3TAVA

Crystal structure of a methionine aminopeptidase from mycobacterium abscessus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
264
structure length
264
Chain Sequence
VGLFGRKKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSFLGYHGFPASICSSVNDQVVHGIPSATAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAAEKQFDRAFGIVDGYGGHGIGRSMHLDPFLPNEGAPGKGPLLAVGSVLAIEPMLTLGTTQTRVLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Hydrolase
total genus 82
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3tavA00
2GU5A 3MX6A 2V3YA 4ZWPA 4IU6A 2P98A 2BWVA 4IPAA 2BHBA 2P99A 2BWTA 2Q94A 2BWYA 4U76A 4MATA 1WLRA 4FLKA 3IG4A 4R60A 1WN1A 4HXXA 4U71A 3PKDA 4RZZA 3BITA 3PKEA 1C24A 1XGMA 3FMQA 1Y1NA 2GA2A 2OKNA 1WL9A 1WL6A 1KQ9A 5JFRA 4U6CA 2BHDA 5JI6A 3PKAA 5JHUA 4JUQA 4ZWUA 2GG5A 1XGNA 4FLIA 1XNZA 1WBQA 5D6FA 4U6JA 1W2MA 3Q6DA 4S2RP 4U69A 4Z7MA 5FCHA 1CHMA 3CB5A 3IU9A 2GZ5A 4RGZ1 5D6EA 1R5GA 2GU6A 2BHCA 4IF7A 1A16A 5CNXA 3RVAA 2EVOA 4ZWOA 4A6WA 1WKMA 2Q95A 2OAZA 3IU7A 1QZYA 4IKUA 2B3HA 2GG3A 3FMRA 2GG2A 4S2TP 3PKBA 4IDYA 2MATA 4U6ZA 1O0XA 4ZNGA 1YW8A 2BWUA 2IW2A 4U1BA 5CDEA 1C21A 4FO8A 5CIKA 2BN7A 3TB5A 1KP0A 2V6CA 4FLLA 2EVCA 4FUKA 4U70A 2G6PA 1YW9A 2GG7A 1R5HA 4PV4A 1JAWA 1N51A 4U73A 4U6EA 3BIQA 5CDLA 1B59A 2GG9A 2GG8A 2GG0A 2BWSA 2Q93A 3MATA 5CLSA 2ZSGA 2P9AA 1KQ0A 2Q96A 1MATA 2V3XA 2B3KA 1C23A 2Q8KA 2EVMA 1W7VA 4QR8A 3L7GA 2ADUA 4A6VA 1QXYA 2HOWA 5E5BA 3CTZA 3D27A 1YJ3A 4RZYA 1XGSA 2NQ7A 3L24A 3BIPA 4EGEA 1QXZA 2BHAA 4FKCA 2GTXA 1BOAA 2NQ6A 4IKSA 1YW7A 1YVMA 5FCFA 2BWXA 4IKTA 4FLJA 1WY2A 2DFIA 2GU7A 1PV9A 1BN5A 4U75A 2V3ZA 3PKCA 2B3LA 1R58A 4KM3A 4U6WA 2EA4A 2BB7A 4IKRA 3MR1A 2GGBA 3IU8A 4PNCA 2EA2A 2GGCA 3FM3A 5CDVA 5CE6A 4B28A 1QXWA 3S6BA 2BWWA 3RORA 1XGOA 1C27A 2GU4A 3CB6A 4S01A 1B6AA 2BH3A 1C22A 4OOKA 1M35A 3TAVA 4IECA 2Q92A 4S00A 4FO7A
chains in the Genus database with same CATH superfamily
