3TAVA

Crystal structure of a methionine aminopeptidase from mycobacterium abscessus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
264
structure length
264
Chain Sequence
b'VGLFGRKKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSFLGYHGFPASICSSVNDQVVHGIPSATAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAAEKQFDRAFGIVDGYGGHGIGRSMHLDPFLPNEGAPGKGPLLAVGSVLAIEPMLTLGTTQTRVLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTMRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Hydrolase
total genus 82
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3tavA00
2B3KA 4HXXA 2GA2A 2Q93A 3FMRA 4ZWOA 2BWXA 4PV4A 2GG5A 1Y1NA 1YW9A 2GG0A 4IKTA 1WY2A 5JFRA 2GG8A 1YJ3A 5JHUA 3MATA 4U6ZA 1WL6A 3MR1A 3CB6A 4A6VA 2GG3A 4ZWPA 2GU6A 5FCFA 3PKEA 2EA2A 1R58A 2BWYA 2V3XA 4FUKA 3IU7A 1QZYA 5FCHA 1M35A 2GGCA 4IDYA 4ZWUA 2GGBA 1C24A 3PKBA 3S6BA 1WLRA 1CHMA 2Q96A 4S00A 2IW2A 4U6EA 4B28A 4U6WA 1B6AA 3IG4A 2G6PA 4FLJA 3TAVA 1WKMA 2DFIA 4U69A 3D27A 3IU8A 1MATA 1C23A 2BHBA 4IECA 4MATA 2P98A 2EVOA 3BITA 4R60A 2OKNA 5CNXA 4OOKA 2P99A 4RGZ1 3RVAA 3FMQA 4U73A 1B59A 2V6CA 1BOAA 3IU9A 3L7GA 2BB7A 3PKCA 1A16A 2GU4A 4ZNGA 4S01A 2GG7A 4IF7A 4IU6A 1QXZA 3MX6A 2BN7A 1W7VA 4U76A 1WN1A 2BWTA 1XGMA 1YW8A 4Z7MA 2GZ5A 2BWVA 3BIQA 3BIPA 4QR8A 5CDLA 2EVMA 1R5GA 2GTXA 4FO7A 2B3LA 4U6JA 5JI6A 2Q92A 5CDEA 2ADUA 2BHCA 1KP0A 3CB5A 3CTZA 2ZSGA 1XGNA 2BHDA 4RZZA 4IKUA 5CIKA 3TB5A 2BWSA 4FLKA 4S2RP 3L24A 4U70A 1JAWA 2Q95A 1QXWA 1PV9A 1KQ9A 1XGOA 4FLLA 1BN5A 4IPAA 4PNCA 5D6EA 2EVCA 1QXYA 5D6FA 1R5HA 5E5BA 2BWWA 1WBQA 2EA4A 2GG2A 2GG9A 3RORA 2MATA 1C22A 2OAZA 1YVMA 4FO8A 1XGSA 4S2TP 2NQ6A 4IKRA 4U75A 5CLSA 2V3YA 3PKAA 1C27A 1YW7A 2BWUA 2NQ7A 1XNZA 1C21A 4U6CA 2V3ZA 3Q6DA 2BH3A 1O0XA 4KM3A 4RZYA 2GU7A 2Q8KA 2Q94A 4U71A 1N51A 1W2MA 4FKCA 4A6WA 4IKSA 4JUQA 1WL9A 3PKDA 2GU5A 1KQ0A 2P9AA 4FLIA 2HOWA 4U1BA 2B3HA 5CDVA 2BHAA 3FM3A 4EGEA 5CE6A
chains in the Genus database with same CATH superfamily
