1XGSA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
295
structure length
295
Chain Sequence
b'MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 97
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgsA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgsA01
5ED4A 3NQOA 1XGNA 1W2MA 1Q1HA 5HS8A 1ZARA 4R79A 1BBYA 3GFMA 5HOOA 1YW7A 1FZPB 2E1NA 4S04A 3QAHA 4RZYA 3PQKA 5L3BA 2ZJ2A 4QWQA 3KLNA 3SFZA 4I01A 4LG0B 3V8KA 2A3SA 1IXRC 3RI4A 1FNNA 3M8EA 1C24A 4FLKA 3RIRA 2PEXA 4HX8A 4G94A 4PV4A 5D8LB 4RAYA 4GYGA 3BPXA 4HF2A 3FF5A 2Y0MA 1YW8A 2YR2A 4ETSA 4IF7A 2FSWA 4N9IA 4G9YA 1NHAA 3OV8A 2OZUA 1HSJA 2GWRA 4U69A 1WN1A 1D5VA 4DNCA 2IVMA 1S6LA 2HOEA 4UVCA 1G3TA 4K2EA 2XAJA 4I0AA 4IU6A 1REPC 3LAJA 3TKYA 2L02A 1WKMA 2GG9A 1W7PA 5D6FA 5E1WA 2Y48A 1RNLA 3GFIA 1EH8A 2BHAA 1IRFA 4GXOA 2C6YA 1MDMA 1DDNA 1XSDA 2QYOA 2HYFA 3BITA 3CTAA 1IN8A 4AD9A 1BI1A 4IECA 2XAFA 4U88A 4BYYA 3HRTA 4LLLA 2HS5A 3DQVC 1O7LA 4U1BA 3BDDA 1R1TA 4LLNA 4M6XA 2ZCWA 3WODF 4Y15A 3R0AA 3MATA 3BY6A 1FP1D 2XAGA 2EA2A 1FBUA 2CG4A 3CDHA 3VB2A 3R0JA 3GXOA 1J9IA 2HTJA 4YG2F 3MR1A 1EH6A 2P5VA 4XRFA 1Z9CA 3HHGA 1LDJA 3R4KA 3K2ZA 1U6GA 1S29A 5A2QZ 1U78A 1ODDA 5F1RA 1SMTA 2VT3A 1P6RA 2CGPA 2L01A 3JSOA 4Q5SF 1SFEA 2O8XA 1J2XA 1MJBA 2PMHA 3KP5A 2QENA 1ZYRF 4A0ZA 3RTRA 4RB3C 4CXFA 1LDKB 2STWA 2WV0A 2FBHA 5EEGA 2LF8A 2DT5A 2JTVA 4ZWPA 2Z9OA 1W5SA 5ERIA 3ZMVA 3FMRA 4EJOA 2BN7A 1XCVA 1KA8A 3GO5A 3ROUA 5CYVA 3JTHA 2VN2A 3BJAA 1OPCA 4M9SA 1UB9A 4LK1F 2W84A 2ADUA 2NQ6A 2QUFA 4EGZA 2D2WA 4EMSA 3IG4A 2K4JA 5E1XA 3S2WA 5CJ9A 1K78A 4S00A 2QZ8A 1ZLJA 2PFBA 2E1CA 1C27A 3C18A 1PP7U 1YTYA 5CE6A 4LB6B 2B3KA 3SZPA 4ZZDA 2ETHA 2ESNA 2YX7A 4N9HA 1U2WA 4FLLA 1IN5A 3FMQA 4WXHA 4MEYF 4WXDA 4P55A 3HTUA 3CUOA 3BP8A 5J8FA 4L9NA 4UUVA 5LHIA 3KP3A 3ML6A 4TV7A 2X0LA 4M71A 4BHBA 4A5NA 3F6VA 4HOBA 1R1UA 5TRDA 3TQNA 1BN5A 1YJ3A 3F8MA 3KZZA 1ON1A 3D5LA 4HA8A 1U5TC 3TGNA 1QXWA 1Z91A 3HIFA 1DUXC 3R6SA 1B6AA 2MC3A 1F4KA 3GFJA 3KCCA 2HYGD 3I4PA 2RVCA 5D8KB 2BGCA 4EJWA 3CB6A 4HQMA 1LVAA 3IRQA 2EVMA 5LGTA 3REOA 4GYIA 3DV8A 1ZAOA 4KDPA 1PV9A 5LLQA 5FLXZ 2ZXJA 1WQ2A 4U0WA 1OMIA 4KN4X 2GU4A 3ULQB 4G8XA 2YU3A 2DLLA 5D4RA 1D8JA 4CICA 2HFHA 1R7JA 2CQKA 2UXNA 2ZKZA 2XGXA 3WG9A 2P5KA 2VBYA 2VT2A 3RKYA 2YSRA 4L9TA 1O3RA 1XDUA 2A5YB 3KETA 1CF7B 2A68F 4EM2A 3RYRA 3BIPA 3I0TA 3L7GA 3QP6A 4L18B 3IWFA 1A16A 5HS7A 1KGSA 5KVRA 4XLNF 2FBKA 2P8TA 2YPRA 3O2PE 4EJUA 2EV5A 3BPVA 4RAZA 1T6SA 1QQIA 2KRFA 1ULYA 5DCMA 2JRTA 2LKPA 5CVRA 3LQQA 2DPUA 4OIOF 4OIPF 4IVNA 2KJCA 2K86A 2B3HA 2OZ6A 1MJAA 