2GU5A 3MX6A 2V3YA 4ZWPA 4IU6A 2P98A 2BWVA 4IPAA 2BHBA 2P99A 2BWTA 2Q94A 2BWYA 4U76A 4MATA 1WLRA 4FLKA 3IG4A 4R60A 1WN1A 4HXXA 4U71A 3PKDA 4RZZA 3BITA 3PKEA 1C24A 1XGMA 3FMQA 1Y1NA 2GA2A 2OKNA 1WL9A 1WL6A 1KQ9A 5JFRA 4U6CA 2BHDA 5JI6A 3PKAA 5JHUA 4JUQA 4ZWUA 2GG5A 1XGNA 4FLIA 1XNZA 1WBQA 5D6FA 4U6JA 1W2MA 3Q6DA 4S2RP 4U69A 4Z7MA 5FCHA 1CHMA 3CB5A 3IU9A 2GZ5A 4RGZ1 5D6EA 1R5GA 2GU6A 2BHCA 4IF7A 1A16A 5CNXA 3RVAA 2EVOA 4ZWOA 4A6WA 1WKMA 2Q95A 2OAZA 3IU7A 1QZYA 4IKUA 2B3HA 2GG3A 3FMRA 2GG2A 4S2TP 3PKBA 4IDYA 2MATA 4U6ZA 1O0XA 4ZNGA 1YW8A 2BWUA 2IW2A 4U1BA 5CDEA 1C21A 4FO8A 5CIKA 2BN7A 3TB5A 1KP0A 2V6CA 4FLLA 2EVCA 4FUKA 4U70A 2G6PA 1YW9A 2GG7A 1R5HA 4PV4A 1JAWA 1N51A 4U73A 4U6EA 3BIQA 5CDLA 1B59A 2GG9A 2GG8A 2GG0A 2BWSA 2Q93A 3MATA 5CLSA 2ZSGA 2P9AA 1KQ0A 2Q96A 1MATA 2V3XA 2B3KA 1C23A 2Q8KA 2EVMA 1W7VA 4QR8A 3L7GA 2ADUA 4A6VA 1QXYA 2HOWA 5E5BA 3CTZA 3D27A 1YJ3A 4RZYA 1XGSA 2NQ7A 3L24A 3BIPA 4EGEA 1QXZA 2BHAA 4FKCA 2GTXA 1BOAA 2NQ6A 4IKSA 1YW7A 1YVMA 5FCFA 2BWXA 4IKTA 4FLJA 1WY2A 2DFIA 2GU7A 1PV9A 1BN5A 4U75A 2V3ZA 3PKCA 2B3LA 1R58A 4KM3A 4U6WA 2EA4A 2BB7A 4IKRA 3MR1A 2GGBA 3IU8A 4PNCA 2EA2A 2GGCA 3FM3A 5CDVA 5CE6A 4B28A 1QXWA 3S6BA 2BWWA 3RORA 1XGOA 1C27A 2GU4A 3CB6A 4S01A 1B6AA 2BH3A 1C22A 4OOKA 1M35A 3TAVA 4IECA 2Q92A 4S00A 4FO7A
chains in the Genus database with same CATH topology
2GU5A 3MX6A 2V3YA 4ZWPA 4IU6A 2P98A 2BWVA 4IPAA 2BHBA 2P99A 2BWTA 2Q94A 2BWYA 4U76A 4MATA 1WLRA 4FLKA 3IG4A 4R60A 1WN1A 4HXXA 4U71A 3PKDA 4RZZA 3BITA 3PKEA 1C24A 1XGMA 3FMQA 1Y1NA 2GA2A 2OKNA 1WL9A 1WL6A 1KQ9A 5JFRA 4U6CA 2BHDA 5JI6A 3PKAA 5JHUA 4JUQA 4ZWUA 2GG5A 1XGNA 4FLIA 1XNZA 1WBQA 5D6FA 4U6JA 1W2MA 3Q6DA 4S2RP 4U69A 4Z7MA 5FCHA 1CHMA 3CB5A 3IU9A 2GZ5A 4RGZ1 5D6EA 1R5GA 2GU6A 2BHCA 4IF7A 1A16A 5CNXA 3RVAA 2EVOA 4ZWOA 4A6WA 1WKMA 2Q95A 2OAZA 3IU7A 1QZYA 4IKUA 2B3HA 2GG3A 3FMRA 2GG2A 4S2TP 3PKBA 4IDYA 2MATA 4U6ZA 1O0XA 4ZNGA 1YW8A 2BWUA 2IW2A 4U1BA 5CDEA 1C21A 4FO8A 5CIKA 2BN7A 3TB5A 1KP0A 2V6CA 4FLLA 2EVCA 4FUKA 4U70A 2G6PA 1YW9A 2GG7A 1R5HA 4PV4A 1JAWA 1N51A 4U73A 4U6EA 3BIQA 5CDLA 1B59A 2GG9A 2GG8A 2GG0A 2BWSA 2Q93A 3MATA 5CLSA 2ZSGA 2P9AA 1KQ0A 2Q96A 1MATA 2V3XA 2B3KA 1C23A 2Q8KA 2EVMA 1W7VA 4QR8A 3L7GA 2ADUA 4A6VA 1QXYA 2HOWA 5E5BA 3CTZA 3D27A 1YJ3A 4RZYA 1XGSA 2NQ7A 3L24A 3BIPA 4EGEA 1QXZA 2BHAA 4FKCA 2GTXA 1BOAA 2NQ6A 4IKSA 1YW7A 