4IKTA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(5-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iktA00
2B3LA 2Q94A 3PKBA 1YW9A 2GGBA 4B28A 1YW8A 2GU5A 2BWVA 1KQ0A 2GG5A 2BWSA 5JHUA 2NQ7A 4U76A 5CNXA 2GG7A 2GG2A 2BWYA 4U69A 4U75A 2DFIA 2P98A 3FMRA 2OKNA 3BIPA 2EVOA 3Q6DA 4FKCA 2GG0A 2ZSGA 2BHAA 4ZNGA 5JFRA 1WKMA 2GU6A 3RORA 3CB5A 2ADUA 2V3XA 2HOWA 3PKDA 2V6CA 2B3HA 3TAVA 5CDVA 4IDYA 3L24A 2BWTA 2BH3A 3FM3A 5D6FA 4IPAA 4U6EA 2V3YA 5CIKA 4QR8A 1R58A 4MATA 1QXWA 2BWUA 4PNCA 1CHMA 2EVCA 1XGOA 1QZYA 1B59A 4Z7MA 3BIQA 4KM3A 4ZWOA 2EVMA 2GU7A 3D27A 4FUKA 1MATA 1A16A 2MATA 1C27A 3IU9A 4HXXA 4IU6A 1QXYA 4EGEA 2BHDA 4A6WA 4A6VA 1C21A 1KP0A 1R5GA 2BHCA 4IF7A 4U6WA 1BN5A 1B6AA 1XNZA 1R5HA 2EA4A 1XGSA 1N51A 4U1BA 2NQ6A 1WLRA 3IU7A 4JUQA 2V3ZA 2BN7A 1JAWA 2OAZA 1Y1NA 2GG3A 4R60A 2Q95A 4S2TP 2GTXA 1C24A 5CDLA 3RVAA 2GG9A 1KQ9A 2G6PA 2BHBA 4U6JA 2Q92A 1O0XA 3FMQA 4IKRA 3IG4A 4RZYA 3PKAA 4IKSA 3L7GA 1C23A 5CLSA 5D6EA 4U73A 4IKTA 1WL9A 3PKCA 4S00A 1BOAA 3MR1A 4U6ZA 1PV9A 4OOKA 4ZWPA 4U6CA 2GG8A 1WY2A 5FCHA 1M35A 4IECA 5CE6A 2P99A 4RGZ1 1WBQA 1YW7A 2BB7A 3BITA 4FO8A 4IKUA 4PV4A 5FCFA 5JI6A 5E5BA 3CB6A 3TB5A 2BWXA 1YJ3A 2GU4A 2B3KA 1WN1A 4S01A 1XGMA 2P9AA 2GA2A 4S2RP 1YVMA 4FLKA 2GGCA 4U70A 1W2MA 1W7VA 4FO7A 4FLLA 2IW2A 2GZ5A 2Q93A 3MATA 4RZZA 5CDEA 2EA2A 1XGNA 4U71A 4ZWUA 1C22A 2Q96A 4FLIA 1WL6A 3CTZA 2Q8KA 3S6BA 4FLJA 3MX6A 2BWWA 1QXZA 3PKEA 3IU8A
chains in the Genus database with same CATH superfamily
2B3LA 2Q94A 3PKBA 1YW9A 2GGBA 4B28A 1YW8A 2GU5A 2BWVA 1KQ0A 2GG5A 2BWSA 5JHUA 2NQ7A 4U76A 5CNXA 2GG7A 2GG2A 2BWYA 4U69A 4U75A 2DFIA 2P98A 3FMRA 2OKNA 3BIPA 2EVOA 3Q6DA 4FKCA 2GG0A 2ZSGA 2BHAA 4ZNGA 5JFRA 1WKMA 2GU6A 3RORA 3CB5A 2ADUA 2V3XA 2HOWA 3PKDA 2V6CA 2B3HA 3TAVA 5CDVA 4IDYA 3L24A 2BWTA 2BH3A 3FM3A 5D6FA 4IPAA 4U6EA 2V3YA 5CIKA 4QR8A 1R58A 4MATA 1QXWA 2BWUA 4PNCA 1CHMA 2EVCA 1XGOA 1QZYA 1B59A 4Z7MA 3BIQA 4KM3A 4ZWOA 2EVMA 2GU7A 3D27A 4FUKA 1MATA 1A16A 2MATA 1C27A 3IU9A 4HXXA 4IU6A 1QXYA 4EGEA 2BHDA 4A6WA 4A6VA 1C21A 1KP0A 