3TAVA

Crystal structure of a methionine aminopeptidase from mycobacterium abscessus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
264
structure length
264
Chain Sequence
VGLFGRKKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSFLGYHGFPASICSSVNDQVVHGIPSATAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAAEKQFDRAFGIVDGYGGHGIGRSMHLDPFLPNEGAPGKGPLLAVGSVLAIEPMLTLGTTQTRVLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 82
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3tavA00
4FLJA 4OOKA 3PKBA 2BH3A 4U71A 5E5BA 3IU8A 3CTZA 3L7GA 3PKEA 1C21A 4IKRA 2Q93A 3IU9A 3IU7A 2V3YA 3FMRA 1N51A 2GG9A 4FLKA 5CDLA 2BWWA 2EA2A 2GA2A 2GZ5A 4FUKA 2BWUA 4IKSA 2Q94A 5CIKA 4RGZ1 4S2RP 5D6FA 1MATA 2GU7A 1C23A 1WLRA 3TAVA 4FLLA 1KP0A 4HXXA 4JUQA 5CDEA 4FKCA 4ZWPA 1WKMA 1YJ3A 2BWXA 1PV9A 4EGEA 2ADUA 4IDYA 1YW9A 2BWSA 4ZWOA 2GG5A 2Q92A 1WN1A 3MX6A 1WL9A 3S6BA 2BWVA 4QR8A 1C27A 1WL6A 2G6PA 4U6EA 1XGSA 3PKDA 1XNZA 2GU4A 2P98A 5JFRA 1XGOA 2IW2A 5FCHA 5D6EA 1B6AA 1YVMA 1YW7A 2V6CA 4IPAA 2BHCA 2GG7A 2OKNA 2NQ7A 4KM3A 4PV4A 4RZYA 4U70A 2P9AA 4PNCA 4U1BA 3Q6DA 2B3HA 2GG3A 4U69A 1YW8A 1A16A 1Y1NA 3CB6A 4IU6A 2GG2A 4U6WA 2Q95A 2Q8KA 3BITA 1R5HA 2BHDA 2OAZA 4U73A 1QXWA 4U6JA 3RVAA 3MATA 1B59A 4FO8A 1WBQA 3FMQA 2MATA 4FO7A 4IF7A 4ZWUA 2V3ZA 3CB5A 4FLIA 2EA4A 1CHMA 4S00A 4RZZA 1R58A 3RORA 2GG0A 3PKAA 1JAWA 2BHAA 5FCFA 1XGNA 2BWYA 1WY2A 1C24A 2GU5A 1R5GA 5JHUA 5CE6A 3PKCA 1W2MA 4IECA 1QXZA 2GG8A 1QZYA 3BIPA 2Q96A 2B3KA 1M35A 4IKUA 2GGCA 2DFIA 2V3XA 3MR1A 4U76A 2BN7A 4S01A 3L24A 3IG4A 1O0XA 2GTXA 1BOAA 1C22A 4U6CA 1BN5A 2BB7A 3FM3A 1QXYA 2GGBA 1W7VA 2EVMA 1XGMA 3BIQA 2BWTA 4ZNGA 5CDVA 5CNXA 1KQ0A 3D27A 2EVCA 2BHBA 4U6ZA 4Z7MA 4A6VA 4A6WA 2ZSGA 4MATA 2GU6A 4R60A 3TB5A 4B28A 2P99A 5JI6A 1KQ9A 2EVOA 4U75A 2HOWA 5CLSA 4IKTA 4S2TP 2B3LA 2NQ6A
chains in the Genus database with same CATH superfamily