2B3KA 4HXXA 2GA2A 2Q93A 3FMRA 4ZWOA 2BWXA 4PV4A 2GG5A 1Y1NA 1YW9A 2GG0A 4IKTA 1WY2A 5JFRA 2GG8A 1YJ3A 5JHUA 3MATA 4U6ZA 1WL6A 3MR1A 3CB6A 4A6VA 2GG3A 4ZWPA 2GU6A 5FCFA 3PKEA 2EA2A 1R58A 2BWYA 2V3XA 4FUKA 3IU7A 1QZYA 5FCHA 1M35A 2GGCA 4IDYA 4ZWUA 2GGBA 1C24A 3PKBA 3S6BA 1WLRA 1CHMA 2Q96A 4S00A 2IW2A 4U6EA 4B28A 4U6WA 1B6AA 3IG4A 2G6PA 4FLJA 3TAVA 1WKMA 2DFIA 4U69A 3D27A 3IU8A 1MATA 1C23A 2BHBA 4IECA 4MATA 2P98A 2EVOA 3BITA 4R60A 2OKNA 5CNXA 4OOKA 2P99A 4RGZ1 3RVAA 3FMQA 4U73A 1B59A 2V6CA 1BOAA 3IU9A 3L7GA 2BB7A 3PKCA 1A16A 2GU4A 4ZNGA 4S01A 2GG7A 4IF7A 4IU6A 1QXZA 3MX6A 2BN7A 1W7VA 4U76A 1WN1A 2BWTA 1XGMA 1YW8A 4Z7MA 2GZ5A 2BWVA 3BIQA 3BIPA 4QR8A 5CDLA 2EVMA 1R5GA 2GTXA 4FO7A 2B3LA 4U6JA 5JI6A 2Q92A 5CDEA 2ADUA 2BHCA 1KP0A 3CB5A 3CTZA 2ZSGA 1XGNA 2BHDA 4RZZA 4IKUA 5CIKA 3TB5A 2BWSA 4FLKA 4S2RP 3L24A 4U70A 1JAWA 2Q95A 1QXWA 1PV9A 1KQ9A 1XGOA 4FLLA 1BN5A 4IPAA 4PNCA 5D6EA 2EVCA 1QXYA 5D6FA 1R5HA 5E5BA 2BWWA 1WBQA 2EA4A 2GG2A 2GG9A 3RORA 2MATA 1C22A 2OAZA 1YVMA 4FO8A 1XGSA 4S2TP 2NQ6A 4IKRA 4U75A 5CLSA 2V3YA 3PKAA 1C27A 1YW7A 2BWUA 2NQ7A 1XNZA 1C21A 4U6CA 2V3ZA 3Q6DA 2BH3A 1O0XA 4KM3A 4RZYA 2GU7A 2Q8KA 2Q94A 4U71A 1N51A 1W2MA 4FKCA 4A6WA 4IKSA 4JUQA 1WL9A 3PKDA 2GU5A 1KQ0A 2P9AA 4FLIA 2HOWA 4U1BA 2B3HA 5CDVA 2BHAA 3FM3A 4EGEA 5CE6A
chains in the Genus database with same CATH topology
2B3KA 4HXXA 2GA2A 2Q93A 3FMRA 4ZWOA 2BWXA 4PV4A 2GG5A 1Y1NA 1YW9A 2GG0A 4IKTA 1WY2A 5JFRA 2GG8A 1YJ3A 5JHUA 3MATA 4U6ZA 1WL6A 3MR1A 3CB6A 4A6VA 2GG3A 4ZWPA 2GU6A 5FCFA 3PKEA 2EA2A 1R58A 2BWYA 2V3XA 4FUKA 3IU7A 1QZYA 5FCHA 1M35A 2GGCA 4IDYA 4ZWUA 2GGBA 1C24A 3PKBA 3S6BA 1WLRA 1CHMA 2Q96A 4S00A 2IW2A 4U6EA 4B28A 4U6WA 1B6AA 3IG4A 2G6PA 4FLJA 3TAVA 1WKMA 2DFIA 4U69A 3D27A 3IU8A 1MATA 1C23A 2BHBA 4IECA 4MATA 2P98A 2EVOA 3BITA 4R60A 2OKNA 5CNXA 4OOKA 2P99A 4RGZ1 3RVAA 3FMQA 4U73A 1B59A 2V6CA 1BOAA 3IU9A 3L7GA 2BB7A 3PKCA 1A16A 2GU4A 4ZNGA 4S01A 2GG7A 4IF7A 4IU6A 1QXZA 3MX6A 2BN7A 1W7VA 4U76A 1WN1A 2BWTA 1XGMA 1YW8A 4Z7MA 2GZ5A 2BWVA 3BIQA 3BIPA 4QR8A 5CDLA 2EVMA 1R5GA 2GTXA 4FO7A 2B3LA 4U6JA 5JI6A 2Q92A 5CDEA 2ADUA 2BHCA 1KP0A 3CB5A 3CTZA 2ZSGA 1XGNA 2BHDA 4RZZA 4IKUA 5CIKA 3TB5A 2BWSA 4FLKA 4S2RP 3L24A 4U70A 1JAWA 2Q95A 1QXWA 1PV9A 1KQ9A 1XGOA 4FLLA 1BN5A 4IPAA 4PNCA 5D6EA 2EVCA 1QXYA 5D6FA 1R5HA 5E5BA 2BWWA 