1R5GA 2BHCA 4IF7A 4U6WA 1BN5A 1B6AA 1XNZA 1R5HA 2EA4A 1XGSA 1N51A 4U1BA 2NQ6A 1WLRA 3IU7A 4JUQA 2V3ZA 2BN7A 1JAWA 2OAZA 1Y1NA 2GG3A 4R60A 2Q95A 4S2TP 2GTXA 1C24A 5CDLA 3RVAA 2GG9A 1KQ9A 2G6PA 2BHBA 4U6JA 2Q92A 1O0XA 3FMQA 4IKRA 3IG4A 4RZYA 3PKAA 4IKSA 3L7GA 1C23A 5CLSA 5D6EA 4U73A 4IKTA 1WL9A 3PKCA 4S00A 1BOAA 3MR1A 4U6ZA 1PV9A 4OOKA 4ZWPA 4U6CA 2GG8A 1WY2A 5FCHA 1M35A 4IECA 5CE6A 2P99A 4RGZ1 1WBQA 1YW7A 2BB7A 3BITA 4FO8A 4IKUA 4PV4A 5FCFA 5JI6A 5E5BA 3CB6A 3TB5A 2BWXA 1YJ3A 2GU4A 2B3KA 1WN1A 4S01A 1XGMA 2P9AA 2GA2A 4S2RP 1YVMA 4FLKA 2GGCA 4U70A 1W2MA 1W7VA 4FO7A 4FLLA 2IW2A 2GZ5A 2Q93A 3MATA 4RZZA 5CDEA 2EA2A 1XGNA 4U71A 4ZWUA 1C22A 2Q96A 4FLIA 1WL6A 3CTZA 2Q8KA 3S6BA 4FLJA 3MX6A 2BWWA 1QXZA 3PKEA 3IU8A
chains in the Genus database with same CATH topology
2B3LA 2Q94A 3PKBA 1YW9A 2GGBA 4B28A 1YW8A 2GU5A 2BWVA 1KQ0A 2GG5A 2BWSA 5JHUA 2NQ7A 4U76A 5CNXA 2GG7A 2GG2A 2BWYA 4U69A 4U75A 2DFIA 2P98A 3FMRA 2OKNA 3BIPA 2EVOA 3Q6DA 4FKCA 2GG0A 2ZSGA 2BHAA 4ZNGA 5JFRA 1WKMA 2GU6A 3RORA 3CB5A 2ADUA 2V3XA 2HOWA 3PKDA 2V6CA 2B3HA 3TAVA 5CDVA 4IDYA 3L24A 2BWTA 2BH3A 3FM3A 5D6FA 4IPAA 4U6EA 2V3YA 5CIKA 4QR8A 1R58A 4MATA 1QXWA 2BWUA 4PNCA 1CHMA 2EVCA 1XGOA 1QZYA 1B59A 4Z7MA 3BIQA 4KM3A 4ZWOA 2EVMA 2GU7A 3D27A 4FUKA 1MATA 1A16A 2MATA 1C27A 3IU9A 4HXXA 4IU6A 1QXYA 4EGEA 2BHDA 4A6WA 4A6VA 1C21A 1KP0A 1R5GA 2BHCA 4IF7A 4U6WA 1BN5A 1B6AA 1XNZA 1R5HA 2EA4A 1XGSA 1N51A 4U1BA 2NQ6A 1WLRA 3IU7A 4JUQA 2V3ZA 2BN7A 1JAWA 2OAZA 1Y1NA 2GG3A 4R60A 2Q95A 4S2TP 2GTXA 1C24A 5CDLA 3RVAA 2GG9A 1KQ9A 2G6PA 2BHBA 4U6JA 2Q92A 1O0XA 3FMQA 4IKRA 3IG4A 4RZYA 3PKAA 4IKSA 3L7GA 1C23A 5CLSA 5D6EA 4U73A 4IKTA 1WL9A 3PKCA 4S00A 1BOAA 3MR1A 4U6ZA 1PV9A 4OOKA 4ZWPA 4U6CA 2GG8A 1WY2A 5FCHA 1M35A 4IECA 5CE6A 2P99A 4RGZ1 1WBQA 1YW7A 2BB7A 3BITA 4FO8A 4IKUA 4PV4A 5FCFA 5JI6A 5E5BA 3CB6A 3TB5A 2BWXA 1YJ3A 2GU4A 2B3KA 1WN1A 4S01A 1XGMA 2P9AA 2GA2A 4S2RP 1YVMA 4FLKA 2GGCA 4U70A 1W2MA 1W7VA 4FO7A 4FLLA 2IW2A 2GZ5A 2Q93A 3MATA 4RZZA 5CDEA 2EA2A 1XGNA 4U71A 4ZWUA 1C22A 2Q96A 4FLIA 1WL6A 