4IKTA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(5-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iktA00
5CDEA 1YJ3A 1YVMA 2MATA 4RGZ1 1QXZA 1W7VA 4S2TP 4A6WA 2BHCA 3PKBA 1YW9A 4RZZA 1YW8A 4IF7A 1R58A 2GZ5A 1KQ9A 1QXWA 4U73A 1CHMA 2BWYA 3IG4A 4U75A 1A16A 4FO7A 4IECA 1WLRA 2BWXA 4U71A 2EVOA 2P9AA 5JFRA 1R5HA 1JAWA 4U76A 5D6EA 2Q93A 4U69A 3RVAA 1M35A 4S01A 3FMRA 5E5BA 2NQ7A 4RZYA 5CLSA 2GTXA 3TB5A 2GG9A 1XNZA 2V6CA 5JHUA 5FCFA 2GG5A 4A6VA 1C24A 4EGEA 3IU8A 4U6ZA 2DFIA 1C22A 2GG0A 4R60A 4U6WA 4IKTA 5CIKA 5JI6A 3MATA 3IU7A 5CDVA 2Q94A 3IU9A 1MATA 2ADUA 3BIPA 4ZWPA 4S2RP 4S00A 2Q8KA 3Q6DA 2B3KA 2BHDA 2BWUA 2EVCA 3BITA 2OAZA 5CE6A 1B59A 4FLLA 1KP0A 3FMQA 2GU6A 2GG2A 4IDYA 4FLKA 1YW7A 4IPAA 2GGCA 5CNXA 2BHAA 1N51A 1C27A 2BWTA 4JUQA 1Y1NA 1QXYA 4FKCA 1WY2A 1R5GA 1PV9A 4FO8A 4U1BA 1QZYA 2G6PA 2GG3A 2IW2A 2BWSA 1WL9A 3CTZA 1WN1A 2BH3A 2EA4A 4IKRA 3RORA 2B3LA 2P99A 4OOKA 1WL6A 3MX6A 5CDLA 4FLJA 4ZWUA 2HOWA 2BWVA 4FLIA 1XGMA 3PKCA 3FM3A 4PNCA 2NQ6A 2P98A 3TAVA 2OKNA 4PV4A 1WKMA 3CB6A 1KQ0A 1XGSA 1O0XA 1XGNA 3L24A 1C21A 2EA2A 2BB7A 3PKEA 4B28A 4IU6A 1WBQA 2BWWA 2V3XA 3D27A 2GU4A 2B3HA 3PKDA 3S6BA 3L7GA 4U6JA 4U6EA 2Q95A 4HXXA 2EVMA 2BN7A 2V3ZA 3PKAA 1B6AA 1C23A 2GGBA 2Q92A 4Z7MA 2GG8A 2GU5A 4U70A 2GU7A 3BIQA 3CB5A 4IKSA 3MR1A 4ZWOA 5FCHA 1BN5A 4U6CA 1XGOA 4MATA 1W2MA 4QR8A 4FUKA 4IKUA 4KM3A 2GA2A 4ZNGA 2BHBA 2GG7A 2Q96A 2ZSGA 5D6FA 2V3YA 1BOAA
chains in the Genus database with same CATH superfamily
5CDEA 1YJ3A 1YVMA 2MATA 4RGZ1 1QXZA 1W7VA 4S2TP 4A6WA 2BHCA 3PKBA 1YW9A 4RZZA 1YW8A 4IF7A 1R58A 2GZ5A 1KQ9A 1QXWA 4U73A 1CHMA 2BWYA 3IG4A 4U75A 1A16A 4FO7A 4IECA 1WLRA 2BWXA 4U71A 2EVOA 2P9AA 5JFRA 1R5HA 1JAWA 4U76A 5D6EA 2Q93A 4U69A 3RVAA 1M35A 4S01A 3FMRA 5E5BA 2NQ7A 4RZYA 5CLSA 2GTXA 3TB5A 2GG9A 1XNZA 2V6CA 5JHUA 5FCFA 2GG5A 4A6VA 1C24A 4EGEA 3IU8A 4U6ZA 2DFIA 1C22A 2GG0A 4R60A 4U6WA 4IKTA 5CIKA 5JI6A 3MATA 3IU7A 5CDVA 2Q94A 3IU9A 1MATA 2ADUA 3BIPA 4ZWPA 4S2RP 4S00A 2Q8KA 3Q6DA 2B3KA 2BHDA 2BWUA 2EVCA 3BITA 2OAZA 5CE6A 1B59A 