1WBQA 2EA4A 2GG2A 2GG9A 3RORA 2MATA 1C22A 2OAZA 1YVMA 4FO8A 1XGSA 4S2TP 2NQ6A 4IKRA 4U75A 5CLSA 2V3YA 3PKAA 1C27A 1YW7A 2BWUA 2NQ7A 1XNZA 1C21A 4U6CA 2V3ZA 3Q6DA 2BH3A 1O0XA 4KM3A 4RZYA 2GU7A 2Q8KA 2Q94A 4U71A 1N51A 1W2MA 4FKCA 4A6WA 4IKSA 4JUQA 1WL9A 3PKDA 2GU5A 1KQ0A 2P9AA 4FLIA 2HOWA 4U1BA 2B3HA 5CDVA 2BHAA 3FM3A 4EGEA 5CE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3K A;  4HXX A;  2GA2 A;  2Q93 A;  3FMR A;  4ZWO A;  2BWX A;  4PV4 A;  2GG5 A;  1Y1N A;  1YW9 A;  2GG0 A;  4IKT A;  1WY2 A;  5JFR A;  2GG8 A;  1YJ3 A;  5JHU A;  3MAT A;  4U6Z A;  1WL6 A;  3MR1 A;  3CB6 A;  4A6V A;  2GG3 A;  4ZWP A;  2GU6 A;  5FCF A;  3PKE A;  2EA2 A;  1R58 A;  2BWY A;  2V3X A;  4FUK A;  3IU7 A;  1QZY A;  5FCH A;  1M35 A;  2GGC A;  4IDY A;  4ZWU A;  2GGB A;  1C24 A;  3PKB A;  3S6B A;  1WLR A;  1CHM A;  2Q96 A;  4S00 A;  2IW2 A;  4U6E A;  4B28 A;  4U6W A;  1B6A A;  3IG4 A;  2G6P A;  4FLJ A;  3TAV A;  1WKM A;  2DFI A;  4U69 A;  3D27 A;  3IU8 A;  1MAT A;  1C23 A;  2BHB A;  4IEC A;  4MAT A;  2P98 A;  2EVO A;  3BIT A;  4R60 A;  2OKN A;  5CNX A;  4OOK A;  2P99 A;  4RGZ 1;  3RVA A;  3FMQ A;  4U73 A;  1B59 A;  2V6C A;  1BOA A;  3IU9 A;  3L7G A;  2BB7 A;  3PKC A;  1A16 A;  2GU4 A;  4ZNG A;  4S01 A;  2GG7 A;  4IF7 A;  4IU6 A;  1QXZ A;  3MX6 A;  2BN7 A;  1W7V A;  4U76 A;  1WN1 A;  2BWT A;  1XGM A;  1YW8 A;  4Z7M A;  2GZ5 A;  2BWV A;  3BIQ A;  3BIP A;  4QR8 A;  5CDL A;  2EVM A;  1R5G A;  2GTX A;  4FO7 A;  2B3L A;  4U6J A;  5JI6 A;  2Q92 A;  5CDE A;  2ADU A;  2BHC A;  1KP0 A;  3CB5 A;  3CTZ A;  2ZSG A;  1XGN A;  2BHD A;  4RZZ A;  4IKU A;  5CIK A;  3TB5 A;  2BWS A;  4FLK A;  4S2R P;  3L24 A;  4U70 A;  1JAW A;  2Q95 A;  1QXW A;  1PV9 A;  1KQ9 A;  1XGO A;  4FLL A;  1BN5 A;  4IPA A;  4PNC A;  5D6E A;  2EVC A;  1QXY A;  5D6F A;  1R5H A;  5E5B A;  2BWW A;  1WBQ A;  2EA4 A;  2GG2 A;  2GG9 A;  3ROR A;  2MAT A;  1C22 A;  2OAZ A;  1YVM A;  4FO8 A;  1XGS A;  4S2T P;  2NQ6 A;  4IKR A;  4U75 A;  5CLS A;  2V3Y A;  3PKA A;  1C27 A;  1YW7 A;  2BWU A;  2NQ7 A;  1XNZ A;  1C21 A;  4U6C A;  2V3Z A;  3Q6D A;  2BH3 A;  1O0X A;  4KM3 A;  4RZY A;  2GU7 A;  2Q8K A;  2Q94 A;  4U71 A;  1N51 A;  1W2M A;  4FKC A;  4A6W A;  4IKS A;  4JUQ A;  1WL9 A;  3PKD A;  2GU5 A;  1KQ0 A;  2P9A A;  4FLI A;  2HOW A;  4U1B A;  2B3H A;  5CDV A;  2BHA A;  3FM3 A;  4EGE A;  5CE6 A; 