1YVMA 5FCFA 2BWXA 4IKTA 4FLJA 1WY2A 2DFIA 2GU7A 1PV9A 1BN5A 4U75A 2V3ZA 3PKCA 2B3LA 1R58A 4KM3A 4U6WA 2EA4A 2BB7A 4IKRA 3MR1A 2GGBA 3IU8A 4PNCA 2EA2A 2GGCA 3FM3A 5CDVA 5CE6A 4B28A 1QXWA 3S6BA 2BWWA 3RORA 1XGOA 1C27A 2GU4A 3CB6A 4S01A 1B6AA 2BH3A 1C22A 4OOKA 1M35A 3TAVA 4IECA 2Q92A 4S00A 4FO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GU5 A;  3MX6 A;  2V3Y A;  4ZWP A;  4IU6 A;  2P98 A;  2BWV A;  4IPA A;  2BHB A;  2P99 A;  2BWT A;  2Q94 A;  2BWY A;  4U76 A;  4MAT A;  1WLR A;  4FLK A;  3IG4 A;  4R60 A;  1WN1 A;  4HXX A;  4U71 A;  3PKD A;  4RZZ A;  3BIT A;  3PKE A;  1C24 A;  1XGM A;  3FMQ A;  1Y1N A;  2GA2 A;  2OKN A;  1WL9 A;  1WL6 A;  1KQ9 A;  5JFR A;  4U6C A;  2BHD A;  5JI6 A;  3PKA A;  5JHU A;  4JUQ A;  4ZWU A;  2GG5 A;  1XGN A;  4FLI A;  1XNZ A;  1WBQ A;  5D6F A;  4U6J A;  1W2M A;  3Q6D A;  4S2R P;  4U69 A;  4Z7M A;  5FCH A;  1CHM A;  3CB5 A;  3IU9 A;  2GZ5 A;  4RGZ 1;  5D6E A;  1R5G A;  2GU6 A;  2BHC A;  4IF7 A;  1A16 A;  5CNX A;  3RVA A;  2EVO A;  4ZWO A;  4A6W A;  1WKM A;  2Q95 A;  2OAZ A;  3IU7 A;  1QZY A;  4IKU A;  2B3H A;  2GG3 A;  3FMR A;  2GG2 A;  4S2T P;  3PKB A;  4IDY A;  2MAT A;  4U6Z A;  1O0X A;  4ZNG A;  1YW8 A;  2BWU A;  2IW2 A;  4U1B A;  5CDE A;  1C21 A;  4FO8 A;  5CIK A;  2BN7 A;  3TB5 A;  1KP0 A;  2V6C A;  4FLL A;  2EVC A;  4FUK A;  4U70 A;  2G6P A;  1YW9 A;  2GG7 A;  1R5H A;  4PV4 A;  1JAW A;  1N51 A;  4U73 A;  4U6E A;  3BIQ A;  5CDL A;  1B59 A;  2GG9 A;  2GG8 A;  2GG0 A;  2BWS A;  2Q93 A;  3MAT A;  5CLS A;  2ZSG A;  2P9A A;  1KQ0 A;  2Q96 A;  1MAT A;  2V3X A;  2B3K A;  1C23 A;  2Q8K A;  2EVM A;  1W7V A;  4QR8 A;  3L7G A;  2ADU A;  4A6V A;  1QXY A;  2HOW A;  5E5B A;  3CTZ A;  3D27 A;  1YJ3 A;  4RZY A;  1XGS A;  2NQ7 A;  3L24 A;  3BIP A;  4EGE A;  1QXZ A;  2BHA A;  4FKC A;  2GTX A;  1BOA A;  2NQ6 A;  4IKS A;  1YW7 A;  1YVM A;  5FCF A;  2BWX A;  4IKT A;  4FLJ A;  1WY2 A;  2DFI A;  2GU7 A;  1PV9 A;  1BN5 A;  4U75 A;  2V3Z A;  3PKC A;  2B3L A;  1R58 A;  4KM3 A;  4U6W A;  2EA4 A;  2BB7 A;  4IKR A;  3MR1 A;  2GGB A;  3IU8 A;  4PNC A;  2EA2 A;  2GGC A;  3FM3 A;  5CDV A;  5CE6 A;  4B28 A;  1QXW A;  3S6B A;  2BWW A;  3ROR A;  1XGO A;  1C27 A;  2GU4 A;  3CB6 A;  4S01 A;  1B6A A;  2BH3 A;  1C22 A;  4OOK A;  1M35 A;  3TAV A;  4IEC A;  2Q92 A;  4S00 A;  4FO7 A; 