4FLLA 1KP0A 3FMQA 2GU6A 2GG2A 4IDYA 4FLKA 1YW7A 4IPAA 2GGCA 5CNXA 2BHAA 1N51A 1C27A 2BWTA 4JUQA 1Y1NA 1QXYA 4FKCA 1WY2A 1R5GA 1PV9A 4FO8A 4U1BA 1QZYA 2G6PA 2GG3A 2IW2A 2BWSA 1WL9A 3CTZA 1WN1A 2BH3A 2EA4A 4IKRA 3RORA 2B3LA 2P99A 4OOKA 1WL6A 3MX6A 5CDLA 4FLJA 4ZWUA 2HOWA 2BWVA 4FLIA 1XGMA 3PKCA 3FM3A 4PNCA 2NQ6A 2P98A 3TAVA 2OKNA 4PV4A 1WKMA 3CB6A 1KQ0A 1XGSA 1O0XA 1XGNA 3L24A 1C21A 2EA2A 2BB7A 3PKEA 4B28A 4IU6A 1WBQA 2BWWA 2V3XA 3D27A 2GU4A 2B3HA 3PKDA 3S6BA 3L7GA 4U6JA 4U6EA 2Q95A 4HXXA 2EVMA 2BN7A 2V3ZA 3PKAA 1B6AA 1C23A 2GGBA 2Q92A 4Z7MA 2GG8A 2GU5A 4U70A 2GU7A 3BIQA 3CB5A 4IKSA 3MR1A 4ZWOA 5FCHA 1BN5A 4U6CA 1XGOA 4MATA 1W2MA 4QR8A 4FUKA 4IKUA 4KM3A 2GA2A 4ZNGA 2BHBA 2GG7A 2Q96A 2ZSGA 5D6FA 2V3YA 1BOAA
chains in the Genus database with same CATH topology
5CDEA 1YJ3A 1YVMA 2MATA 4RGZ1 1QXZA 1W7VA 4S2TP 4A6WA 2BHCA 3PKBA 1YW9A 4RZZA 1YW8A 4IF7A 1R58A 2GZ5A 1KQ9A 1QXWA 4U73A 1CHMA 2BWYA 3IG4A 4U75A 1A16A 4FO7A 4IECA 1WLRA 2BWXA 4U71A 2EVOA 2P9AA 5JFRA 1R5HA 1JAWA 4U76A 5D6EA 2Q93A 4U69A 3RVAA 1M35A 4S01A 3FMRA 5E5BA 2NQ7A 4RZYA 5CLSA 2GTXA 3TB5A 2GG9A 1XNZA 2V6CA 5JHUA 5FCFA 2GG5A 4A6VA 1C24A 4EGEA 3IU8A 4U6ZA 2DFIA 1C22A 2GG0A 4R60A 4U6WA 4IKTA 5CIKA 5JI6A 3MATA 3IU7A 5CDVA 2Q94A 3IU9A 1MATA 2ADUA 3BIPA 4ZWPA 4S2RP 4S00A 2Q8KA 3Q6DA 2B3KA 2BHDA 2BWUA 2EVCA 3BITA 2OAZA 5CE6A 1B59A 4FLLA 1KP0A 3FMQA 2GU6A 2GG2A 4IDYA 4FLKA 1YW7A 4IPAA 2GGCA 5CNXA 2BHAA 1N51A 1C27A 2BWTA 4JUQA 1Y1NA 1QXYA 4FKCA 1WY2A 1R5GA 1PV9A 4FO8A 4U1BA 1QZYA 2G6PA 2GG3A 2IW2A 2BWSA 1WL9A 3CTZA 1WN1A 2BH3A 2EA4A 4IKRA 3RORA 2B3LA 2P99A 4OOKA 1WL6A 3MX6A 5CDLA 4FLJA 4ZWUA 2HOWA 2BWVA 4FLIA 1XGMA 3PKCA 3FM3A 4PNCA 2NQ6A 2P98A 3TAVA 2OKNA 4PV4A 1WKMA 3CB6A 1KQ0A 1XGSA 1O0XA 1XGNA 3L24A 1C21A 2EA2A 2BB7A 3PKEA 4B28A 4IU6A 1WBQA 2BWWA 2V3XA 3D27A 2GU4A 2B3HA 3PKDA 3S6BA 3L7GA 4U6JA 4U6EA 2Q95A 4HXXA 2EVMA 2BN7A 2V3ZA 3PKAA 1B6AA 1C23A 2GGBA 2Q92A 4Z7MA 2GG8A 2GU5A 4U70A 2GU7A 3BIQA 3CB5A 4IKSA 3MR1A 4ZWOA 5FCHA 1BN5A 4U6CA 1XGOA 4MATA 1W2MA 4QR8A 4FUKA 4IKUA 4KM3A 