3TAVA

Crystal structure of a methionine aminopeptidase from mycobacterium abscessus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
264
structure length
264
Chain Sequence
VGLFGRKKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSFLGYHGFPASICSSVNDQVVHGIPSATAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAAEKQFDRAFGIVDGYGGHGIGRSMHLDPFLPNEGAPGKGPLLAVGSVLAIEPMLTLGTTQTRVLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 82
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3tavA00
2GU5A 1YW7A 2GG5A 4A6WA 4U6CA 1Y1NA 4A6VA 4B28A 1W2MA 1QXWA 2GG7A 1C23A 2Q96A 2BWXA 5CDVA 2BHCA 1WBQA 2BB7A 2BN7A 2Q94A 5CE6A 1WY2A 2BHBA 2P9AA 4U1BA 1BOAA 4U73A 4IPAA 3FM3A 3PKCA 1YW8A 4ZWUA 5E5BA 5CIKA 2V3XA 5D6FA 1C22A 5FCHA 2GG2A 3RORA 1XGSA 2GU4A 1QZYA 1YW9A 2V3ZA 5FCFA 2GGCA 4U71A 3MATA 4ZNGA 2EA2A 2BWSA 4PNCA 4RGZ1 3L24A 2ZSGA 2GU7A 2BWTA 3FMRA 1R5HA 1R58A 3BIQA 1B59A 2B3KA 3PKEA 1WLRA 4S00A 2GA2A 1A16A 1MATA 2GG3A 2GTXA 2P98A 2GG0A 3BIPA 4FUKA 4QR8A 2BH3A 4RZYA 2GG8A 2DFIA 4IKSA 4U69A 4U76A 2Q8KA 1R5GA 2HOWA 4FLLA 1QXYA 1C27A 5CLSA 1M35A 4FKCA 1B6AA 4ZWPA 4FLIA 4RZZA 2BHDA 2BWVA 1JAWA 2IW2A 2NQ7A 4EGEA 3IU9A 4Z7MA 2GU6A 1WL9A 3PKDA 3D27A 4U6ZA 1WN1A 4U75A 2B3HA 1N51A 1XGNA 2EVOA 3Q6DA 4FLJA 1KP0A 1C21A 1W7VA 2GG9A 1XGOA 1C24A 4FO8A 1BN5A 3TB5A 4IECA 1XNZA 4IKTA 4U6EA 2BWYA 1KQ0A 2V6CA 2OKNA 4MATA 2B3LA 4ZWOA 4U70A 2Q92A 3PKAA 4IU6A 4FLKA 4FO7A 4S2TP 5JFRA 5JHUA 2GZ5A 4KM3A 3S6BA 3MX6A 1CHMA 2EVCA 4PV4A 3PKBA 2Q95A 2BWWA 4U6JA 1YVMA 3RVAA 4S01A 1WKMA 4IDYA 5JI6A 3FMQA 2EA4A 1XGMA 3IU7A 5CDLA 1YJ3A 2V3YA 2ADUA 3L7GA 4IF7A 2MATA 1O0XA 2BWUA 1WL6A 4HXXA 2GGBA 4S2RP 5CDEA 3IU8A 4JUQA 3BITA 4R60A 4OOKA 3CB5A 1KQ9A 2P99A 4U6WA 3TAVA 3CB6A 1QXZA 3CTZA 4IKRA 2G6PA 2OAZA 2EVMA 2Q93A 2NQ6A 1PV9A 3IG4A 5CNXA 4IKUA 3MR1A 5D6EA 2BHAA
chains in the Genus database with same CATH superfamily