#chains in the Genus database with same CATH topology
 2B3K A;  4HXX A;  2GA2 A;  2Q93 A;  3FMR A;  4ZWO A;  2BWX A;  4PV4 A;  2GG5 A;  1Y1N A;  1YW9 A;  2GG0 A;  4IKT A;  1WY2 A;  5JFR A;  2GG8 A;  1YJ3 A;  5JHU A;  3MAT A;  4U6Z A;  1WL6 A;  3MR1 A;  3CB6 A;  4A6V A;  2GG3 A;  4ZWP A;  2GU6 A;  5FCF A;  3PKE A;  2EA2 A;  1R58 A;  2BWY A;  2V3X A;  4FUK A;  3IU7 A;  1QZY A;  5FCH A;  1M35 A;  2GGC A;  4IDY A;  4ZWU A;  2GGB A;  1C24 A;  3PKB A;  3S6B A;  1WLR A;  1CHM A;  2Q96 A;  4S00 A;  2IW2 A;  4U6E A;  4B28 A;  4U6W A;  1B6A A;  3IG4 A;  2G6P A;  4FLJ A;  3TAV A;  1WKM A;  2DFI A;  4U69 A;  3D27 A;  3IU8 A;  1MAT A;  1C23 A;  2BHB A;  4IEC A;  4MAT A;  2P98 A;  2EVO A;  3BIT A;  4R60 A;  2OKN A;  5CNX A;  4OOK A;  2P99 A;  4RGZ 1;  3RVA A;  3FMQ A;  4U73 A;  1B59 A;  2V6C A;  1BOA A;  3IU9 A;  3L7G A;  2BB7 A;  3PKC A;  1A16 A;  2GU4 A;  4ZNG A;  4S01 A;  2GG7 A;  4IF7 A;  4IU6 A;  1QXZ A;  3MX6 A;  2BN7 A;  1W7V A;  4U76 A;  1WN1 A;  2BWT A;  1XGM A;  1YW8 A;  4Z7M A;  2GZ5 A;  2BWV A;  3BIQ A;  3BIP A;  4QR8 A;  5CDL A;  2EVM A;  1R5G A;  2GTX A;  4FO7 A;  2B3L A;  4U6J A;  5JI6 A;  2Q92 A;  5CDE A;  2ADU A;  2BHC A;  1KP0 A;  3CB5 A;  3CTZ A;  2ZSG A;  1XGN A;  2BHD A;  4RZZ A;  4IKU A;  5CIK A;  3TB5 A;  2BWS A;  4FLK A;  4S2R P;  3L24 A;  4U70 A;  1JAW A;  2Q95 A;  1QXW A;  1PV9 A;  1KQ9 A;  1XGO A;  4FLL A;  1BN5 A;  4IPA A;  4PNC A;  5D6E A;  2EVC A;  1QXY A;  5D6F A;  1R5H A;  5E5B A;  2BWW A;  1WBQ A;  2EA4 A;  2GG2 A;  2GG9 A;  3ROR A;  2MAT A;  1C22 A;  2OAZ A;  1YVM A;  4FO8 A;  1XGS A;  4S2T P;  2NQ6 A;  4IKR A;  4U75 A;  5CLS A;  2V3Y A;  3PKA A;  1C27 A;  1YW7 A;  2BWU A;  2NQ7 A;  1XNZ A;  1C21 A;  4U6C A;  2V3Z A;  3Q6D A;  2BH3 A;  1O0X A;  4KM3 A;  4RZY A;  2GU7 A;  2Q8K A;  2Q94 A;  4U71 A;  1N51 A;  1W2M A;  4FKC A;  4A6W A;  4IKS A;  4JUQ A;  1WL9 A;  3PKD A;  2GU5 A;  1KQ0 A;  2P9A A;  4FLI A;  2HOW A;  4U1B A;  2B3H A;  5CDV A;  2BHA A;  3FM3 A;  4EGE A;  5CE6 A; 
