4IKTA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(5-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iktA00
2EVCA 2GG7A 3RVAA 1XGMA 1R5HA 1C22A 2GGBA 2GG3A 2B3KA 2Q95A 2NQ7A 4S2RP 5E5BA 5CDEA 1W7VA 2ADUA 1WBQA 5CDLA 2P98A 1WLRA 2BHCA 1BOAA 2BB7A 1B59A 3TAVA 5D6FA 3D27A 3L7GA 4R60A 4U71A 1M35A 2V6CA 4U69A 5FCFA 4MATA 1KP0A 2G6PA 5JI6A 2GGCA 2GG5A 2OAZA 1JAWA 3IU9A 4U6JA 1R5GA 2Q93A 2GG0A 3IU8A 4PV4A 4U6ZA 2GA2A 2GTXA 1W2MA 3FMRA 4ZNGA 1CHMA 1YW9A 3Q6DA 1WL9A 4ZWOA 4KM3A 1Y1NA 1O0XA 3BITA 2IW2A 1KQ9A 2GZ5A 2GG9A 4S2TP 1WN1A 2BWWA 4U6CA 4ZWPA 4U70A 4FO7A 4IKTA 4IKUA 2BWUA 1YW8A 5CE6A 3CB5A 4Z7MA 1PV9A 5FCHA 1QXYA 2GG8A 1C23A 2GU5A 4IF7A 2EA2A 4U76A 2P9AA 3BIQA 3PKAA 2BWTA 2GU7A 2BWVA 1QXZA 3FMQA 5D6EA 2BWSA 2Q92A 1WL6A 3PKCA 2Q96A 4EGEA 4U73A 4OOKA 2GU4A 1MATA 5CLSA 2EA4A 3MX6A 3BIPA 3FM3A 1WKMA 2Q94A 4U75A 2B3LA 3MATA 2GG2A 2B3HA 4FLJA 1R58A 2Q8KA 1YJ3A 4IPAA 2P99A 2MATA 2BWYA 1BN5A 2EVOA 1XGSA 2EVMA 3S6BA 2BN7A 4IECA 4B28A 4S00A 2V3ZA 4A6WA 3IU7A 3L24A 3IG4A 4IU6A 2BHAA 1C24A 2HOWA 3CTZA 4U6WA 4FLKA 4U6EA 2BWXA 1WY2A 4S01A 4FUKA 4PNCA 1N51A 4RZYA 5CDVA 3CB6A 1YW7A 3PKBA 2DFIA 1XNZA 2GU6A 4IKRA 4FLIA 1B6AA 4IKSA 2ZSGA 3PKDA 2OKNA 4IDYA 4FLLA 4RZZA 1YVMA 5CIKA 5JFRA 2V3YA 1XGOA 4FO8A 4HXXA 4QR8A 1A16A 4U1BA 4ZWUA 2BHBA 3MR1A 1QXWA 4A6VA 1XGNA 1C27A 3PKEA 1QZYA 2V3XA 3RORA 1KQ0A 2BH3A 4RGZ1 5JHUA 2BHDA 4FKCA 3TB5A 1C21A 2NQ6A 4JUQA 5CNXA
chains in the Genus database with same CATH superfamily
2EVCA 2GG7A 3RVAA 1XGMA 1R5HA 1C22A 2GGBA 2GG3A 2B3KA 2Q95A 2NQ7A 4S2RP 5E5BA 5CDEA 1W7VA 2ADUA 1WBQA 5CDLA 2P98A 1WLRA 2BHCA 1BOAA 2BB7A 1B59A 3TAVA 5D6FA 3D27A 3L7GA 4R60A 4U71A 1M35A 2V6CA 4U69A 5FCFA 4MATA 1KP0A 2G6PA 5JI6A 2GGCA 2GG5A 2OAZA 1JAWA 3IU9A 4U6JA 1R5GA 2Q93A 2GG0A 3IU8A 4PV4A 4U6ZA 2GA2A 2GTXA 1W2MA 3FMRA 4ZNGA 1CHMA 1YW9A 3Q6DA 1WL9A 4ZWOA 4KM3A 1Y1NA 1O0XA 3BITA 2IW2A 1KQ9A 2GZ5A 2GG9A 4S2TP 1WN1A 2BWWA 4U6CA 4ZWPA 4U70A 4FO7A 4IKTA 4IKUA 2BWUA 1YW8A 5CE6A 3CB5A 4Z7MA 1PV9A 5FCHA 1QXYA 2GG8A 1C23A 2GU5A 4IF7A 