2GU5A 1YW7A 2GG5A 4A6WA 4U6CA 1Y1NA 4A6VA 4B28A 1W2MA 1QXWA 2GG7A 1C23A 2Q96A 2BWXA 5CDVA 2BHCA 1WBQA 2BB7A 2BN7A 2Q94A 5CE6A 1WY2A 2BHBA 2P9AA 4U1BA 1BOAA 4U73A 4IPAA 3FM3A 3PKCA 1YW8A 4ZWUA 5E5BA 5CIKA 2V3XA 5D6FA 1C22A 5FCHA 2GG2A 3RORA 1XGSA 2GU4A 1QZYA 1YW9A 2V3ZA 5FCFA 2GGCA 4U71A 3MATA 4ZNGA 2EA2A 2BWSA 4PNCA 4RGZ1 3L24A 2ZSGA 2GU7A 2BWTA 3FMRA 1R5HA 1R58A 3BIQA 1B59A 2B3KA 3PKEA 1WLRA 4S00A 2GA2A 1A16A 1MATA 2GG3A 2GTXA 2P98A 2GG0A 3BIPA 4FUKA 4QR8A 2BH3A 4RZYA 2GG8A 2DFIA 4IKSA 4U69A 4U76A 2Q8KA 1R5GA 2HOWA 4FLLA 1QXYA 1C27A 5CLSA 1M35A 4FKCA 1B6AA 4ZWPA 4FLIA 4RZZA 2BHDA 2BWVA 1JAWA 2IW2A 2NQ7A 4EGEA 3IU9A 4Z7MA 2GU6A 1WL9A 3PKDA 3D27A 4U6ZA 1WN1A 4U75A 2B3HA 1N51A 1XGNA 2EVOA 3Q6DA 4FLJA 1KP0A 1C21A 1W7VA 2GG9A 1XGOA 1C24A 4FO8A 1BN5A 3TB5A 4IECA 1XNZA 4IKTA 4U6EA 2BWYA 1KQ0A 2V6CA 2OKNA 4MATA 2B3LA 4ZWOA 4U70A 2Q92A 3PKAA 4IU6A 4FLKA 4FO7A 4S2TP 5JFRA 5JHUA 2GZ5A 4KM3A 3S6BA 3MX6A 1CHMA 2EVCA 4PV4A 3PKBA 2Q95A 2BWWA 4U6JA 1YVMA 3RVAA 4S01A 1WKMA 4IDYA 5JI6A 3FMQA 2EA4A 1XGMA 3IU7A 5CDLA 1YJ3A 2V3YA 2ADUA 3L7GA 4IF7A 2MATA 1O0XA 2BWUA 1WL6A 4HXXA 2GGBA 4S2RP 5CDEA 3IU8A 4JUQA 3BITA 4R60A 4OOKA 3CB5A 1KQ9A 2P99A 4U6WA 3TAVA 3CB6A 1QXZA 3CTZA 4IKRA 2G6PA 2OAZA 2EVMA 2Q93A 2NQ6A 1PV9A 3IG4A 5CNXA 4IKUA 3MR1A 5D6EA 2BHAA
chains in the Genus database with same CATH topology
2GU5A 1YW7A 2GG5A 4A6WA 4U6CA 1Y1NA 4A6VA 4B28A 1W2MA 1QXWA 2GG7A 1C23A 2Q96A 2BWXA 5CDVA 2BHCA 1WBQA 2BB7A 2BN7A 2Q94A 5CE6A 1WY2A 2BHBA 2P9AA 4U1BA 1BOAA 4U73A 4IPAA 3FM3A 3PKCA 1YW8A 4ZWUA 5E5BA 5CIKA 2V3XA 5D6FA 1C22A 5FCHA 2GG2A 3RORA 1XGSA 2GU4A 1QZYA 1YW9A 2V3ZA 5FCFA 2GGCA 4U71A 3MATA 4ZNGA 2EA2A 2BWSA 4PNCA 4RGZ1 3L24A 2ZSGA 2GU7A 2BWTA 3FMRA 1R5HA 1R58A 3BIQA 1B59A 2B3KA 3PKEA 1WLRA 4S00A 2GA2A 1A16A 1MATA 2GG3A 2GTXA 2P98A 2GG0A 3BIPA 4FUKA 4QR8A 2BH3A 4RZYA 2GG8A 2DFIA 4IKSA 4U69A 4U76A 2Q8KA 1R5GA 2HOWA 4FLLA 1QXYA 1C27A 5CLSA 1M35A 4FKCA 1B6AA 4ZWPA 4FLIA 4RZZA 2BHDA 2BWVA 1JAWA 2IW2A 2NQ7A 4EGEA 3IU9A 4Z7MA 2GU6A 1WL9A 3PKDA 3D27A 4U6ZA 1WN1A 4U75A 2B3HA 1N51A 1XGNA 2EVOA 3Q6DA 4FLJA 1KP0A 1C21A 1W7VA 2GG9A 1XGOA 1C24A 4FO8A 1BN5A 3TB5A 4IECA 1XNZA 4IKTA 4U6EA 2BWYA 1KQ0A 2V6CA 2OKNA 4MATA 2B3LA 4ZWOA 4U70A 2Q92A 3PKAA 4IU6A 4FLKA 4FO7A 4S2TP 5JFRA 5JHUA 2GZ5A 4KM3A 3S6BA 3MX6A 1CHMA 2EVCA 4PV4A 3PKBA 2Q95A 2BWWA 4U6JA 1YVMA 3RVAA 4S01A 