2JZYA 1QO0D 2NNNA 3V7CA 4EJVA 1BI0A 3F8FA 3TOBA 4MHGA 3ZP5A 2CO5A 4CGZA 2PMUA 1USTA 1O3QA 2D1VA 1ZRFA 3FMSA 2L54A 3J81K 1S7AA 5BOXA 4G7HF 3WU1B 4BAYA 3KP2A 3I58A 2IA1A 2VXZA 2CWEA 5L3GA 2Z3YA 3D0SA 1EV7A 4IHSA 1Z6RA 1GXQA 3U1DA 3C7JA 3ZN1A 3VODA 4YFXF 3H92A 1F9NA 2V1XA 3CUQB 3FZVA 3F23A 2GXBA 4U70A 4U76A 4RB0A 3VFZA 4Q48A 4GCVA 1I5ZA 2H09A 5D5VB 1ZHFA 1WI9A 5J6XA 4FO8A 2Q96A 3L7WA 2FBIA 5IT9Z 1XMAA 1BI3A 2FMYA 4LGWA 2V79A 1TW2A 3KZYA 4GGGA 3WTUC 4HQEA 2VBXA 1U3EM 4LK0F 1R23A 5LGUA 4EVIA 2XAHA 3PKEA 3LFKA 4L0YB 3R60A 1BC7C 1KU3A 2HDCA 4ZNGA 1STZA 2Q93A 2CW0F 1RI7A 3G3ZA 4L9JA 3GX4X 4MGRA 2P5LC 1HKSA 4MNUA 1D3YA 3RYPA 4ENNA 4ESFA 2BEOA 2XHKA 4HLYA 4IKSA 2BWXA 5L3DA 3BJOA 1DP7P 2H6CA 3MQ0A 4CYDA 4P9FA 5H6QA 4FKCA 3QU6A 1JHHA 5FLXK 1TBXA 4JUQA 3G73A 2LDUA 3F6OA 3QOPA 3T1BA 2L3DA 1F1ZA 3V4GA 4KN7X 1MZBA 1W7PB 2HTSA 2P4WA 3K1NA 2H27A 4A0YA 1WL9A 4HF0A 5CVIA 5ICFA 4UV9A 3F8CA 1Y1NA 1UHWA 2VC0A 1TTYA 5K1YA 1MDMB 1Y0UA 2GAUA 1M35A 4ON0A 5FCFA 1MJ9A 2A69F 4HDUA 2EA4A 1DPRA 1WBQA 2BBYA 4OIQF 3JAMZ 2VONA 3K1MA 2VOPA 3SQNA 2IW2A 3T8RA 2LF7A 3NRVA 3M9AA 2GG0A 1F5TA 3ECHA 3EETA 1U5TA 5ICGA 4B28A 2DW4A 4B09A 2GXGA 3F3XA 3M8FA 2GG2A 1P4XA 3PKCA 5FO5A 1K6OA 2P98A 2EFWA 2HZTA 4OMYA 3IKVA 3WTXC 1BIBA 2BWTA 2RNJA 5D5UB 3P7NA 3P9CA 1YYVA 1FBSA 1L0OC 3V7SA 3ZMUA 2JPBA 2QM3A 2EJRA 2FA5A 1ONVA 3O6BB 4Y17A 4Q47A 1QGPA 3HRMA 2V1DA 2XKPA 4XBFA 2MH2A 4Y13A 1YQAA 4RS8A 3I59A 2P6SA 5CDVA 1PUEE 1B9MA 3PFIA 4AWXB 4BQAA 4UHTA 4FX0A 3K0LA 3VOEA 1R5HA 5BQTA 4ENJA 2A6HF 5CVJA 3M1EA 1MKMA 5ILVA 4S2TP 2BB7A 4U73A 1ZN2A 5JVTA 1OYWA 2DQLA 1J75A 4A6WA 2WC2A 3SXYA 3HTSB 4KA4A 2OAZA 3EUHA 2V6CA 5D5WB 2Q0OA 5L3EA 1J59A 4HV6A 1K78B 4LJZF 5D5XB 2DFIA 4WWCA 3ISPA 4JBAA 3BZ6A 1GVJA 5DD8A 3GF2A 4L5IA 1O3SA 1YIOA 4FUKA 2O6GE 1XGMA 4RGUA 2FNAA 2DK5A 4MQVA 2RN7A 3PKDA 3H3UA 3HUGA 3RORA 2Q92A 4LFUA 1KQ0A 1IAWA 3MX6A 2DTRA 2XAQA 1PP8F 1B59A 4H0EA 4CO8A 4O3MA 2FXAA 2W57A 3KP7A 2P7CB 3CJNA 1KYZA 1SFUA 2H94A 2PG4A 2X4HA 1FWZA 1U8RA 2E7WA 5BPIA 4I7HA 4UV8A 4HBLA 5LGNA 1IZ1A 2LNBA 2IJLA 5BPDA 1TQMA 3RVAA 3I53A 4HV5A 1YFHA 3E6CC 5LHGA 3GW2A 4A2UA 3E5QA 4U75A 1Z6TA 2FF4A 4IHTA 1T0FA 1W5TA 4QLCU 1FYMA 5LHHA 5E5BA 3ZMSA 2A07F 2E7XA 2R7FA 1ZLKA 1FOKA 3JAMK 1TNSA 3GLXA 1XDSA 4NB5A 4ENKA 1SD6A 4P5OA 5E17F 4R1HA 1I6XA 1C23A 2A61A 4CZZA 4YIFA 2MLKA 4UVBA 2R7DA 4Z7MA 3EYIA 4UNOA 3ZQ7A 3CUQC 1W4MA 2CFXA 1HW1A 3I71A 2F5FA 1KU9A 3FX3A 3HHHA 3WTZA 1IN7A 4R60A 3ZMZA 2Y75A 1T98A 4HLXA 1G3SA 1MGTA 2WWYA 2GQQA 3E5UA 4RB2C 2XASA 1USSA 5JFRA 2OBPA 2ISZA 2EVOA 