2EA2A 4U76A 2P9AA 3BIQA 3PKAA 2BWTA 2GU7A 2BWVA 1QXZA 3FMQA 5D6EA 2BWSA 2Q92A 1WL6A 3PKCA 2Q96A 4EGEA 4U73A 4OOKA 2GU4A 1MATA 5CLSA 2EA4A 3MX6A 3BIPA 3FM3A 1WKMA 2Q94A 4U75A 2B3LA 3MATA 2GG2A 2B3HA 4FLJA 1R58A 2Q8KA 1YJ3A 4IPAA 2P99A 2MATA 2BWYA 1BN5A 2EVOA 1XGSA 2EVMA 3S6BA 2BN7A 4IECA 4B28A 4S00A 2V3ZA 4A6WA 3IU7A 3L24A 3IG4A 4IU6A 2BHAA 1C24A 2HOWA 3CTZA 4U6WA 4FLKA 4U6EA 2BWXA 1WY2A 4S01A 4FUKA 4PNCA 1N51A 4RZYA 5CDVA 3CB6A 1YW7A 3PKBA 2DFIA 1XNZA 2GU6A 4IKRA 4FLIA 1B6AA 4IKSA 2ZSGA 3PKDA 2OKNA 4IDYA 4FLLA 4RZZA 1YVMA 5CIKA 5JFRA 2V3YA 1XGOA 4FO8A 4HXXA 4QR8A 1A16A 4U1BA 4ZWUA 2BHBA 3MR1A 1QXWA 4A6VA 1XGNA 1C27A 3PKEA 1QZYA 2V3XA 3RORA 1KQ0A 2BH3A 4RGZ1 5JHUA 2BHDA 4FKCA 3TB5A 1C21A 2NQ6A 4JUQA 5CNXA
chains in the Genus database with same CATH topology
2EVCA 2GG7A 3RVAA 1XGMA 1R5HA 1C22A 2GGBA 2GG3A 2B3KA 2Q95A 2NQ7A 4S2RP 5E5BA 5CDEA 1W7VA 2ADUA 1WBQA 5CDLA 2P98A 1WLRA 2BHCA 1BOAA 2BB7A 1B59A 3TAVA 5D6FA 3D27A 3L7GA 4R60A 4U71A 1M35A 2V6CA 4U69A 5FCFA 4MATA 1KP0A 2G6PA 5JI6A 2GGCA 2GG5A 2OAZA 1JAWA 3IU9A 4U6JA 1R5GA 2Q93A 2GG0A 3IU8A 4PV4A 4U6ZA 2GA2A 2GTXA 1W2MA 3FMRA 4ZNGA 1CHMA 1YW9A 3Q6DA 1WL9A 4ZWOA 4KM3A 1Y1NA 1O0XA 3BITA 2IW2A 1KQ9A 2GZ5A 2GG9A 4S2TP 1WN1A 2BWWA 4U6CA 4ZWPA 4U70A 4FO7A 4IKTA 4IKUA 2BWUA 1YW8A 5CE6A 3CB5A 4Z7MA 1PV9A 5FCHA 1QXYA 2GG8A 1C23A 2GU5A 4IF7A 2EA2A 4U76A 2P9AA 3BIQA 3PKAA 2BWTA 2GU7A 2BWVA 1QXZA 3FMQA 5D6EA 2BWSA 2Q92A 1WL6A 3PKCA 2Q96A 4EGEA 4U73A 4OOKA 2GU4A 1MATA 5CLSA 2EA4A 3MX6A 3BIPA 3FM3A 1WKMA 2Q94A 4U75A 2B3LA 3MATA 2GG2A 2B3HA 4FLJA 1R58A 2Q8KA 1YJ3A 4IPAA 2P99A 2MATA 2BWYA 1BN5A 2EVOA 1XGSA 2EVMA 3S6BA 2BN7A 4IECA 4B28A 4S00A 2V3ZA 4A6WA 3IU7A 3L24A 3IG4A 4IU6A 2BHAA 1C24A 2HOWA 3CTZA 4U6WA 4FLKA 4U6EA 2BWXA 1WY2A 4S01A 4FUKA 4PNCA 1N51A 4RZYA 5CDVA 3CB6A 1YW7A 3PKBA 2DFIA 1XNZA 2GU6A 4IKRA 4FLIA 1B6AA 4IKSA 2ZSGA 3PKDA 2OKNA 4IDYA 4FLLA 4RZZA 1YVMA 5CIKA 5JFRA 2V3YA 1XGOA 4FO8A 4HXXA 4QR8A 1A16A 4U1BA 4ZWUA 2BHBA 3MR1A 1QXWA 4A6VA 1XGNA 1C27A 3PKEA 1QZYA 2V3XA 3RORA 1KQ0A 2BH3A 