1WKMA 4IDYA 5JI6A 3FMQA 2EA4A 1XGMA 3IU7A 5CDLA 1YJ3A 2V3YA 2ADUA 3L7GA 4IF7A 2MATA 1O0XA 2BWUA 1WL6A 4HXXA 2GGBA 4S2RP 5CDEA 3IU8A 4JUQA 3BITA 4R60A 4OOKA 3CB5A 1KQ9A 2P99A 4U6WA 3TAVA 3CB6A 1QXZA 3CTZA 4IKRA 2G6PA 2OAZA 2EVMA 2Q93A 2NQ6A 1PV9A 3IG4A 5CNXA 4IKUA 3MR1A 5D6EA 2BHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GU5 A;  1YW7 A;  2GG5 A;  4A6W A;  4U6C A;  1Y1N A;  4A6V A;  4B28 A;  1W2M A;  1QXW A;  2GG7 A;  1C23 A;  2Q96 A;  2BWX A;  5CDV A;  2BHC A;  1WBQ A;  2BB7 A;  2BN7 A;  2Q94 A;  5CE6 A;  1WY2 A;  2BHB A;  2P9A A;  4U1B A;  1BOA A;  4U73 A;  4IPA A;  3FM3 A;  3PKC A;  1YW8 A;  4ZWU A;  5E5B A;  5CIK A;  2V3X A;  5D6F A;  1C22 A;  5FCH A;  2GG2 A;  3ROR A;  1XGS A;  2GU4 A;  1QZY A;  1YW9 A;  2V3Z A;  5FCF A;  2GGC A;  4U71 A;  3MAT A;  4ZNG A;  2EA2 A;  2BWS A;  4PNC A;  4RGZ 1;  3L24 A;  2ZSG A;  2GU7 A;  2BWT A;  3FMR A;  1R5H A;  1R58 A;  3BIQ A;  1B59 A;  2B3K A;  3PKE A;  1WLR A;  4S00 A;  2GA2 A;  1A16 A;  1MAT A;  2GG3 A;  2GTX A;  2P98 A;  2GG0 A;  3BIP A;  4FUK A;  4QR8 A;  2BH3 A;  4RZY A;  2GG8 A;  2DFI A;  4IKS A;  4U69 A;  4U76 A;  2Q8K A;  1R5G A;  2HOW A;  4FLL A;  1QXY A;  1C27 A;  5CLS A;  1M35 A;  4FKC A;  1B6A A;  4ZWP A;  4FLI A;  4RZZ A;  2BHD A;  2BWV A;  1JAW A;  2IW2 A;  2NQ7 A;  4EGE A;  3IU9 A;  4Z7M A;  2GU6 A;  1WL9 A;  3PKD A;  3D27 A;  4U6Z A;  1WN1 A;  4U75 A;  2B3H A;  1N51 A;  1XGN A;  2EVO A;  3Q6D A;  4FLJ A;  1KP0 A;  1C21 A;  1W7V A;  2GG9 A;  1XGO A;  1C24 A;  4FO8 A;  1BN5 A;  3TB5 A;  4IEC A;  1XNZ A;  4IKT A;  4U6E A;  2BWY A;  1KQ0 A;  2V6C A;  2OKN A;  4MAT A;  2B3L A;  4ZWO A;  4U70 A;  2Q92 A;  3PKA A;  4IU6 A;  4FLK A;  4FO7 A;  4S2T P;  5JFR A;  5JHU A;  2GZ5 A;  4KM3 A;  3S6B A;  3MX6 A;  1CHM A;  2EVC A;  4PV4 A;  3PKB A;  2Q95 A;  2BWW A;  4U6J A;  1YVM A;  3RVA A;  4S01 A;  1WKM A;  4IDY A;  5JI6 A;  3FMQ A;  2EA4 A;  1XGM A;  3IU7 A;  5CDL A;  1YJ3 A;  2V3Y A;  2ADU A;  3L7G A;  4IF7 A;  2MAT A;  1O0X A;  2BWU A;  1WL6 A;  4HXX A;  2GGB A;  4S2R P;  5CDE A;  3IU8 A;  4JUQ A;  3BIT A;  4R60 A;  4OOK A;  3CB5 A;  1KQ9 A;  2P99 A;  4U6W A;  3TAV A;  3CB6 A;  1QXZ A;  3CTZ A;  4IKR A;  2G6P A;  2OAZ A;  2EVM A;  2Q93 A;  2NQ6 A;  1PV9 A;  3IG4 A;  5CNX A;  4IKU A;  3MR1 A;  5D6E A;  2BHA A; 