5H20A 2QBYB 1W7PD 1IXCA 1R5GA 1B4AA 4WF2A 2P9AA 1ZRCA 5DCMB 4OMZA 2ZMEA 3I54A 4A6EA 1T39A 2GG3A 3WTTC 1C22A 2FRHA 3WTSC 2IA2A 3LA2A 4G7OF 1LEBA 2FMLA 5DEQA 3TDZC 1JGSA 3F72A 4KT5C 1YS6A 5D4SA 2Q94A 3C3WA 1XGOA 2MD5A 2A6EF 1BM9A 5EEHA 1Z05A 1G4DA 1H9TA 2DQRA 5HS9A 2BWVA 3TO6A 3Q6DA 1E17A 2IT0A 3KP6A 4JQFA 3GZ6A 3F22A 1ZGJA 3F21A 1ZH5A 4FLJA 3R61A 1T38A 5BS6A 3J80Z 4KMFA 1PDNC 3V7RA 1R22A 5HDNA 2HR3A 4XLPF 5LBQA 2NQ7A 1YS7A 1LB2A 2OKNA 1LEAA 1O0XA 5CVVA 5TJJA 3ZN0A 2ZNZA 4KIFA 5A2QK 2O03A 2V3ZA 3B02A 2XKOA 4A12A 3QU3A 5AIQA 1UHMA 5JI6A 6PAXA 4HXXA 4ESBA 3TO7A 5E20A 2IPQX 3F8BA 2BWWA 4KYWA 1XD7A 4FX4A 1ZG5A 2RKHA 3RPUA 4L0ZB 2EB7A 1P4WA 1ON2A 1R36A 2QQAA 1K79A 4KMUX 2WTEA 2JPCA 2ZNYA 3BWGA 2V3XA 4HYEA 1O7FA 1IUYA 2ZBKA 4JK1X 3IRRA 5KK1A 5DUIA 1KQ8A 1P2FA 3JTGA 4HF1A 1ZG1A 5FGMA 4EGYA 3CLOA 2KJBA 4YFNF 1YLFA 3TDUC 4EM0B 1SAXA 3W6JB 1OKRA 4HDVA 2GU6A 2IP2A 4OU0A 3NEUA 2EVCA 1SD5A 1XMKA 1H0MA 2NYXA 2MATA 2L4AA 1S7OA 1C0WA 1GXPA 1XGSA 3P9KA 2M1BA 3CB5A 3D27A 1OYIA 3KFWX 5K5RA 4XSXF 2BV6A 3JW4A 2QQ9A 2QWWA 5E1ZB 2J5PA 4RB1A 5CLSA 2YX4A 2FU4A 4L5JA 2K7LA 2BYVE 4EGEA 2GIVA 4KFCA 1KU7A 2UZKA 5K5OA 1S8NA 3ZMTA 1IN4A 4FT8A 3E6DA 3BROA 4NQWA 5AONA 1HQCA 5DYMA 3IHUA 5F64A 3W6KB 3LWFA 2B0LA 2DPDA 2XIGA 2OU2A 1XCBA 3GWZA 4KUMA 1T2KA 2F2EA 2K4BA 1U5TB 1ZRDA 1XB4A 1I27A 5DD4A 2BHBA 1WSUA 5CDLA 1HBXG 1OYYA 2Z33A 4OOIA 4RGSA 1LDDA 4OINF 5ICCA 3VEPA 2DU9A 1JXSA 1RUOA 4BH9A 2PQ8A 4HX4A 1QZYA 4IKUA 2G7UA 1HW2A 3DF8A 3WGHA 4AIHA 1WRJA 1V4RA 4OOKA 1J5YA 3GUDA 4S2RP 1TNTA 2DBBA 1J7KA 2PBIA 4ESJA 1FSEA 2HKOA 3MFKA 4HAMA 3Q9SA 4P96A 2PLYA 2DAOA 3T0YA 3WE3A 2CYYA 1P92A 1YG2A 2FE3A 2G9WA 4XSZF 3DP7A 4BHCA 2JT1A 3PKBA 3S6BA 4EV0A 3I59B 2W25A 3SZTA 5LEKA 2Z5UA 1G3WA 4IRGA 2F5DA 1R00A 2Q8KA 3LAPA 1RIOH 4U6JA 4UVAA 4LD5A 2K02A 2L4MA 2MA3A 4FHTA 3KLOA 5JHUA 2O61A 1XSVA 1HW5A 2OD5A 4LLGF 2IRFG 1A04A 2QLZA 3ABUA 5HDKA 3RJPA 3CO7C 5LEJA 4WCGA 1J0RA 2R3SA 3K9TA 5CVUA 3GZ5A 5HDGA 2V1UA 2HKXA 4A0XA 2EV0A 3ELKA 1BIAA 5FFXA 1WY2A 3WTVC 4D0PA 5HLIA 2DI3A 1OR7A 5F6FA 2VBWA 2EV6A 2BWYA 3TAVA 4LB5A 1V3FA 3DXJF 4U7BA 3EYYA 3MAJA 3CTZA 1P4AA 3E5XA 2PN6A 2P6TA 2J5OA 3RKXA 3WGGA 5HLHA 1O3TA 1WLRA 5DUKA 4Z2YA 2HWVA 1JE8A 1QNTA 4ZWUA 4DQ2A 3LA7A 2COMA 3TO9A 2HEOA 3L00A 4KM3A 3QRFF 2UXXA 1XSXA 2HQRA 3I64A 2W24A 4LG0A 1FYKA 4IF4A 4ZWOA 3P9IA 3HRUA 5DCFA 3E6BA 4MQ9F 3LA3A 2D45A 4U0VA 4M74A 3F8NA 5IT9K 1I1SA 2F5CA 1SD4A 1DPUA 1HSTA 3HOTA 2HGCA 4CHUA 2UWMA 1YO5C 3J7AO 2QVOA 4RGZ1 2H6BA 2ZFWA 1XN7A 1FYLA 4G6QA 2KIFA 3FM5A 2GA2A 3DPLC 4S01A 