3CTZA 2Q8KA 3S6BA 4FLJA 3MX6A 2BWWA 1QXZA 3PKEA 3IU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3L A;  2Q94 A;  3PKB A;  1YW9 A;  2GGB A;  4B28 A;  1YW8 A;  2GU5 A;  2BWV A;  1KQ0 A;  2GG5 A;  2BWS A;  5JHU A;  2NQ7 A;  4U76 A;  5CNX A;  2GG7 A;  2GG2 A;  2BWY A;  4U69 A;  4U75 A;  2DFI A;  2P98 A;  3FMR A;  2OKN A;  3BIP A;  2EVO A;  3Q6D A;  4FKC A;  2GG0 A;  2ZSG A;  2BHA A;  4ZNG A;  5JFR A;  1WKM A;  2GU6 A;  3ROR A;  3CB5 A;  2ADU A;  2V3X A;  2HOW A;  3PKD A;  2V6C A;  2B3H A;  3TAV A;  5CDV A;  4IDY A;  3L24 A;  2BWT A;  2BH3 A;  3FM3 A;  5D6F A;  4IPA A;  4U6E A;  2V3Y A;  5CIK A;  4QR8 A;  1R58 A;  4MAT A;  1QXW A;  2BWU A;  4PNC A;  1CHM A;  2EVC A;  1XGO A;  1QZY A;  1B59 A;  4Z7M A;  3BIQ A;  4KM3 A;  4ZWO A;  2EVM A;  2GU7 A;  3D27 A;  4FUK A;  1MAT A;  1A16 A;  2MAT A;  1C27 A;  3IU9 A;  4HXX A;  4IU6 A;  1QXY A;  4EGE A;  2BHD A;  4A6W A;  4A6V A;  1C21 A;  1KP0 A;  1R5G A;  2BHC A;  4IF7 A;  4U6W A;  1BN5 A;  1B6A A;  1XNZ A;  1R5H A;  2EA4 A;  1XGS A;  1N51 A;  4U1B A;  2NQ6 A;  1WLR A;  3IU7 A;  4JUQ A;  2V3Z A;  2BN7 A;  1JAW A;  2OAZ A;  1Y1N A;  2GG3 A;  4R60 A;  2Q95 A;  4S2T P;  2GTX A;  1C24 A;  5CDL A;  3RVA A;  2GG9 A;  1KQ9 A;  2G6P A;  2BHB A;  4U6J A;  2Q92 A;  1O0X A;  3FMQ A;  4IKR A;  3IG4 A;  4RZY A;  3PKA A;  4IKS A;  3L7G A;  1C23 A;  5CLS A;  5D6E A;  4U73 A;  4IKT A;  1WL9 A;  3PKC A;  4S00 A;  1BOA A;  3MR1 A;  4U6Z A;  1PV9 A;  4OOK A;  4ZWP A;  4U6C A;  2GG8 A;  1WY2 A;  5FCH A;  1M35 A;  4IEC A;  5CE6 A;  2P99 A;  4RGZ 1;  1WBQ A;  1YW7 A;  2BB7 A;  3BIT A;  4FO8 A;  4IKU A;  4PV4 A;  5FCF A;  5JI6 A;  5E5B A;  3CB6 A;  3TB5 A;  2BWX A;  1YJ3 A;  2GU4 A;  2B3K A;  1WN1 A;  4S01 A;  1XGM A;  2P9A A;  2GA2 A;  4S2R P;  1YVM A;  4FLK A;  2GGC A;  4U70 A;  1W2M A;  1W7V A;  4FO7 A;  4FLL A;  2IW2 A;  2GZ5 A;  2Q93 A;  3MAT A;  4RZZ A;  5CDE A;  2EA2 A;  1XGN A;  4U71 A;  4ZWU A;  1C22 A;  2Q96 A;  4FLI A;  1WL6 A;  3CTZ A;  2Q8K A;  3S6B A;  4FLJ A;  3MX6 A;  2BWW A;  1QXZ A;  3PKE A;  3IU8 A; 