2GA2A 4ZNGA 2BHBA 2GG7A 2Q96A 2ZSGA 5D6FA 2V3YA 1BOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CDE A;  1YJ3 A;  1YVM A;  2MAT A;  4RGZ 1;  1QXZ A;  1W7V A;  4S2T P;  4A6W A;  2BHC A;  3PKB A;  1YW9 A;  4RZZ A;  1YW8 A;  4IF7 A;  1R58 A;  2GZ5 A;  1KQ9 A;  1QXW A;  4U73 A;  1CHM A;  2BWY A;  3IG4 A;  4U75 A;  1A16 A;  4FO7 A;  4IEC A;  1WLR A;  2BWX A;  4U71 A;  2EVO A;  2P9A A;  5JFR A;  1R5H A;  1JAW A;  4U76 A;  5D6E A;  2Q93 A;  4U69 A;  3RVA A;  1M35 A;  4S01 A;  3FMR A;  5E5B A;  2NQ7 A;  4RZY A;  5CLS A;  2GTX A;  3TB5 A;  2GG9 A;  1XNZ A;  2V6C A;  5JHU A;  5FCF A;  2GG5 A;  4A6V A;  1C24 A;  4EGE A;  3IU8 A;  4U6Z A;  2DFI A;  1C22 A;  2GG0 A;  4R60 A;  4U6W A;  4IKT A;  5CIK A;  5JI6 A;  3MAT A;  3IU7 A;  5CDV A;  2Q94 A;  3IU9 A;  1MAT A;  2ADU A;  3BIP A;  4ZWP A;  4S2R P;  4S00 A;  2Q8K A;  3Q6D A;  2B3K A;  2BHD A;  2BWU A;  2EVC A;  3BIT A;  2OAZ A;  5CE6 A;  1B59 A;  4FLL A;  1KP0 A;  3FMQ A;  2GU6 A;  2GG2 A;  4IDY A;  4FLK A;  1YW7 A;  4IPA A;  2GGC A;  5CNX A;  2BHA A;  1N51 A;  1C27 A;  2BWT A;  4JUQ A;  1Y1N A;  1QXY A;  4FKC A;  1WY2 A;  1R5G A;  1PV9 A;  4FO8 A;  4U1B A;  1QZY A;  2G6P A;  2GG3 A;  2IW2 A;  2BWS A;  1WL9 A;  3CTZ A;  1WN1 A;  2BH3 A;  2EA4 A;  4IKR A;  3ROR A;  2B3L A;  2P99 A;  4OOK A;  1WL6 A;  3MX6 A;  5CDL A;  4FLJ A;  4ZWU A;  2HOW A;  2BWV A;  4FLI A;  1XGM A;  3PKC A;  3FM3 A;  4PNC A;  2NQ6 A;  2P98 A;  3TAV A;  2OKN A;  4PV4 A;  1WKM A;  3CB6 A;  1KQ0 A;  1XGS A;  1O0X A;  1XGN A;  3L24 A;  1C21 A;  2EA2 A;  2BB7 A;  3PKE A;  4B28 A;  4IU6 A;  1WBQ A;  2BWW A;  2V3X A;  3D27 A;  2GU4 A;  2B3H A;  3PKD A;  3S6B A;  3L7G A;  4U6J A;  4U6E A;  2Q95 A;  4HXX A;  2EVM A;  2BN7 A;  2V3Z A;  3PKA A;  1B6A A;  1C23 A;  2GGB A;  2Q92 A;  4Z7M A;  2GG8 A;  2GU5 A;  4U70 A;  2GU7 A;  3BIQ A;  3CB5 A;  4IKS A;  3MR1 A;  4ZWO A;  5FCH A;  1BN5 A;  4U6C A;  1XGO A;  4MAT A;  1W2M A;  4QR8 A;  4FUK A;  4IKU A;  4KM3 A;  2GA2 A;  4ZNG A;  2BHB A;  2GG7 A;  2Q96 A;  2ZSG A;  5D6F A;  2V3Y A;  1BOA A; 