3U2RA 4ZYDA 1MD0A 5CNXA 1N51A 4S05A 4ZH4F 3ECOA 1BI2A 1IXSB 1YVMA 3QP5A 2DK8A 4WXCA 4E70A 4BNCA 2EFNA 3O3KA 1LJ9A 2FEZA 1Z1DA 1K7AA 4RGRA 4ZYEA 3MZHA 1TLHB 4G6DA 5HVQC 2ZMEB 4FO7A 4PDKA 2VE9A 4Q4ZF 1AOYA 1SD7A 4I09A 2KIMA 4U6ZA 4MATA 2EFQA 2ELHA 3KEQA 1BJAA 3U9GA 2ESHA 1JAWA 3J81Z 3WTWC 1VTNC 3HSRA 2FNPA 3IKTA 4I0BA 2GG7A 1IRGA 3JSPA 4KIBA 3DPTA 1B9NA 4ZYHA 3K1PA 5LRSA 3T8TA 4I02A 2B3LA 4BHPA 4MTDA 1X3UA 2GG5A 2TDXA 2GU5A 3PQJA 5ILSA 1YW9A 4WX9A 4KICA 4MEXF 4F7ZA 4HZFA 3ABTA 2M8EA 3QPTA 1HKQA 2Z99A 4KNYA 1XNZA 2VOOA 2MH9A 3KEOA 1FLIA 2EWNA 2M87A 1TW3A 3T5XA 3FHZA 1ZG3A 4YIIA 3E6MA 5FD5A 2IA0A 4IKRA 2BWUA 3FWEA 1QBJA 2W85A 4IXAA 3QPHA 2MLGA 3CO6C 4BXUA 4N0BA 1AWCA 2GGBA 2MBFA 4IKTA 2K27A 5ILUA 4U6WA 1QPMA 3E97A 1R1VA 2KKOA 3RPQA 5JR3A 2OA4A 2OQGA 2PJPA 2RQPA 2DO7A 1UFMA 5FB2A 1TQIA 3KP4A 4FLIA 5E8IA 3FM3A 3WGIA 2ZO4A 2M30A 3IU7A 2GZ5A 4ZYGA 2EFPA 4WK8F 4CDGA 1LNWA 4AIJA 3FXUA 4ASNA 4PNCA 2O3FA 3RKWA 2Q2EA 3AAFA 3L2CA 2XV4S 4P9UA 1C21A 1FY7A 3EQLF 3I5UA 4A5MA 3Q9VA 2V9VA 2RC4A 2BHDA 1HKTA 2CSOA 3BIQA 5FFZA 2G7HA 3DFGA 3RDIA 3ZMDA 5H6RA 4PCQA 2ACJA 4A6VA 5DV5A 4M73A 3GYHX 3HYIA 1HXDA 1H9GA 3DEUA 5IT3A 4EJTA 5DDGA 2BH3A 2NAZA 1KYWA 3HRSA 3ZPLA 1QZZA 3TB5A 1FBQA 4PGGA 4I2OA 1CGPA 4I98B 2P7VB 4U7DA 5FCHA 1GHCA 1RUNA 4L9VA 3V8LA 5CIKA 2LSOA 1TQPA 3OOPA 3MEXA 1MATA 3C1DA 4HW0A 3BOQA 3TOAA 3WE2A 1RZ4A 2BWSA 2G6PA 3N97A 2VODA 3EDPA 1G3YA 2ZSGA 4G7ZF 4U71A 2NRAC 1Z7UA 3PKAA 1LQ1A 2EFOA 2RGVA 1QXZA 2QBYA 1WL6A 2XROA 3COAC 2GU7A 4AVPA 5CDEA 3IL2A 5L3CA 2XRNA 3L9FA 1KU2A 3LQRA 3B73A 4EM1A 3HOSA 3IWZA 3LSTA 3GVAA 2HOWA 1S3JA 4M72A 3HSFA 4RGXA 4A6DA 1UCRA 2STTA 1JHFA 3M7GA 2HQNA 3MWMA 1WWXA 5BMZA 1FPQA 1SFXA 1FSHA 1IW7F 1I1GA 3FXRA 1W7VA 3IU9A 4RZZA 4O5VA 4IJAA 2VE8A 3N4MA 4ENMA 4B8XA 5L3FA 4M9XA 1SMYF 4HX7A 3HSEA 2F5EA 4IRIA 3WTYC 1G6NA 4IRHA 3E3VA 1CHMA 1BOAA 1ZGAA 4ZZLA 4O6JA 3Q5FA 1E2XA 4OIRF 4M9ZA 4AIKA 3GFLA 3L09A 1CF7A 2P99A 2AS5F 1IN6A 2GG8A 1FP2A 2QQBA 2XUBA 3SHFA 4GO1A 2Q95A 4U0YA 3IU8A 1FX7A 2XVCA 4IDYA 2BHCA 1QXYA 2RDPA 5E8GA 5FD6A 4PGHA 3L24A 1IF1A 4NHJA 1BC8C 4M6YA 2OQRA 1FT9A 2AXLA 1FC3A 2GZWA 2V3YA 2GTXA 2NS0A 4QR8A 5ICEA 3MZYA 2FQ3A 2RV8A 5AIPA 5J8CA 1KP0A 1B1BA 5LRRA 4YFKF 1ZREA 3ERED 1L3LA 4R8HA 1D8KA 3BJ6A 4PZJA 2GGCA 2VBZA 5E18F 2BE5F 2FOKA 3WU0A 2NNYA 4IPAA 5K5QA 5HLGA 4EQQA 2IW5A 2KIUA 4LMYA 2PI0A 2VC1A 3K69A 4KIGA 3GEZA 3FXQA 3V8JA 5D6EA 2GA1A 1KQ9A 3KE2A 2D1HA 2JSCA 3H3ZA 4U6EA 4U6CA 1EH7A 2EK5A 1O57A 2ISYA 3MCZA 1R58A 3IC7A 3CUQA 3J80K 3DKWA 2M45A 4UXNA 2O0YA 4MTEA 2M5WA