4FLJA 4OOKA 3PKBA 2BH3A 4U71A 5E5BA 3IU8A 3CTZA 3L7GA 3PKEA 1C21A 4IKRA 2Q93A 3IU9A 3IU7A 2V3YA 3FMRA 1N51A 2GG9A 4FLKA 5CDLA 2BWWA 2EA2A 2GA2A 2GZ5A 4FUKA 2BWUA 4IKSA 2Q94A 5CIKA 4RGZ1 4S2RP 5D6FA 1MATA 2GU7A 1C23A 1WLRA 3TAVA 4FLLA 1KP0A 4HXXA 4JUQA 5CDEA 4FKCA 4ZWPA 1WKMA 1YJ3A 2BWXA 1PV9A 4EGEA 2ADUA 4IDYA 1YW9A 2BWSA 4ZWOA 2GG5A 2Q92A 1WN1A 3MX6A 1WL9A 3S6BA 2BWVA 4QR8A 1C27A 1WL6A 2G6PA 4U6EA 1XGSA 3PKDA 1XNZA 2GU4A 2P98A 5JFRA 1XGOA 2IW2A 5FCHA 5D6EA 1B6AA 1YVMA 1YW7A 2V6CA 4IPAA 2BHCA 2GG7A 2OKNA 2NQ7A 4KM3A 4PV4A 4RZYA 4U70A 2P9AA 4PNCA 4U1BA 3Q6DA 2B3HA 2GG3A 4U69A 1YW8A 1A16A 1Y1NA 3CB6A 4IU6A 2GG2A 4U6WA 2Q95A 2Q8KA 3BITA 1R5HA 2BHDA 2OAZA 4U73A 1QXWA 4U6JA 3RVAA 3MATA 1B59A 4FO8A 1WBQA 3FMQA 2MATA 4FO7A 4IF7A 4ZWUA 2V3ZA 3CB5A 4FLIA 2EA4A 1CHMA 4S00A 4RZZA 1R58A 3RORA 2GG0A 3PKAA 1JAWA 2BHAA 5FCFA 1XGNA 2BWYA 1WY2A 1C24A 2GU5A 1R5GA 5JHUA 5CE6A 3PKCA 1W2MA 4IECA 1QXZA 2GG8A 1QZYA 3BIPA 2Q96A 2B3KA 1M35A 4IKUA 2GGCA 2DFIA 2V3XA 3MR1A 4U76A 2BN7A 4S01A 3L24A 3IG4A 1O0XA 2GTXA 1BOAA 1C22A 4U6CA 1BN5A 2BB7A 3FM3A 1QXYA 2GGBA 1W7VA 2EVMA 1XGMA 3BIQA 2BWTA 4ZNGA 5CDVA 5CNXA 1KQ0A 3D27A 2EVCA 2BHBA 4U6ZA 4Z7MA 4A6VA 4A6WA 2ZSGA 4MATA 2GU6A 4R60A 3TB5A 4B28A 2P99A 5JI6A 1KQ9A 2EVOA 4U75A 2HOWA 5CLSA 4IKTA 4S2TP 2B3LA 2NQ6A
chains in the Genus database with same CATH topology
4FLJA 4OOKA 3PKBA 2BH3A 4U71A 5E5BA 3IU8A 3CTZA 3L7GA 3PKEA 1C21A 4IKRA 2Q93A 3IU9A 3IU7A 2V3YA 3FMRA 1N51A 2GG9A 4FLKA 5CDLA 2BWWA 2EA2A 2GA2A 2GZ5A 4FUKA 2BWUA 4IKSA 2Q94A 5CIKA 4RGZ1 4S2RP 5D6FA 1MATA 2GU7A 1C23A 1WLRA 3TAVA 4FLLA 1KP0A 4HXXA 4JUQA 5CDEA 4FKCA 4ZWPA 1WKMA 1YJ3A 2BWXA 1PV9A 4EGEA 2ADUA 4IDYA 1YW9A 2BWSA 4ZWOA 2GG5A 2Q92A 1WN1A 3MX6A 1WL9A 3S6BA 2BWVA 4QR8A 1C27A 1WL6A 2G6PA 4U6EA 1XGSA 3PKDA 1XNZA 2GU4A 2P98A 5JFRA 1XGOA 2IW2A 5FCHA 5D6EA 1B6AA 1YVMA 1YW7A 2V6CA 4IPAA 2BHCA 2GG7A 2OKNA 2NQ7A 4KM3A 4PV4A 4RZYA 4U70A 2P9AA 4PNCA 4U1BA 3Q6DA 2B3HA 2GG3A 4U69A 1YW8A 1A16A 1Y1NA 3CB6A 4IU6A 2GG2A 4U6WA 2Q95A 2Q8KA 3BITA 1R5HA 2BHDA 2OAZA 4U73A 1QXWA 4U6JA 3RVAA 3MATA 1B59A 4FO8A 1WBQA 3FMQA 2MATA 4FO7A 4IF7A 4ZWUA 2V3ZA 3CB5A 4FLIA 2EA4A 1CHMA 4S00A 4RZZA 1R58A 3RORA 2GG0A 3PKAA 1JAWA 2BHAA 5FCFA 1XGNA 2BWYA 1WY2A 1C24A 2GU5A 1R5GA 5JHUA 5CE6A 3PKCA 1W2MA 4IECA 1QXZA 2GG8A 1QZYA 3BIPA 2Q96A 2B3KA 1M35A 4IKUA 2GGCA 2DFIA 2V3XA 3MR1A 4U76A 