#chains in the Genus database with same CATH topology
 2GU5 A;  3MX6 A;  2V3Y A;  4ZWP A;  4IU6 A;  2P98 A;  2BWV A;  4IPA A;  2BHB A;  2P99 A;  2BWT A;  2Q94 A;  2BWY A;  4U76 A;  4MAT A;  1WLR A;  4FLK A;  3IG4 A;  4R60 A;  1WN1 A;  4HXX A;  4U71 A;  3PKD A;  4RZZ A;  3BIT A;  3PKE A;  1C24 A;  1XGM A;  3FMQ A;  1Y1N A;  2GA2 A;  2OKN A;  1WL9 A;  1WL6 A;  1KQ9 A;  5JFR A;  4U6C A;  2BHD A;  5JI6 A;  3PKA A;  5JHU A;  4JUQ A;  4ZWU A;  2GG5 A;  1XGN A;  4FLI A;  1XNZ A;  1WBQ A;  5D6F A;  4U6J A;  1W2M A;  3Q6D A;  4S2R P;  4U69 A;  4Z7M A;  5FCH A;  1CHM A;  3CB5 A;  3IU9 A;  2GZ5 A;  4RGZ 1;  5D6E A;  1R5G A;  2GU6 A;  2BHC A;  4IF7 A;  1A16 A;  5CNX A;  3RVA A;  2EVO A;  4ZWO A;  4A6W A;  1WKM A;  2Q95 A;  2OAZ A;  3IU7 A;  1QZY A;  4IKU A;  2B3H A;  2GG3 A;  3FMR A;  2GG2 A;  4S2T P;  3PKB A;  4IDY A;  2MAT A;  4U6Z A;  1O0X A;  4ZNG A;  1YW8 A;  2BWU A;  2IW2 A;  4U1B A;  5CDE A;  1C21 A;  4FO8 A;  5CIK A;  2BN7 A;  3TB5 A;  1KP0 A;  2V6C A;  4FLL A;  2EVC A;  4FUK A;  4U70 A;  2G6P A;  1YW9 A;  2GG7 A;  1R5H A;  4PV4 A;  1JAW A;  1N51 A;  4U73 A;  4U6E A;  3BIQ A;  5CDL A;  1B59 A;  2GG9 A;  2GG8 A;  2GG0 A;  2BWS A;  2Q93 A;  3MAT A;  5CLS A;  2ZSG A;  2P9A A;  1KQ0 A;  2Q96 A;  1MAT A;  2V3X A;  2B3K A;  1C23 A;  2Q8K A;  2EVM A;  1W7V A;  4QR8 A;  3L7G A;  2ADU A;  4A6V A;  1QXY A;  2HOW A;  5E5B A;  3CTZ A;  3D27 A;  1YJ3 A;  4RZY A;  1XGS A;  2NQ7 A;  3L24 A;  3BIP A;  4EGE A;  1QXZ A;  2BHA A;  4FKC A;  2GTX A;  1BOA A;  2NQ6 A;  4IKS A;  1YW7 A;  1YVM A;  5FCF A;  2BWX A;  4IKT A;  4FLJ A;  1WY2 A;  2DFI A;  2GU7 A;  1PV9 A;  1BN5 A;  4U75 A;  2V3Z A;  3PKC A;  2B3L A;  1R58 A;  4KM3 A;  4U6W A;  2EA4 A;  2BB7 A;  4IKR A;  3MR1 A;  2GGB A;  3IU8 A;  4PNC A;  2EA2 A;  2GGC A;  3FM3 A;  5CDV A;  5CE6 A;  4B28 A;  1QXW A;  3S6B A;  2BWW A;  3ROR A;  1XGO A;  1C27 A;  2GU4 A;  3CB6 A;  4S01 A;  1B6A A;  2BH3 A;  1C22 A;  4OOK A;  1M35 A;  3TAV A;  4IEC A;  2Q92 A;  4S00 A;  4FO7 A; 