chains in the Genus database with same CATH superfamily
5ED4A 4BDYA 3I4MJ 3NQOA 4RA2A 1XGNA 1W2MA 1Q1HA 3FXOA 5HS8A 2CW7A 3K10A 1ZARA 4R79A 1BBYA 2M8GX 3GFMA 5HOOA 1YW7A 3OYCA 1FZPB 2R5ZA 4S0HB 4IOCF 2JUCA 5KNLA 1TWCJ 2E1NA 4S04A 1A36A 3QAHA 2Z1DA 4RZYA 3PQKA 4HNUA 5L3BA 1MSFC 3QYEA 3LSKA 1X1PA 3PNVA 1X4OA 2ZJ2A 4QWQA 3W2WA 3BLYA 2V9KA 3ZOBA 3KLNA 2KZGA 3SFZA 4CUGA 4I01A 4LG0B 3RPUD 3V8KA 2IGNA 5GTIC 2A3SA 3FK7A 1IXRC 1LFUP 1ETVA 1JJ6C 3RI4A 1FNNA 3L1PA 3LNQA 2DODA 3M8EA 4IHVA 1C24A 3DLLF 3IP4B 4FLKA 3RIRA 2PEXA 4HX8A 4G94A 5FKLA 4YEJA 2CV1A 4PV4A 5D8LB 1XC5A 4RAYA 3CP2A 4GYGA 4C2TA 1X1CA 5FLMJ 3BPXA 4HF2A 2WB1A 2Y0MA 1YW8A 3FF5A 4V2GA 2YR2A 4ETSA 4IF7A 2FSWA 3S17J 4N9IA 4G9YA 3GTJJ 1ZTRA 1D1CA 1NHAA 3OV8A 2ZSHB 1WH7A 5C4JJ 2OZUA 1UJ8A 1HSJA 2GWRA 3ZR8X 1GLNA 4AVZA 1MBEA 4U69A 1WN1A 2PX9A 3BZCA 1KONA 1D5VA 4DNCA 3TEDA 2IVMA 1NH3A 1S6LA 2HOEA 2L9VA 4UVCA 4F92B 1U8BA 2XGDA 1G3TA 2ZXIA 4K2EA 2XAJA 3OYJA 2HDDA 4I0AA 4IU6A 1REPC 3LAJA 3S1MJ 3TKYA 4QSHA 2L02A 2M7AA 1WKMA 1OCTC 3ZRGA 2R7QA 2WY7Q 2GG9A 1W7PA 2NS7A 5D6FA 4BY1J 5E1WA 2Y48A 4B4CA 4XLEA 1RNLA 1AKHB 3GFIA 3OYMA 1EH8A 3QYBA 1IRFA 1BW5A 2BHAA 4GXOA 1B72A 4ANJA 2C6YA 2DA7A 3SFIA 1MDMA 3JRIA 1DDNA 2BXYA 1XSDA 2QYOA 2HYFA 1MMNA 1FEXA 3BITA 3CTAA 3ZCOA 2EZKA 3VSKA 3BQYA 1IN8A 4AD9A 1BI1A 3S93A 2XSDC 4IECA 2X51A 2XAFA 4U88A 4BYYA 3HRTA 4LLLA 2HS5A 3DQVC 1T8IA 1O7LA 3HXLA 1JKQC 4U1BA 4XKVA 2LR8A 3BDDA 1R1TA 3CDIA 4LLNA 1D5YA 4M6XA 2ZCWA 3WODF 4Y15A 3R0AA 2JMWA 3MATA 5EJCA 2M7BA 3LSGA 3BY6A 1FP1D 2DT6A 2XAGA 2EA2A 1FBUA 2CG4A 2VXDA 3JRAA 3CDHA 2VI6A 4GRIA 3VB2A 4XICA 2QQ8A 2O9LA 2Z16A 3R0JA 3GXOA 3LSJA 2LREA 4IQ4A 1J9IA 2HTJA 4YG2F 3MR1A 1EH6A 2P5VA 4XRFA 2BW3B 1Z9CA 1RRJA 2VIXA 4N4OB 3L2WA 3HHGA 1LDJA 4PJJA 2K9NA 2KZVA 3R4KA 5GAHJ 3FBIB 3K2ZA 1U6GA 2XB5A 1S29A 4QTRA 5A2QZ 4BACA 2E35A 3M4OJ 1U78A 1ODDA 2BY2A 2OCEA 5F1RA 1SMTA 2VT3A 2K9QA 3LSIA 1TL8A 1P6RA 2CGPA 2L01A 4JX4A 2TRTA 5KAFC 3H5AA 2ZJRF 3JSOA 3H5RA 3VYTB 4B47A 1SFEA 4Q5SF 1YITI 2O8XA 1H89C 2CH0A 3BT9A 1J2XA 1MJBA 3RZDJ 1NG6A 2VKEA 2PMHA 3DBLB 1TZLA 3KP5A 2EH3A 3JR9A 2QENA 1ZYRF 4A0ZA 3RTRA 4RB3C 2IGKA 4CXFA 1U0JA 1A35A 1LDKB 3GZNB 5EDNA 2STWA 2WV0A 2FBHA 3LMMA 4HSTA 5EEGA 2NVTJ 2LF8A 2DT5A 4BUPA 2JTVA 4ZWPA 3GTMJ 4HSRA 2Z9OA 3AG2H 1W5SA 2I8DA 5ERIA 1DQUA 4XN0A 4YELA 4IHXA 3ZMVA 1VQ8I 3FMRA 2PMZN 1MBHA 4EJOA 2BN7A 5J4YA 2L7FP 1Q1VA 3PO2J 1R71A 2V9PA 1XCVA 1KA8A 4XNFA 3GO5A 1Z21A 3ROUA 5CYVA 2DFFA 2BZTA 2XPUA 3JTHA 3ZGKA 2BXZA 1N75A 2VN2A 5TISC 2OPTA 2DOFA 3BJAA 2JK3A 1DGRM 1OPCA 2VKVA 