#chains in the Genus database with same CATH topology
 2B3L A;  2Q94 A;  3PKB A;  1YW9 A;  2GGB A;  4B28 A;  1YW8 A;  2GU5 A;  2BWV A;  1KQ0 A;  2GG5 A;  2BWS A;  5JHU A;  2NQ7 A;  4U76 A;  5CNX A;  2GG7 A;  2GG2 A;  2BWY A;  4U69 A;  4U75 A;  2DFI A;  2P98 A;  3FMR A;  2OKN A;  3BIP A;  2EVO A;  3Q6D A;  4FKC A;  2GG0 A;  2ZSG A;  2BHA A;  4ZNG A;  5JFR A;  1WKM A;  2GU6 A;  3ROR A;  3CB5 A;  2ADU A;  2V3X A;  2HOW A;  3PKD A;  2V6C A;  2B3H A;  3TAV A;  5CDV A;  4IDY A;  3L24 A;  2BWT A;  2BH3 A;  3FM3 A;  5D6F A;  4IPA A;  4U6E A;  2V3Y A;  5CIK A;  4QR8 A;  1R58 A;  4MAT A;  1QXW A;  2BWU A;  4PNC A;  1CHM A;  2EVC A;  1XGO A;  1QZY A;  1B59 A;  4Z7M A;  3BIQ A;  4KM3 A;  4ZWO A;  2EVM A;  2GU7 A;  3D27 A;  4FUK A;  1MAT A;  1A16 A;  2MAT A;  1C27 A;  3IU9 A;  4HXX A;  4IU6 A;  1QXY A;  4EGE A;  2BHD A;  4A6W A;  4A6V A;  1C21 A;  1KP0 A;  1R5G A;  2BHC A;  4IF7 A;  4U6W A;  1BN5 A;  1B6A A;  1XNZ A;  1R5H A;  2EA4 A;  1XGS A;  1N51 A;  4U1B A;  2NQ6 A;  1WLR A;  3IU7 A;  4JUQ A;  2V3Z A;  2BN7 A;  1JAW A;  2OAZ A;  1Y1N A;  2GG3 A;  4R60 A;  2Q95 A;  4S2T P;  2GTX A;  1C24 A;  5CDL A;  3RVA A;  2GG9 A;  1KQ9 A;  2G6P A;  2BHB A;  4U6J A;  2Q92 A;  1O0X A;  3FMQ A;  4IKR A;  3IG4 A;  4RZY A;  3PKA A;  4IKS A;  3L7G A;  1C23 A;  5CLS A;  5D6E A;  4U73 A;  4IKT A;  1WL9 A;  3PKC A;  4S00 A;  1BOA A;  3MR1 A;  4U6Z A;  1PV9 A;  4OOK A;  4ZWP A;  4U6C A;  2GG8 A;  1WY2 A;  5FCH A;  1M35 A;  4IEC A;  5CE6 A;  2P99 A;  4RGZ 1;  1WBQ A;  1YW7 A;  2BB7 A;  3BIT A;  4FO8 A;  4IKU A;  4PV4 A;  5FCF A;  5JI6 A;  5E5B A;  3CB6 A;  3TB5 A;  2BWX A;  1YJ3 A;  2GU4 A;  2B3K A;  1WN1 A;  4S01 A;  1XGM A;  2P9A A;  2GA2 A;  4S2R P;  1YVM A;  4FLK A;  2GGC A;  4U70 A;  1W2M A;  1W7V A;  4FO7 A;  4FLL A;  2IW2 A;  2GZ5 A;  2Q93 A;  3MAT A;  4RZZ A;  5CDE A;  2EA2 A;  1XGN A;  4U71 A;  4ZWU A;  1C22 A;  2Q96 A;  4FLI A;  1WL6 A;  3CTZ A;  2Q8K A;  3S6B A;  4FLJ A;  3MX6 A;  2BWW A;  1QXZ A;  3PKE A;  3IU8 A; 