#chains in the Genus database with same CATH homology
 2GU5 A;  3MX6 A;  2V3Y A;  4ZWP A;  4IU6 A;  2P98 A;  2BWV A;  4IPA A;  2BHB A;  2P99 A;  2BWT A;  2Q94 A;  2BWY A;  4U76 A;  4MAT A;  1WLR A;  4FLK A;  3IG4 A;  4R60 A;  1WN1 A;  4HXX A;  4U71 A;  3PKD A;  4RZZ A;  3BIT A;  3PKE A;  1C24 A;  1XGM A;  3FMQ A;  1Y1N A;  2GA2 A;  2OKN A;  1WL9 A;  1WL6 A;  1KQ9 A;  5JFR A;  4U6C A;  2BHD A;  5JI6 A;  3PKA A;  5JHU A;  4JUQ A;  4ZWU A;  2GG5 A;  1XGN A;  4FLI A;  1XNZ A;  1WBQ A;  5D6F A;  4U6J A;  1W2M A;  3Q6D A;  4S2R P;  4U69 A;  4Z7M A;  5FCH A;  1CHM A;  3CB5 A;  3IU9 A;  2GZ5 A;  4RGZ 1;  5D6E A;  1R5G A;  2GU6 A;  2BHC A;  4IF7 A;  1A16 A;  5CNX A;  3RVA A;  2EVO A;  4ZWO A;  4A6W A;  1WKM A;  2Q95 A;  2OAZ A;  3IU7 A;  1QZY A;  4IKU A;  2B3H A;  2GG3 A;  3FMR A;  2GG2 A;  4S2T P;  3PKB A;  4IDY A;  2MAT A;  4U6Z A;  1O0X A;  4ZNG A;  1YW8 A;  2BWU A;  2IW2 A;  4U1B A;  5CDE A;  1C21 A;  4FO8 A;  5CIK A;  2BN7 A;  3TB5 A;  1KP0 A;  2V6C A;  4FLL A;  2EVC A;  4FUK A;  4U70 A;  2G6P A;  1YW9 A;  2GG7 A;  1R5H A;  4PV4 A;  1JAW A;  1N51 A;  4U73 A;  4U6E A;  3BIQ A;  5CDL A;  1B59 A;  2GG9 A;  2GG8 A;  2GG0 A;  2BWS A;  2Q93 A;  3MAT A;  5CLS A;  2ZSG A;  2P9A A;  1KQ0 A;  2Q96 A;  1MAT A;  2V3X A;  2B3K A;  1C23 A;  2Q8K A;  2EVM A;  1W7V A;  4QR8 A;  3L7G A;  2ADU A;  4A6V A;  1QXY A;  2HOW A;  5E5B A;  3CTZ A;  3D27 A;  1YJ3 A;  4RZY A;  1XGS A;  2NQ7 A;  3L24 A;  3BIP A;  4EGE A;  1QXZ A;  2BHA A;  4FKC A;  2GTX A;  1BOA A;  2NQ6 A;  4IKS A;  1YW7 A;  1YVM A;  5FCF A;  2BWX A;  4IKT A;  4FLJ A;  1WY2 A;  2DFI A;  2GU7 A;  1PV9 A;  1BN5 A;  4U75 A;  2V3Z A;  3PKC A;  2B3L A;  1R58 A;  4KM3 A;  4U6W A;  2EA4 A;  2BB7 A;  4IKR A;  3MR1 A;  2GGB A;  3IU8 A;  4PNC A;  2EA2 A;  2GGC A;  3FM3 A;  5CDV A;  5CE6 A;  4B28 A;  1QXW A;  3S6B A;  2BWW A;  3ROR A;  1XGO A;  1C27 A;  2GU4 A;  3CB6 A;  4S01 A;  1B6A A;  2BH3 A;  1C22 A;  4OOK A;  1M35 A;  3TAV A;  4IEC A;  2Q92 A;  4S00 A;  4FO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...