3BTLA 2Q2EB 1S5LC 1BJZA 1UB9A 2L9RA 3HBLA 4M9SA 2DJIA 5J1UA 1E3OC 4LK1F 1XMXA 5GADJ 3IAS2 3K4CA 2W84A 3MN2A 2ADUA 2WB1N 2QUFA 2WBMA 2Y0SA 4QIWN 4EGZA 5J4VA 2NQ6A 2D2WA 3HKZN 4EMSA 3U1KA 3IG4A 4KT6A 2K4JA 2W00A 2LBFA 5E1XA 3S2WA 5CJ9A 1K78A 4S00A 3TW7A 3SYTA 2QZ8A 1ZLJA 5EGOB 4AYBA 1X1BA 4F55A 2PFBA 2E1CA 5IP9J 1C27A 3C18A 4IOAF 1PP7U 1YTYA 3S2DJ 2K9SA 1YX5A 4RBOA 4HG2A 2B9SA 5CE6A 4LB6B 4ZTJA 2KPMA 3SZPA 4I76A 4ZZDA 2B3KA 2ETHA 5BNGA 4XOPA 3OIOA 2ESNA 2YX7A 4N9HA 4PUSA 1U2WA 2DA2A 5GTHC 3H1CA 1QVTA 4FLLA 2BOLA 1IN5A 2HOTA 3FMQA 5F0HA 4WXHA 4MEYF 3F0CA 4D7NA 3OSFA 4PFPA 4A69C 3QWLA 4WXDA 4P55A 3HTUA 3CUOA 3BP8A 5B5EC 5J8FA 4L9NA 4UUVA 5LHIA 2IGOA 4PJ0C 3GTLJ 3KP3A 2G0EA 3CCLI 3ML6A 4TV7A 2X0LA 1FJLA 2VASA 5FLVA 1OCRH 4M71A 4BHBA 4PSWA 3DWLE 1YE9A 4A5NA 3F6VA 4HOBA 1R1UA 5TRDA 1YIJI 3TQNA 1JI8A 1KZHA 3BG6A 1BN5A 3LSMA 2I5UA 2BY1A 3MKZA 1YJ3A 1XTAA 1JGGA 4A3FJ 2A05A 3F8MA 3OMYA 3KZZA 1ON1A 5EG0B 3D5LA 4HA8A 4NC6A 1SANA 3DEEA 1FOYA 1U5TC 3TGNA 1QXWA 1Z91A 3HIFA 1DUXC 3R6SA 3ABLH 4XKCA 1B6AA 2MC3A 1F4KA 3GFJA 1OCOH 1E0EA 3KCCA 2HYGD 3D5SC 3I4PA 2F4IA 2CU7A 3I56I 2RVCA 5D8KB 2BGCA 4EJWA 3CB6A 2VJJA 3BR3A 4HQMA 1LVAA 3IRQA 1VI0A 1TC3C 1QZEA 1W0UA 2EVMA 2FUG2 5LGTA 3BR6A 2KDZA 3REOA 4GYIA 4A3CJ 3DV8A 1ZAOA 4KDPA 4RAGA 1PV9A 5LLQA 4A3EJ 1ETOA 5FLXZ 2ZXJA 1WQ2A 4U0WA 4XOTA 5DTDA 1OMIA 4KN4X 2GU4A 3IV5A 3ULQB 4XN3A 5EZHA 4G8XA 2YU9J 2YU3A 4JYKA 2DLLA 5D4RA 4J00A 3L2VA 1IRZA 1W36D 1D8JA 3CCYA 4CICA 3HL2A 2HFHA 1R7JA 2CQKA 3CCJI 2UXNA 2ZKZA 2XGXA 3WG9A 1WJ5A 2P5KA 2VBYA 4NC7A 1VQMI 5K7HA 2VT2A 3HEFA 3RKYA 4BJ6C 2YSRA 3C2GA 4IX7A 4V19K 2F4OB 4L9TA 4BJTA 1O3RA 4E7SA 4RMNA 1XDUA 2A5YB 4A3LJ 2V4JC 3KETA 1CF7B 2A68F 4EM2A 3RYRA 3BIPA 4Y3OA 3I0TA 3S1NJ 3L7GA 3QP6A 1MW7A 1RR7A 4HNTA 3PO3J 3A2KA 2IEKA 3GBGA 4L18B 3IWFA 3PFYA 1A16A 5HS7A 1KGSA 5B66C 4DW6A 5KVRA 4XLNF 2FBKA 1BR2A 3OR2C 2P8TA 2YPRA 3O2PE 3EUHC 4NQWB 4EJUA 2EV5A 3CLQA 3BPVA 4RAZA 3A01B 3OS1A 1S7EA 1T6SA 1AA7A 1QQIA 2KRFA 1BR1A 1ULYA 2BVLA 5DCMA 3VYUB 2JRTA 2Y0SN 2LKPA 5CVRA 3LQQA 1PUFB 2DPUA 2JA2A 4OIOF 2HVRA 3UNGC 4OIPF 4DJAA 4IVNA 4F3QA 2KJCA 2LK2A 2K86A 4NUBA 2OZ6A 2B3HA 1MJAA 1W0TA 2JZYA 1QO0D 2GOXB 4NNJA 2OV7A 2NNNA 3JREA 1FTTA 3V7CA 1XPXA 3PJRA 4EJVA 1BI0A 1WJFA 3F8FA 3FXKA 3TOBA 1X1DA 4MLOA 4MHGA 3ZP5A 2R7VA 1BOBA 1R5ID 2CO5A 4W97A 4CGZA 1E3PA 2L9SA 2PMUA 1USTA 3AL0C 5K7FA 1O3QA 2D1VA 4E7LA 4C3HJ 4DYQA 5HODA 1ZRFA 4DYCA 3FMSA 4PK4A 2VQCA 4RLQA 4A3BJ 2L54A 3CDLA 2KRCA 2VQHA 3J81K 1S7AA 5BOXA 4RB1A 4G7HF 3WU1B 3E1SA 4BAYA 3KP2A 3I58A 