4RGZ1 5JHUA 2BHDA 4FKCA 3TB5A 1C21A 2NQ6A 4JUQA 5CNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVC A;  2GG7 A;  3RVA A;  1XGM A;  1R5H A;  1C22 A;  2GGB A;  2GG3 A;  2B3K A;  2Q95 A;  2NQ7 A;  4S2R P;  5E5B A;  5CDE A;  1W7V A;  2ADU A;  1WBQ A;  5CDL A;  2P98 A;  1WLR A;  2BHC A;  1BOA A;  2BB7 A;  1B59 A;  3TAV A;  5D6F A;  3D27 A;  3L7G A;  4R60 A;  4U71 A;  1M35 A;  2V6C A;  4U69 A;  5FCF A;  4MAT A;  1KP0 A;  2G6P A;  5JI6 A;  2GGC A;  2GG5 A;  2OAZ A;  1JAW A;  3IU9 A;  4U6J A;  1R5G A;  2Q93 A;  2GG0 A;  3IU8 A;  4PV4 A;  4U6Z A;  2GA2 A;  2GTX A;  1W2M A;  3FMR A;  4ZNG A;  1CHM A;  1YW9 A;  3Q6D A;  1WL9 A;  4ZWO A;  4KM3 A;  1Y1N A;  1O0X A;  3BIT A;  2IW2 A;  1KQ9 A;  2GZ5 A;  2GG9 A;  4S2T P;  1WN1 A;  2BWW A;  4U6C A;  4ZWP A;  4U70 A;  4FO7 A;  4IKT A;  4IKU A;  2BWU A;  1YW8 A;  5CE6 A;  3CB5 A;  4Z7M A;  1PV9 A;  5FCH A;  1QXY A;  2GG8 A;  1C23 A;  2GU5 A;  4IF7 A;  2EA2 A;  4U76 A;  2P9A A;  3BIQ A;  3PKA A;  2BWT A;  2GU7 A;  2BWV A;  1QXZ A;  3FMQ A;  5D6E A;  2BWS A;  2Q92 A;  1WL6 A;  3PKC A;  2Q96 A;  4EGE A;  4U73 A;  4OOK A;  2GU4 A;  1MAT A;  5CLS A;  2EA4 A;  3MX6 A;  3BIP A;  3FM3 A;  1WKM A;  2Q94 A;  4U75 A;  2B3L A;  3MAT A;  2GG2 A;  2B3H A;  4FLJ A;  1R58 A;  2Q8K A;  1YJ3 A;  4IPA A;  2P99 A;  2MAT A;  2BWY A;  1BN5 A;  2EVO A;  1XGS A;  2EVM A;  3S6B A;  2BN7 A;  4IEC A;  4B28 A;  4S00 A;  2V3Z A;  4A6W A;  3IU7 A;  3L24 A;  3IG4 A;  4IU6 A;  2BHA A;  1C24 A;  2HOW A;  3CTZ A;  4U6W A;  4FLK A;  4U6E A;  2BWX A;  1WY2 A;  4S01 A;  4FUK A;  4PNC A;  1N51 A;  4RZY A;  5CDV A;  3CB6 A;  1YW7 A;  3PKB A;  2DFI A;  1XNZ A;  2GU6 A;  4IKR A;  4FLI A;  1B6A A;  4IKS A;  2ZSG A;  3PKD A;  2OKN A;  4IDY A;  4FLL A;  4RZZ A;  1YVM A;  5CIK A;  5JFR A;  2V3Y A;  1XGO A;  4FO8 A;  4HXX A;  4QR8 A;  1A16 A;  4U1B A;  4ZWU A;  2BHB A;  3MR1 A;  1QXW A;  4A6V A;  1XGN A;  1C27 A;  3PKE A;  1QZY A;  2V3X A;  3ROR A;  1KQ0 A;  2BH3 A;  4RGZ 1;  5JHU A;  2BHD A;  4FKC A;  3TB5 A;  1C21 A;  2NQ6 A;  4JUQ A;  5CNX A; 