#chains in the Genus database with same CATH homology
 2B3K A;  4HXX A;  2GA2 A;  2Q93 A;  3FMR A;  4ZWO A;  2BWX A;  4PV4 A;  2GG5 A;  1Y1N A;  1YW9 A;  2GG0 A;  4IKT A;  1WY2 A;  5JFR A;  2GG8 A;  1YJ3 A;  5JHU A;  3MAT A;  4U6Z A;  1WL6 A;  3MR1 A;  3CB6 A;  4A6V A;  2GG3 A;  4ZWP A;  2GU6 A;  5FCF A;  3PKE A;  2EA2 A;  1R58 A;  2BWY A;  2V3X A;  4FUK A;  3IU7 A;  1QZY A;  5FCH A;  1M35 A;  2GGC A;  4IDY A;  4ZWU A;  2GGB A;  1C24 A;  3PKB A;  3S6B A;  1WLR A;  1CHM A;  2Q96 A;  4S00 A;  2IW2 A;  4U6E A;  4B28 A;  4U6W A;  1B6A A;  3IG4 A;  2G6P A;  4FLJ A;  3TAV A;  1WKM A;  2DFI A;  4U69 A;  3D27 A;  3IU8 A;  1MAT A;  1C23 A;  2BHB A;  4IEC A;  4MAT A;  2P98 A;  2EVO A;  3BIT A;  4R60 A;  2OKN A;  5CNX A;  4OOK A;  2P99 A;  4RGZ 1;  3RVA A;  3FMQ A;  4U73 A;  1B59 A;  2V6C A;  1BOA A;  3IU9 A;  3L7G A;  2BB7 A;  3PKC A;  1A16 A;  2GU4 A;  4ZNG A;  4S01 A;  2GG7 A;  4IF7 A;  4IU6 A;  1QXZ A;  3MX6 A;  2BN7 A;  1W7V A;  4U76 A;  1WN1 A;  2BWT A;  1XGM A;  1YW8 A;  4Z7M A;  2GZ5 A;  2BWV A;  3BIQ A;  3BIP A;  4QR8 A;  5CDL A;  2EVM A;  1R5G A;  2GTX A;  4FO7 A;  2B3L A;  4U6J A;  5JI6 A;  2Q92 A;  5CDE A;  2ADU A;  2BHC A;  1KP0 A;  3CB5 A;  3CTZ A;  2ZSG A;  1XGN A;  2BHD A;  4RZZ A;  4IKU A;  5CIK A;  3TB5 A;  2BWS A;  4FLK A;  4S2R P;  3L24 A;  4U70 A;  1JAW A;  2Q95 A;  1QXW A;  1PV9 A;  1KQ9 A;  1XGO A;  4FLL A;  1BN5 A;  4IPA A;  4PNC A;  5D6E A;  2EVC A;  1QXY A;  5D6F A;  1R5H A;  5E5B A;  2BWW A;  1WBQ A;  2EA4 A;  2GG2 A;  2GG9 A;  3ROR A;  2MAT A;  1C22 A;  2OAZ A;  1YVM A;  4FO8 A;  1XGS A;  4S2T P;  2NQ6 A;  4IKR A;  4U75 A;  5CLS A;  2V3Y A;  3PKA A;  1C27 A;  1YW7 A;  2BWU A;  2NQ7 A;  1XNZ A;  1C21 A;  4U6C A;  2V3Z A;  3Q6D A;  2BH3 A;  1O0X A;  4KM3 A;  4RZY A;  2GU7 A;  2Q8K A;  2Q94 A;  4U71 A;  1N51 A;  1W2M A;  4FKC A;  4A6W A;  4IKS A;  4JUQ A;  1WL9 A;  3PKD A;  2GU5 A;  1KQ0 A;  2P9A A;  4FLI A;  2HOW A;  4U1B A;  2B3H A;  5CDV A;  2BHA A;  3FM3 A;  4EGE A;  5CE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...