3OYLA 2IA1A 2VXZA 2CWEA 4XL9A 5B1AH 4HRIA 4AM3A 5L3GA 3JRDA 2Z3YA 2LY9A 3D0SA 1EV7A 4IHSA 1Z6RA 1ZELA 4MO7A 1PYVA 2CV2A 1GXQA 3U1DA 3C7JA 2PJRA 3ZN1A 3VODA 2KHMA 4BQOA 3LSPA 3BR5A 1HCRA 4YFXF 3H92A 3K2AA 1F9NA 3ABMH 2V1XA 3CUQB 2DMPA 2VL8A 3FZVA 2W7NA 3F23A 2GXBA 4U70A 4U76A 4RB0A 3VFZA 1U9OA 2F4MB 2XGCA 3K6GA 3NWSA 1I5ZA 2NOGA 4GCVA 2H09A 4Q48A 5D5VB 1ZHFA 3J7YJ 2L2OA 3F9KA 1WI9A 3V42A 5C4XJ 4BBSJ 3OYFA 3LSRA 3CJQB 4IQJA 2R5ZB 3WHBA 5J6XA 4NDLA 3CCUI 2Q96A 2JA8J 4FO8A 3L7WA 2FBIA 3W3CA 1D0XA 5IT9Z 1OCZH 1BI3A 1XMAA 2FMYA 2HOAA 4ZC3A 4XRSG 1NK3P 4BQNA 4LGWA 2R7ZJ 2V79A 1TW2A 3KZYA 4GGGA 4UUTA 1T08B 3WTUC 4HQEA 2LG4A 1H88C 1RETA 2N8GA 2JQ7A 2VBXA 1U3EM 4LK0F 1R23A 2VPLA 5LGUA 3BTIA 2DA3A 4EVIA 2NVYJ 2XAHA 2RREA 3PKEA 4G6TB 3LFKA 3ZQCA 5GPAA 4L0YB 3R60A 2EZHA 1BC7C 1KU3A 2LY1A 1Y6IA 4CYCA 2HDCA 4Z6YA 4ZNGA 1STZA 2LFBA 2VKDA 2CW0F 2Q93A 1RI7A 4C2UA 1TT0A 3G3ZA 3OYHA 1BR4A 3EPZA 4L9JA 3ZQHA 3OS0A 1I39A 2XPVA 2XRLA 3GX4X 3A03A 1OCCH 5DM7F 1VQ9I 4MGRA 3CC7I 3CQZJ 2P5LC 2FD5A 2JRMA 3CZ6A 1HKSA 2CUFA 2HZDA 1D3YA 4MNUA 3NWTA 5C44J 3RYPA 4ENNA 3H9GA 4ESFA 2BEOA 4BQQA 3OYGA 3K4JA 2CRGA 2XHKA 4HPQA 4AU7A 4HLYA 4IKSA 2BWXA 2FOWA 5L3DA 3DTKA 4C3IJ 3BJOA 1DP7P 2H6CA 4D5FA 3UKGA 1X19A 3MQ0A 2VJ5A 4CYDA 1WH5A 2P81A 4XRMA 4P9FA 5H6QA 3U21A 4FKCA 3QU6A 2HPIA 1JHHA 4X1EA 5FLXK 1TBXA 4JUQA 2VPRA 3G73A 2LDUA 3K4MA 3F6OA 3QOPA 3T1BA 2L3DA 3O8GA 3ZQFA 1F1ZA 1WJEA 2CFOA 2ZMEC 3HJEA 4KN7X 3V4GA 1MZBA 1W7PB 3KZIC 2HTSA 2P4WA 3K1NA 2H27A 2DMNA 4A0YA 1WL9A 4HF0A 3J7ZI 5CVIA 5ICFA 1YJNI 2X6WA 4UV9A 1N77A 3F8CA 1Y1NA 1W5CC 4D1QA 2JA7J 1UHWA 2VC0A 2JA5J 1B72B 2OTJI 1TTYA 2Q1ZB 5K1YA 2DT7B 1Y0UA 2GAUA 1MDMB 1M35A 4ON0A 5FCFA 3CP8A 1MJ9A 2A69F 4HDUA 3I55I 2EA4A 1DPRA 4ITVA 4PFOA 5LFAA 4E7IA 1WBQA 1I3QJ 5H2FC 2BBYA 2CJJA 4OIQF 3JAMZ 2VONA 1BL0A 1ZK8A 3J7AY 3KIOA 1YJ9I 3K1MA 2PMZA 3CCSI 1WFXA 3OYDA 2VOPA 1VNDA 1WHUA 3SQNA 2LVSA 2IW2A 3T8RA 2LF7A 2DA5A 2CQQA 3NRVA 3M9AA 1Z0XA 2V6EA 2GG0A 1F5TA 3ECHA 3EETA 4FQGA 1NTCA 3Q0WA 1U5TA 3HGGA 2ZB9A 5ICGA 2M4GA 2X1DA 4B28A 1ZR2A 2DW4A 4B09A 2NVQJ 2XAUA 2GXGA 3RQ4A 4YRVA 3F3XA 3M8FA 2DOAA 2HI3A 2GG2A 1IDYA 5F0CA 4J19A 1P4XA 2IS1A 3PKCA 5FO5A 3HKZA 1K6OA 2P98A 2OCCH 2EFWA 2L7KA 1X2MA 9ANTA 3TP3A 2HZTA 4OMYA 3IKVA 4W1UA 1BIBA 3WTXC 1UZCA 2BWTA 1MMDA 1YOVB 3QYFA 2RNJA 5D5UB 3P7NA 2ZSIB 2XPWA 3P9CA 1YYVA 3PM1A 1APLC 1FBSA 3Q0VA 1L0OC 2LOOA 3HOXJ 3V7SA 3ZMUA 2JPBA 5JHFA 2QM3A 2EJRA 2FA5A 1ONVA 3O6BB 4PJNA 4Y17A 2D5VA 1DU6A 3PNYA 4Q47A 1QGPA 1TT5B 3FKJA 3HRMA 1OFCX 2V1DA 1G8XA 4IZZA 