2BN7A 4S01A 3L24A 3IG4A 1O0XA 2GTXA 1BOAA 1C22A 4U6CA 1BN5A 2BB7A 3FM3A 1QXYA 2GGBA 1W7VA 2EVMA 1XGMA 3BIQA 2BWTA 4ZNGA 5CDVA 5CNXA 1KQ0A 3D27A 2EVCA 2BHBA 4U6ZA 4Z7MA 4A6VA 4A6WA 2ZSGA 4MATA 2GU6A 4R60A 3TB5A 4B28A 2P99A 5JI6A 1KQ9A 2EVOA 4U75A 2HOWA 5CLSA 4IKTA 4S2TP 2B3LA 2NQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLJ A;  4OOK A;  3PKB A;  2BH3 A;  4U71 A;  5E5B A;  3IU8 A;  3CTZ A;  3L7G A;  3PKE A;  1C21 A;  4IKR A;  2Q93 A;  3IU9 A;  3IU7 A;  2V3Y A;  3FMR A;  1N51 A;  2GG9 A;  4FLK A;  5CDL A;  2BWW A;  2EA2 A;  2GA2 A;  2GZ5 A;  4FUK A;  2BWU A;  4IKS A;  2Q94 A;  5CIK A;  4RGZ 1;  4S2R P;  5D6F A;  1MAT A;  2GU7 A;  1C23 A;  1WLR A;  3TAV A;  4FLL A;  1KP0 A;  4HXX A;  4JUQ A;  5CDE A;  4FKC A;  4ZWP A;  1WKM A;  1YJ3 A;  2BWX A;  1PV9 A;  4EGE A;  2ADU A;  4IDY A;  1YW9 A;  2BWS A;  4ZWO A;  2GG5 A;  2Q92 A;  1WN1 A;  3MX6 A;  1WL9 A;  3S6B A;  2BWV A;  4QR8 A;  1C27 A;  1WL6 A;  2G6P A;  4U6E A;  1XGS A;  3PKD A;  1XNZ A;  2GU4 A;  2P98 A;  5JFR A;  1XGO A;  2IW2 A;  5FCH A;  5D6E A;  1B6A A;  1YVM A;  1YW7 A;  2V6C A;  4IPA A;  2BHC A;  2GG7 A;  2OKN A;  2NQ7 A;  4KM3 A;  4PV4 A;  4RZY A;  4U70 A;  2P9A A;  4PNC A;  4U1B A;  3Q6D A;  2B3H A;  2GG3 A;  4U69 A;  1YW8 A;  1A16 A;  1Y1N A;  3CB6 A;  4IU6 A;  2GG2 A;  4U6W A;  2Q95 A;  2Q8K A;  3BIT A;  1R5H A;  2BHD A;  2OAZ A;  4U73 A;  1QXW A;  4U6J A;  3RVA A;  3MAT A;  1B59 A;  4FO8 A;  1WBQ A;  3FMQ A;  2MAT A;  4FO7 A;  4IF7 A;  4ZWU A;  2V3Z A;  3CB5 A;  4FLI A;  2EA4 A;  1CHM A;  4S00 A;  4RZZ A;  1R58 A;  3ROR A;  2GG0 A;  3PKA A;  1JAW A;  2BHA A;  5FCF A;  1XGN A;  2BWY A;  1WY2 A;  1C24 A;  2GU5 A;  1R5G A;  5JHU A;  5CE6 A;  3PKC A;  1W2M A;  4IEC A;  1QXZ A;  2GG8 A;  1QZY A;  3BIP A;  2Q96 A;  2B3K A;  1M35 A;  4IKU A;  2GGC A;  2DFI A;  2V3X A;  3MR1 A;  4U76 A;  2BN7 A;  4S01 A;  3L24 A;  3IG4 A;  1O0X A;  2GTX A;  1BOA A;  1C22 A;  4U6C A;  1BN5 A;  2BB7 A;  3FM3 A;  1QXY A;  2GGB A;  1W7V A;  2EVM A;  1XGM A;  3BIQ A;  2BWT A;  4ZNG A;  5CDV A;  5CNX A;  1KQ0 A;  3D27 A;  2EVC A;  2BHB A;  4U6Z A;  4Z7M A;  4A6V A;  4A6W A;  2ZSG A;  4MAT A;  2GU6 A;  4R60 A;  3TB5 A;  4B28 A;  2P99 A;  5JI6 A;  1KQ9 A;  2EVO A;  4U75 A;  2HOW A;  5CLS A;  4IKT A;  4S2T P;  2B3L A;  2NQ6 A; 