#chains in the Genus database with same CATH topology
 2GU5 A;  1YW7 A;  2GG5 A;  4A6W A;  4U6C A;  1Y1N A;  4A6V A;  4B28 A;  1W2M A;  1QXW A;  2GG7 A;  1C23 A;  2Q96 A;  2BWX A;  5CDV A;  2BHC A;  1WBQ A;  2BB7 A;  2BN7 A;  2Q94 A;  5CE6 A;  1WY2 A;  2BHB A;  2P9A A;  4U1B A;  1BOA A;  4U73 A;  4IPA A;  3FM3 A;  3PKC A;  1YW8 A;  4ZWU A;  5E5B A;  5CIK A;  2V3X A;  5D6F A;  1C22 A;  5FCH A;  2GG2 A;  3ROR A;  1XGS A;  2GU4 A;  1QZY A;  1YW9 A;  2V3Z A;  5FCF A;  2GGC A;  4U71 A;  3MAT A;  4ZNG A;  2EA2 A;  2BWS A;  4PNC A;  4RGZ 1;  3L24 A;  2ZSG A;  2GU7 A;  2BWT A;  3FMR A;  1R5H A;  1R58 A;  3BIQ A;  1B59 A;  2B3K A;  3PKE A;  1WLR A;  4S00 A;  2GA2 A;  1A16 A;  1MAT A;  2GG3 A;  2GTX A;  2P98 A;  2GG0 A;  3BIP A;  4FUK A;  4QR8 A;  2BH3 A;  4RZY A;  2GG8 A;  2DFI A;  4IKS A;  4U69 A;  4U76 A;  2Q8K A;  1R5G A;  2HOW A;  4FLL A;  1QXY A;  1C27 A;  5CLS A;  1M35 A;  4FKC A;  1B6A A;  4ZWP A;  4FLI A;  4RZZ A;  2BHD A;  2BWV A;  1JAW A;  2IW2 A;  2NQ7 A;  4EGE A;  3IU9 A;  4Z7M A;  2GU6 A;  1WL9 A;  3PKD A;  3D27 A;  4U6Z A;  1WN1 A;  4U75 A;  2B3H A;  1N51 A;  1XGN A;  2EVO A;  3Q6D A;  4FLJ A;  1KP0 A;  1C21 A;  1W7V A;  2GG9 A;  1XGO A;  1C24 A;  4FO8 A;  1BN5 A;  3TB5 A;  4IEC A;  1XNZ A;  4IKT A;  4U6E A;  2BWY A;  1KQ0 A;  2V6C A;  2OKN A;  4MAT A;  2B3L A;  4ZWO A;  4U70 A;  2Q92 A;  3PKA A;  4IU6 A;  4FLK A;  4FO7 A;  4S2T P;  5JFR A;  5JHU A;  2GZ5 A;  4KM3 A;  3S6B A;  3MX6 A;  1CHM A;  2EVC A;  4PV4 A;  3PKB A;  2Q95 A;  2BWW A;  4U6J A;  1YVM A;  3RVA A;  4S01 A;  1WKM A;  4IDY A;  5JI6 A;  3FMQ A;  2EA4 A;  1XGM A;  3IU7 A;  5CDL A;  1YJ3 A;  2V3Y A;  2ADU A;  3L7G A;  4IF7 A;  2MAT A;  1O0X A;  2BWU A;  1WL6 A;  4HXX A;  2GGB A;  4S2R P;  5CDE A;  3IU8 A;  4JUQ A;  3BIT A;  4R60 A;  4OOK A;  3CB5 A;  1KQ9 A;  2P99 A;  4U6W A;  3TAV A;  3CB6 A;  1QXZ A;  3CTZ A;  4IKR A;  2G6P A;  2OAZ A;  2EVM A;  2Q93 A;  2NQ6 A;  1PV9 A;  3IG4 A;  5CNX A;  4IKU A;  3MR1 A;  5D6E A;  2BHA A; 