#chains in the Genus database with same CATH topology
 2EVC A;  2GG7 A;  3RVA A;  1XGM A;  1R5H A;  1C22 A;  2GGB A;  2GG3 A;  2B3K A;  2Q95 A;  2NQ7 A;  4S2R P;  5E5B A;  5CDE A;  1W7V A;  2ADU A;  1WBQ A;  5CDL A;  2P98 A;  1WLR A;  2BHC A;  1BOA A;  2BB7 A;  1B59 A;  3TAV A;  5D6F A;  3D27 A;  3L7G A;  4R60 A;  4U71 A;  1M35 A;  2V6C A;  4U69 A;  5FCF A;  4MAT A;  1KP0 A;  2G6P A;  5JI6 A;  2GGC A;  2GG5 A;  2OAZ A;  1JAW A;  3IU9 A;  4U6J A;  1R5G A;  2Q93 A;  2GG0 A;  3IU8 A;  4PV4 A;  4U6Z A;  2GA2 A;  2GTX A;  1W2M A;  3FMR A;  4ZNG A;  1CHM A;  1YW9 A;  3Q6D A;  1WL9 A;  4ZWO A;  4KM3 A;  1Y1N A;  1O0X A;  3BIT A;  2IW2 A;  1KQ9 A;  2GZ5 A;  2GG9 A;  4S2T P;  1WN1 A;  2BWW A;  4U6C A;  4ZWP A;  4U70 A;  4FO7 A;  4IKT A;  4IKU A;  2BWU A;  1YW8 A;  5CE6 A;  3CB5 A;  4Z7M A;  1PV9 A;  5FCH A;  1QXY A;  2GG8 A;  1C23 A;  2GU5 A;  4IF7 A;  2EA2 A;  4U76 A;  2P9A A;  3BIQ A;  3PKA A;  2BWT A;  2GU7 A;  2BWV A;  1QXZ A;  3FMQ A;  5D6E A;  2BWS A;  2Q92 A;  1WL6 A;  3PKC A;  2Q96 A;  4EGE A;  4U73 A;  4OOK A;  2GU4 A;  1MAT A;  5CLS A;  2EA4 A;  3MX6 A;  3BIP A;  3FM3 A;  1WKM A;  2Q94 A;  4U75 A;  2B3L A;  3MAT A;  2GG2 A;  2B3H A;  4FLJ A;  1R58 A;  2Q8K A;  1YJ3 A;  4IPA A;  2P99 A;  2MAT A;  2BWY A;  1BN5 A;  2EVO A;  1XGS A;  2EVM A;  3S6B A;  2BN7 A;  4IEC A;  4B28 A;  4S00 A;  2V3Z A;  4A6W A;  3IU7 A;  3L24 A;  3IG4 A;  4IU6 A;  2BHA A;  1C24 A;  2HOW A;  3CTZ A;  4U6W A;  4FLK A;  4U6E A;  2BWX A;  1WY2 A;  4S01 A;  4FUK A;  4PNC A;  1N51 A;  4RZY A;  5CDV A;  3CB6 A;  1YW7 A;  3PKB A;  2DFI A;  1XNZ A;  2GU6 A;  4IKR A;  4FLI A;  1B6A A;  4IKS A;  2ZSG A;  3PKD A;  2OKN A;  4IDY A;  4FLL A;  4RZZ A;  1YVM A;  5CIK A;  5JFR A;  2V3Y A;  1XGO A;  4FO8 A;  4HXX A;  4QR8 A;  1A16 A;  4U1B A;  4ZWU A;  2BHB A;  3MR1 A;  1QXW A;  4A6V A;  1XGN A;  1C27 A;  3PKE A;  1QZY A;  2V3X A;  3ROR A;  1KQ0 A;  2BH3 A;  4RGZ 1;  5JHU A;  2BHD A;  4FKC A;  3TB5 A;  1C21 A;  2NQ6 A;  4JUQ A;  5CNX A; 