#chains in the Genus database with same CATH topology
 4FLJ A;  4OOK A;  3PKB A;  2BH3 A;  4U71 A;  5E5B A;  3IU8 A;  3CTZ A;  3L7G A;  3PKE A;  1C21 A;  4IKR A;  2Q93 A;  3IU9 A;  3IU7 A;  2V3Y A;  3FMR A;  1N51 A;  2GG9 A;  4FLK A;  5CDL A;  2BWW A;  2EA2 A;  2GA2 A;  2GZ5 A;  4FUK A;  2BWU A;  4IKS A;  2Q94 A;  5CIK A;  4RGZ 1;  4S2R P;  5D6F A;  1MAT A;  2GU7 A;  1C23 A;  1WLR A;  3TAV A;  4FLL A;  1KP0 A;  4HXX A;  4JUQ A;  5CDE A;  4FKC A;  4ZWP A;  1WKM A;  1YJ3 A;  2BWX A;  1PV9 A;  4EGE A;  2ADU A;  4IDY A;  1YW9 A;  2BWS A;  4ZWO A;  2GG5 A;  2Q92 A;  1WN1 A;  3MX6 A;  1WL9 A;  3S6B A;  2BWV A;  4QR8 A;  1C27 A;  1WL6 A;  2G6P A;  4U6E A;  1XGS A;  3PKD A;  1XNZ A;  2GU4 A;  2P98 A;  5JFR A;  1XGO A;  2IW2 A;  5FCH A;  5D6E A;  1B6A A;  1YVM A;  1YW7 A;  2V6C A;  4IPA A;  2BHC A;  2GG7 A;  2OKN A;  2NQ7 A;  4KM3 A;  4PV4 A;  4RZY A;  4U70 A;  2P9A A;  4PNC A;  4U1B A;  3Q6D A;  2B3H A;  2GG3 A;  4U69 A;  1YW8 A;  1A16 A;  1Y1N A;  3CB6 A;  4IU6 A;  2GG2 A;  4U6W A;  2Q95 A;  2Q8K A;  3BIT A;  1R5H A;  2BHD A;  2OAZ A;  4U73 A;  1QXW A;  4U6J A;  3RVA A;  3MAT A;  1B59 A;  4FO8 A;  1WBQ A;  3FMQ A;  2MAT A;  4FO7 A;  4IF7 A;  4ZWU A;  2V3Z A;  3CB5 A;  4FLI A;  2EA4 A;  1CHM A;  4S00 A;  4RZZ A;  1R58 A;  3ROR A;  2GG0 A;  3PKA A;  1JAW A;  2BHA A;  5FCF A;  1XGN A;  2BWY A;  1WY2 A;  1C24 A;  2GU5 A;  1R5G A;  5JHU A;  5CE6 A;  3PKC A;  1W2M A;  4IEC A;  1QXZ A;  2GG8 A;  1QZY A;  3BIP A;  2Q96 A;  2B3K A;  1M35 A;  4IKU A;  2GGC A;  2DFI A;  2V3X A;  3MR1 A;  4U76 A;  2BN7 A;  4S01 A;  3L24 A;  3IG4 A;  1O0X A;  2GTX A;  1BOA A;  1C22 A;  4U6C A;  1BN5 A;  2BB7 A;  3FM3 A;  1QXY A;  2GGB A;  1W7V A;  2EVM A;  1XGM A;  3BIQ A;  2BWT A;  4ZNG A;  5CDV A;  5CNX A;  1KQ0 A;  3D27 A;  2EVC A;  2BHB A;  4U6Z A;  4Z7M A;  4A6V A;  4A6W A;  2ZSG A;  4MAT A;  2GU6 A;  4R60 A;  3TB5 A;  4B28 A;  2P99 A;  5JI6 A;  1KQ9 A;  2EVO A;  4U75 A;  2HOW A;  5CLS A;  4IKT A;  4S2T P;  2B3L A;  2NQ6 A; 