#chains in the Genus database with same CATH topology
 5CDE A;  1YJ3 A;  1YVM A;  2MAT A;  4RGZ 1;  1QXZ A;  1W7V A;  4S2T P;  4A6W A;  2BHC A;  3PKB A;  1YW9 A;  4RZZ A;  1YW8 A;  4IF7 A;  1R58 A;  2GZ5 A;  1KQ9 A;  1QXW A;  4U73 A;  1CHM A;  2BWY A;  3IG4 A;  4U75 A;  1A16 A;  4FO7 A;  4IEC A;  1WLR A;  2BWX A;  4U71 A;  2EVO A;  2P9A A;  5JFR A;  1R5H A;  1JAW A;  4U76 A;  5D6E A;  2Q93 A;  4U69 A;  3RVA A;  1M35 A;  4S01 A;  3FMR A;  5E5B A;  2NQ7 A;  4RZY A;  5CLS A;  2GTX A;  3TB5 A;  2GG9 A;  1XNZ A;  2V6C A;  5JHU A;  5FCF A;  2GG5 A;  4A6V A;  1C24 A;  4EGE A;  3IU8 A;  4U6Z A;  2DFI A;  1C22 A;  2GG0 A;  4R60 A;  4U6W A;  4IKT A;  5CIK A;  5JI6 A;  3MAT A;  3IU7 A;  5CDV A;  2Q94 A;  3IU9 A;  1MAT A;  2ADU A;  3BIP A;  4ZWP A;  4S2R P;  4S00 A;  2Q8K A;  3Q6D A;  2B3K A;  2BHD A;  2BWU A;  2EVC A;  3BIT A;  2OAZ A;  5CE6 A;  1B59 A;  4FLL A;  1KP0 A;  3FMQ A;  2GU6 A;  2GG2 A;  4IDY A;  4FLK A;  1YW7 A;  4IPA A;  2GGC A;  5CNX A;  2BHA A;  1N51 A;  1C27 A;  2BWT A;  4JUQ A;  1Y1N A;  1QXY A;  4FKC A;  1WY2 A;  1R5G A;  1PV9 A;  4FO8 A;  4U1B A;  1QZY A;  2G6P A;  2GG3 A;  2IW2 A;  2BWS A;  1WL9 A;  3CTZ A;  1WN1 A;  2BH3 A;  2EA4 A;  4IKR A;  3ROR A;  2B3L A;  2P99 A;  4OOK A;  1WL6 A;  3MX6 A;  5CDL A;  4FLJ A;  4ZWU A;  2HOW A;  2BWV A;  4FLI A;  1XGM A;  3PKC A;  3FM3 A;  4PNC A;  2NQ6 A;  2P98 A;  3TAV A;  2OKN A;  4PV4 A;  1WKM A;  3CB6 A;  1KQ0 A;  1XGS A;  1O0X A;  1XGN A;  3L24 A;  1C21 A;  2EA2 A;  2BB7 A;  3PKE A;  4B28 A;  4IU6 A;  1WBQ A;  2BWW A;  2V3X A;  3D27 A;  2GU4 A;  2B3H A;  3PKD A;  3S6B A;  3L7G A;  4U6J A;  4U6E A;  2Q95 A;  4HXX A;  2EVM A;  2BN7 A;  2V3Z A;  3PKA A;  1B6A A;  1C23 A;  2GGB A;  2Q92 A;  4Z7M A;  2GG8 A;  2GU5 A;  4U70 A;  2GU7 A;  3BIQ A;  3CB5 A;  4IKS A;  3MR1 A;  4ZWO A;  5FCH A;  1BN5 A;  4U6C A;  1XGO A;  4MAT A;  1W2M A;  4QR8 A;  4FUK A;  4IKU A;  4KM3 A;  2GA2 A;  4ZNG A;  2BHB A;  2GG7 A;  2Q96 A;  2ZSG A;  5D6F A;  2V3Y A;  1BOA A; 
