  1B59 A;  2BWS A;  2EA4 A;  2GG8 A;  1XNZ A;  2BWY A;  5FCF A;  2Q92 A;  5CE6 A;  1A16 A;  2DFI A;  4ZWU A;  2HOW A;  1W2M A;  1R5G A;  1WY2 A;  2NQ6 A;  1KQ9 A;  4IU6 A;  2GG9 A;  1YW8 A;  1N51 A;  2GGC A;  4S2T P;  2V3Y A;  3PKD A;  3MX6 A;  2EVC A;  2MAT A;  1C23 A;  3IU9 A;  2BWW A;  1XGO A;  2GA2 A;  1XGN A;  1YVM A;  1KQ0 A;  3PKE A;  2BHD A;  4QR8 A;  4U1B A;  4IKR A;  3PKB A;  1WKM A;  2GU5 A;  1MAT A;  2BWX A;  2GG2 A;  4U6C A;  4FO8 A;  4U75 A;  3TB5 A;  1WL9 A;  2P9A A;  3FMR A;  2EVO A;  3S6B A;  1YW7 A;  2GG3 A;  2BH3 A;  2V3Z A;  4A6V A;  3Q6D A;  1QXW A;  4KM3 A;  4FLL A;  4OOK A;  3IU7 A;  2Q96 A;  1WN1 A;  4U69 A;  3FMQ A;  2Q8K A;  2ZSG A;  3RVA A;  4IEC A;  1YW9 A;  4JUQ A;  2EVM A;  3CB6 A;  4RZY A;  2V3X A;  4IKS A;  1QZY A;  2B3K A;  4B28 A;  1CHM A;  2OAZ A;  1BN5 A;  2BB7 A;  2EA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...