#chains in the Genus database with same CATH homology
 2GU5 A;  1YW7 A;  2GG5 A;  4A6W A;  4U6C A;  1Y1N A;  4A6V A;  4B28 A;  1W2M A;  1QXW A;  2GG7 A;  1C23 A;  2Q96 A;  2BWX A;  5CDV A;  2BHC A;  1WBQ A;  2BB7 A;  2BN7 A;  2Q94 A;  5CE6 A;  1WY2 A;  2BHB A;  2P9A A;  4U1B A;  1BOA A;  4U73 A;  4IPA A;  3FM3 A;  3PKC A;  1YW8 A;  4ZWU A;  5E5B A;  5CIK A;  2V3X A;  5D6F A;  1C22 A;  5FCH A;  2GG2 A;  3ROR A;  1XGS A;  2GU4 A;  1QZY A;  1YW9 A;  2V3Z A;  5FCF A;  2GGC A;  4U71 A;  3MAT A;  4ZNG A;  2EA2 A;  2BWS A;  4PNC A;  4RGZ 1;  3L24 A;  2ZSG A;  2GU7 A;  2BWT A;  3FMR A;  1R5H A;  1R58 A;  3BIQ A;  1B59 A;  2B3K A;  3PKE A;  1WLR A;  4S00 A;  2GA2 A;  1A16 A;  1MAT A;  2GG3 A;  2GTX A;  2P98 A;  2GG0 A;  3BIP A;  4FUK A;  4QR8 A;  2BH3 A;  4RZY A;  2GG8 A;  2DFI A;  4IKS A;  4U69 A;  4U76 A;  2Q8K A;  1R5G A;  2HOW A;  4FLL A;  1QXY A;  1C27 A;  5CLS A;  1M35 A;  4FKC A;  1B6A A;  4ZWP A;  4FLI A;  4RZZ A;  2BHD A;  2BWV A;  1JAW A;  2IW2 A;  2NQ7 A;  4EGE A;  3IU9 A;  4Z7M A;  2GU6 A;  1WL9 A;  3PKD A;  3D27 A;  4U6Z A;  1WN1 A;  4U75 A;  2B3H A;  1N51 A;  1XGN A;  2EVO A;  3Q6D A;  4FLJ A;  1KP0 A;  1C21 A;  1W7V A;  2GG9 A;  1XGO A;  1C24 A;  4FO8 A;  1BN5 A;  3TB5 A;  4IEC A;  1XNZ A;  4IKT A;  4U6E A;  2BWY A;  1KQ0 A;  2V6C A;  2OKN A;  4MAT A;  2B3L A;  4ZWO A;  4U70 A;  2Q92 A;  3PKA A;  4IU6 A;  4FLK A;  4FO7 A;  4S2T P;  5JFR A;  5JHU A;  2GZ5 A;  4KM3 A;  3S6B A;  3MX6 A;  1CHM A;  2EVC A;  4PV4 A;  3PKB A;  2Q95 A;  2BWW A;  4U6J A;  1YVM A;  3RVA A;  4S01 A;  1WKM A;  4IDY A;  5JI6 A;  3FMQ A;  2EA4 A;  1XGM A;  3IU7 A;  5CDL A;  1YJ3 A;  2V3Y A;  2ADU A;  3L7G A;  4IF7 A;  2MAT A;  1O0X A;  2BWU A;  1WL6 A;  4HXX A;  2GGB A;  4S2R P;  5CDE A;  3IU8 A;  4JUQ A;  3BIT A;  4R60 A;  4OOK A;  3CB5 A;  1KQ9 A;  2P99 A;  4U6W A;  3TAV A;  3CB6 A;  1QXZ A;  3CTZ A;  4IKR A;  2G6P A;  2OAZ A;  2EVM A;  2Q93 A;  2NQ6 A;  1PV9 A;  3IG4 A;  5CNX A;  4IKU A;  3MR1 A;  5D6E A;  2BHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...