#chains in the Genus database with same CATH homology
 2EVC A;  2GG7 A;  3RVA A;  1XGM A;  1R5H A;  1C22 A;  2GGB A;  2GG3 A;  2B3K A;  2Q95 A;  2NQ7 A;  4S2R P;  5E5B A;  5CDE A;  1W7V A;  2ADU A;  1WBQ A;  5CDL A;  2P98 A;  1WLR A;  2BHC A;  1BOA A;  2BB7 A;  1B59 A;  3TAV A;  5D6F A;  3D27 A;  3L7G A;  4R60 A;  4U71 A;  1M35 A;  2V6C A;  4U69 A;  5FCF A;  4MAT A;  1KP0 A;  2G6P A;  5JI6 A;  2GGC A;  2GG5 A;  2OAZ A;  1JAW A;  3IU9 A;  4U6J A;  1R5G A;  2Q93 A;  2GG0 A;  3IU8 A;  4PV4 A;  4U6Z A;  2GA2 A;  2GTX A;  1W2M A;  3FMR A;  4ZNG A;  1CHM A;  1YW9 A;  3Q6D A;  1WL9 A;  4ZWO A;  4KM3 A;  1Y1N A;  1O0X A;  3BIT A;  2IW2 A;  1KQ9 A;  2GZ5 A;  2GG9 A;  4S2T P;  1WN1 A;  2BWW A;  4U6C A;  4ZWP A;  4U70 A;  4FO7 A;  4IKT A;  4IKU A;  2BWU A;  1YW8 A;  5CE6 A;  3CB5 A;  4Z7M A;  1PV9 A;  5FCH A;  1QXY A;  2GG8 A;  1C23 A;  2GU5 A;  4IF7 A;  2EA2 A;  4U76 A;  2P9A A;  3BIQ A;  3PKA A;  2BWT A;  2GU7 A;  2BWV A;  1QXZ A;  3FMQ A;  5D6E A;  2BWS A;  2Q92 A;  1WL6 A;  3PKC A;  2Q96 A;  4EGE A;  4U73 A;  4OOK A;  2GU4 A;  1MAT A;  5CLS A;  2EA4 A;  3MX6 A;  3BIP A;  3FM3 A;  1WKM A;  2Q94 A;  4U75 A;  2B3L A;  3MAT A;  2GG2 A;  2B3H A;  4FLJ A;  1R58 A;  2Q8K A;  1YJ3 A;  4IPA A;  2P99 A;  2MAT A;  2BWY A;  1BN5 A;  2EVO A;  1XGS A;  2EVM A;  3S6B A;  2BN7 A;  4IEC A;  4B28 A;  4S00 A;  2V3Z A;  4A6W A;  3IU7 A;  3L24 A;  3IG4 A;  4IU6 A;  2BHA A;  1C24 A;  2HOW A;  3CTZ A;  4U6W A;  4FLK A;  4U6E A;  2BWX A;  1WY2 A;  4S01 A;  4FUK A;  4PNC A;  1N51 A;  4RZY A;  5CDV A;  3CB6 A;  1YW7 A;  3PKB A;  2DFI A;  1XNZ A;  2GU6 A;  4IKR A;  4FLI A;  1B6A A;  4IKS A;  2ZSG A;  3PKD A;  2OKN A;  4IDY A;  4FLL A;  4RZZ A;  1YVM A;  5CIK A;  5JFR A;  2V3Y A;  1XGO A;  4FO8 A;  4HXX A;  4QR8 A;  1A16 A;  4U1B A;  4ZWU A;  2BHB A;  3MR1 A;  1QXW A;  4A6V A;  1XGN A;  1C27 A;  3PKE A;  1QZY A;  2V3X A;  3ROR A;  1KQ0 A;  2BH3 A;  4RGZ 1;  5JHU A;  2BHD A;  4FKC A;  3TB5 A;  1C21 A;  2NQ6 A;  4JUQ A;  5CNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...