#chains in the Genus database with same CATH homology
 5CDE A;  1YJ3 A;  1YVM A;  2MAT A;  4RGZ 1;  1QXZ A;  1W7V A;  4S2T P;  4A6W A;  2BHC A;  3PKB A;  1YW9 A;  4RZZ A;  1YW8 A;  4IF7 A;  1R58 A;  2GZ5 A;  1KQ9 A;  1QXW A;  4U73 A;  1CHM A;  2BWY A;  3IG4 A;  4U75 A;  1A16 A;  4FO7 A;  4IEC A;  1WLR A;  2BWX A;  4U71 A;  2EVO A;  2P9A A;  5JFR A;  1R5H A;  1JAW A;  4U76 A;  5D6E A;  2Q93 A;  4U69 A;  3RVA A;  1M35 A;  4S01 A;  3FMR A;  5E5B A;  2NQ7 A;  4RZY A;  5CLS A;  2GTX A;  3TB5 A;  2GG9 A;  1XNZ A;  2V6C A;  5JHU A;  5FCF A;  2GG5 A;  4A6V A;  1C24 A;  4EGE A;  3IU8 A;  4U6Z A;  2DFI A;  1C22 A;  2GG0 A;  4R60 A;  4U6W A;  4IKT A;  5CIK A;  5JI6 A;  3MAT A;  3IU7 A;  5CDV A;  2Q94 A;  3IU9 A;  1MAT A;  2ADU A;  3BIP A;  4ZWP A;  4S2R P;  4S00 A;  2Q8K A;  3Q6D A;  2B3K A;  2BHD A;  2BWU A;  2EVC A;  3BIT A;  2OAZ A;  5CE6 A;  1B59 A;  4FLL A;  1KP0 A;  3FMQ A;  2GU6 A;  2GG2 A;  4IDY A;  4FLK A;  1YW7 A;  4IPA A;  2GGC A;  5CNX A;  2BHA A;  1N51 A;  1C27 A;  2BWT A;  4JUQ A;  1Y1N A;  1QXY A;  4FKC A;  1WY2 A;  1R5G A;  1PV9 A;  4FO8 A;  4U1B A;  1QZY A;  2G6P A;  2GG3 A;  2IW2 A;  2BWS A;  1WL9 A;  3CTZ A;  1WN1 A;  2BH3 A;  2EA4 A;  4IKR A;  3ROR A;  2B3L A;  2P99 A;  4OOK A;  1WL6 A;  3MX6 A;  5CDL A;  4FLJ A;  4ZWU A;  2HOW A;  2BWV A;  4FLI A;  1XGM A;  3PKC A;  3FM3 A;  4PNC A;  2NQ6 A;  2P98 A;  3TAV A;  2OKN A;  4PV4 A;  1WKM A;  3CB6 A;  1KQ0 A;  1XGS A;  1O0X A;  1XGN A;  3L24 A;  1C21 A;  2EA2 A;  2BB7 A;  3PKE A;  4B28 A;  4IU6 A;  1WBQ A;  2BWW A;  2V3X A;  3D27 A;  2GU4 A;  2B3H A;  3PKD A;  3S6B A;  3L7G A;  4U6J A;  4U6E A;  2Q95 A;  4HXX A;  2EVM A;  2BN7 A;  2V3Z A;  3PKA A;  1B6A A;  1C23 A;  2GGB A;  2Q92 A;  4Z7M A;  2GG8 A;  2GU5 A;  4U70 A;  2GU7 A;  3BIQ A;  3CB5 A;  4IKS A;  3MR1 A;  4ZWO A;  5FCH A;  1BN5 A;  4U6C A;  1XGO A;  4MAT A;  1W2M A;  4QR8 A;  4FUK A;  4IKU A;  4KM3 A;  2GA2 A;  4ZNG A;  2BHB A;  2GG7 A;  2Q96 A;  2ZSG A;  5D6F A;  2V3Y A;  1BOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...