#chains in the Genus database with same CATH homology
 2B3L A;  2Q94 A;  3PKB A;  1YW9 A;  2GGB A;  4B28 A;  1YW8 A;  2GU5 A;  2BWV A;  1KQ0 A;  2GG5 A;  2BWS A;  5JHU A;  2NQ7 A;  4U76 A;  5CNX A;  2GG7 A;  2GG2 A;  2BWY A;  4U69 A;  4U75 A;  2DFI A;  2P98 A;  3FMR A;  2OKN A;  3BIP A;  2EVO A;  3Q6D A;  4FKC A;  2GG0 A;  2ZSG A;  2BHA A;  4ZNG A;  5JFR A;  1WKM A;  2GU6 A;  3ROR A;  3CB5 A;  2ADU A;  2V3X A;  2HOW A;  3PKD A;  2V6C A;  2B3H A;  3TAV A;  5CDV A;  4IDY A;  3L24 A;  2BWT A;  2BH3 A;  3FM3 A;  5D6F A;  4IPA A;  4U6E A;  2V3Y A;  5CIK A;  4QR8 A;  1R58 A;  4MAT A;  1QXW A;  2BWU A;  4PNC A;  1CHM A;  2EVC A;  1XGO A;  1QZY A;  1B59 A;  4Z7M A;  3BIQ A;  4KM3 A;  4ZWO A;  2EVM A;  2GU7 A;  3D27 A;  4FUK A;  1MAT A;  1A16 A;  2MAT A;  1C27 A;  3IU9 A;  4HXX A;  4IU6 A;  1QXY A;  4EGE A;  2BHD A;  4A6W A;  4A6V A;  1C21 A;  1KP0 A;  1R5G A;  2BHC A;  4IF7 A;  4U6W A;  1BN5 A;  1B6A A;  1XNZ A;  1R5H A;  2EA4 A;  1XGS A;  1N51 A;  4U1B A;  2NQ6 A;  1WLR A;  3IU7 A;  4JUQ A;  2V3Z A;  2BN7 A;  1JAW A;  2OAZ A;  1Y1N A;  2GG3 A;  4R60 A;  2Q95 A;  4S2T P;  2GTX A;  1C24 A;  5CDL A;  3RVA A;  2GG9 A;  1KQ9 A;  2G6P A;  2BHB A;  4U6J A;  2Q92 A;  1O0X A;  3FMQ A;  4IKR A;  3IG4 A;  4RZY A;  3PKA A;  4IKS A;  3L7G A;  1C23 A;  5CLS A;  5D6E A;  4U73 A;  4IKT A;  1WL9 A;  3PKC A;  4S00 A;  1BOA A;  3MR1 A;  4U6Z A;  1PV9 A;  4OOK A;  4ZWP A;  4U6C A;  2GG8 A;  1WY2 A;  5FCH A;  1M35 A;  4IEC A;  5CE6 A;  2P99 A;  4RGZ 1;  1WBQ A;  1YW7 A;  2BB7 A;  3BIT A;  4FO8 A;  4IKU A;  4PV4 A;  5FCF A;  5JI6 A;  5E5B A;  3CB6 A;  3TB5 A;  2BWX A;  1YJ3 A;  2GU4 A;  2B3K A;  1WN1 A;  4S01 A;  1XGM A;  2P9A A;  2GA2 A;  4S2R P;  1YVM A;  4FLK A;  2GGC A;  4U70 A;  1W2M A;  1W7V A;  4FO7 A;  4FLL A;  2IW2 A;  2GZ5 A;  2Q93 A;  3MAT A;  4RZZ A;  5CDE A;  2EA2 A;  1XGN A;  4U71 A;  4ZWU A;  1C22 A;  2Q96 A;  4FLI A;  1WL6 A;  3CTZ A;  2Q8K A;  3S6B A;  4FLJ A;  3MX6 A;  2BWW A;  1QXZ A;  3PKE A;  3IU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...