#chains in the Genus database with same CATH homology
 4FLJ A;  4OOK A;  3PKB A;  2BH3 A;  4U71 A;  5E5B A;  3IU8 A;  3CTZ A;  3L7G A;  3PKE A;  1C21 A;  4IKR A;  2Q93 A;  3IU9 A;  3IU7 A;  2V3Y A;  3FMR A;  1N51 A;  2GG9 A;  4FLK A;  5CDL A;  2BWW A;  2EA2 A;  2GA2 A;  2GZ5 A;  4FUK A;  2BWU A;  4IKS A;  2Q94 A;  5CIK A;  4RGZ 1;  4S2R P;  5D6F A;  1MAT A;  2GU7 A;  1C23 A;  1WLR A;  3TAV A;  4FLL A;  1KP0 A;  4HXX A;  4JUQ A;  5CDE A;  4FKC A;  4ZWP A;  1WKM A;  1YJ3 A;  2BWX A;  1PV9 A;  4EGE A;  2ADU A;  4IDY A;  1YW9 A;  2BWS A;  4ZWO A;  2GG5 A;  2Q92 A;  1WN1 A;  3MX6 A;  1WL9 A;  3S6B A;  2BWV A;  4QR8 A;  1C27 A;  1WL6 A;  2G6P A;  4U6E A;  1XGS A;  3PKD A;  1XNZ A;  2GU4 A;  2P98 A;  5JFR A;  1XGO A;  2IW2 A;  5FCH A;  5D6E A;  1B6A A;  1YVM A;  1YW7 A;  2V6C A;  4IPA A;  2BHC A;  2GG7 A;  2OKN A;  2NQ7 A;  4KM3 A;  4PV4 A;  4RZY A;  4U70 A;  2P9A A;  4PNC A;  4U1B A;  3Q6D A;  2B3H A;  2GG3 A;  4U69 A;  1YW8 A;  1A16 A;  1Y1N A;  3CB6 A;  4IU6 A;  2GG2 A;  4U6W A;  2Q95 A;  2Q8K A;  3BIT A;  1R5H A;  2BHD A;  2OAZ A;  4U73 A;  1QXW A;  4U6J A;  3RVA A;  3MAT A;  1B59 A;  4FO8 A;  1WBQ A;  3FMQ A;  2MAT A;  4FO7 A;  4IF7 A;  4ZWU A;  2V3Z A;  3CB5 A;  4FLI A;  2EA4 A;  1CHM A;  4S00 A;  4RZZ A;  1R58 A;  3ROR A;  2GG0 A;  3PKA A;  1JAW A;  2BHA A;  5FCF A;  1XGN A;  2BWY A;  1WY2 A;  1C24 A;  2GU5 A;  1R5G A;  5JHU A;  5CE6 A;  3PKC A;  1W2M A;  4IEC A;  1QXZ A;  2GG8 A;  1QZY A;  3BIP A;  2Q96 A;  2B3K A;  1M35 A;  4IKU A;  2GGC A;  2DFI A;  2V3X A;  3MR1 A;  4U76 A;  2BN7 A;  4S01 A;  3L24 A;  3IG4 A;  1O0X A;  2GTX A;  1BOA A;  1C22 A;  4U6C A;  1BN5 A;  2BB7 A;  3FM3 A;  1QXY A;  2GGB A;  1W7V A;  2EVM A;  1XGM A;  3BIQ A;  2BWT A;  4ZNG A;  5CDV A;  5CNX A;  1KQ0 A;  3D27 A;  2EVC A;  2BHB A;  4U6Z A;  4Z7M A;  4A6V A;  4A6W A;  2ZSG A;  4MAT A;  2GU6 A;  4R60 A;  3TB5 A;  4B28 A;  2P99 A;  5JI6 A;  1KQ9 A;  2EVO A;  4U75 A;  2HOW A;  5CLS A;  4IKT A;  4S2T P;  2B3L A;  2NQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...