1MBFA 2XKPA 2LC2A 4XBFA 5HLTA 1VFCA 2MH2A 1EJ9A 1JUMA 4Y13A 1YQAA 4OAYA 1R49A 1JUPA 4RS8A 2XC7A 3I59A 4A3DJ 2ICWG 2P6SA 3HPHA 5CDVA 1PUEE 1B9MA 1GV2A 3PFIA 4AWXB 4BQAA 1FIAA 4UHTA 5KAIC 4FX0A 3K0LA 3PUBA 3VOEA 5FKMA 1R5HA 5BQTA 4ENJA 2A6HF 4KITB 3WU2C 1GV5A 5CVJA 3OIQA 3M1EA 1MKMA 5ILVA 4S2TP 2BB7A 2GM4A 3HPGA 3DCFA 1ZN2A 4U73A 3X2QH 2X6OA 1OYWA 3BTJA 5JVTA 2DA4A 2DQLA 1SEUA 1J75A 4A6WA 4I99C 4FCYA 2WC2A 3SXYA 3HTSB 4KA4A 2OAZA 3CC2I 2VLAA 2QA4I 3EUHA 5M5WJ 3CCQI 3S15J 2V6CA 3CD6I 1DP3A 5D5WB 3BCBA 2LBFB 2Q0OA 5L3EA 1J59A 4HV6A 1K78B 4LJZF 5D5XB 2DFIA 4AIDA 3FDYA 4ZTFA 4M3BA 3FISA 3ZXSA 1TWFJ 4WWCA 3ISPA 1MNDA 1IJWC 4JBAA 3BZ6A 1GVJA 5FKKA 5DD8A 3GF2A 2A5WA 4L5IA 3HGYA 2Y9YA 1P7IA 3MKLA 1MMSA 1S9HA 1O3SA 2HXOA 1YIOA 4FUKA 5IOZA 3ASNH 2O6GE 1FMVA 1XGMA 4RGUA 2FNAA 2LRDA 2DK5A 4BBRJ 2CQNA 2KISA 5EF6A 4MQVA 2RN7A 3M1CA 3H3UA 3PKDA 3H0GJ 3HUGA 3RORA 2FJ1A 2IS4A 3GLLA 2Q92A 1Y0NA 4FISA 4LFUA 3FXMA 2A6TA 2M0MA 1VQNI 1KQ0A 1IAWA 3MX6A 2Z2SB 2DTRA 2CS3A 5M5XJ 2XAQA 3BCAA 2EILH 2MGQA 3I3LA 1PP8F 1Y1WJ 1B59A 2DJNA 4H0EA 4CO8A 5IYDJ 1WJCA 1SFKA 2DXIA 4O3MA 2FXAA 2W57A 3KP7A 2CMPA 4II3A 1NK2P 2P7CB 4IHWA 1F43A 3BG5A 3SJMA 3CJNA 1KYZA 1SFUA 2H94A 3GTGJ 2PG4A 2X4HA 4J01A 1FWZA 1U8RA 1RR8C 2E7WA 4YIRX 2OJED 5BPIA 3HOWJ 4I7HA 4UV8A 3G2BA 4HBLA 5LGNA 1IZ1A 2LNBA 1M1EB 5DM6F 2IJLA 5BPDA 1BW6A 1TQMA 3SDBA 3RVAA 2ZFUA 4XLAA 2WAQN 3I53A 5F04A 2QKLB 1LFBA 4HV5A 4IO9F 2CQ7A 1YFHA 4B3AA 2AXTC 3E6CC 5LHGA 3GW2A 4A2UA 1G2HA 4E6KG 4E7KA 2RQQA 4UUSA 2MG4A 3E5QA 3Q0UA 4U75A 1Z6TA 2FF4A 1AU7A 4IHTA 3MVPA 4D5CA 1S72I 5E3MA 2R92J 1T0FA 1N25A 1W5TA 3CJRB 4QLCU 1FYMA 5LHHA 5E5BA 3ZMSA 2A07F 2E7XA 2R7FA 3OWTA 1ZLKA 2ID6A 1FOKA 1VF9A 3JAMK 2EIMH 2DDBA 1TNSA 2QGUA 3GLXA 1XDSA 3SZGA 4JOMA 3BG3A 3BTCA 4NB5A 2LH9A 4ENKA 1SD6A 4P5OA 2HXIA 1K83J 2R5YA 5E17F 3FK6A 4R1HA 4DGWB 1I6XA 1C23A 1OJLA 4D7MA 2GLOA 2A61A 1VQ7I 2BW3A 4CZZA 2ZJPF 4YIFA 2CUZA 1WPKA 2MLKA 2R7OA 4UVBA 2R7DA 3MZ8A 2DA1A 4Z7MA 4BXFA 1D0ZA 2ELJA 3MKWB 3BR2A 3EYIA 4UNOA 3ZQ7A 3CUQC 3KX2A 1V55H 1W4MA 2LTPA 2CFXA 1HDDC 4BE1A 1HW1A 3I71A 2F5FA 3CJTB 1KU9A 3FX3A 4ZDLA 4DBRA 3HHHA 3WTZA 1IN7A 4R60A 3ZMZA 4BL0B 2Y75A 1T98A 4HLXA 1G3SA 1MGTA 5M3FJ 2WWYA 1JJ8C 2GQQA 2X1EA 1U9NA 2HDWA 1FMWA 3E5UA 2XASA 4RB2C 1MNMC 1USSA 2ZXWH 5JFRA 2OBPA 2ISZA 2EVOA 4A3MJ 5H20A 2E1MB 1FOXA 5FRMA 1HDPA 2QBYB 3A0BC 1W7PD 2MFZA 1IXCA 1LFPA 1R5GA 1B4AA 4WF2A 2P9AA 4M3GA 4M3EA 3GCMA 4XK4A 1ZRCA 5DCMB 2K3FA 4OMZA 2ZMEA 2DOEA 3I54A 3NARA 5IYBJ 4A6EA 3WTTC 5FKNA 1T39A 2GG3A 3QPLA 1C22A 1ZQ3P 1WCMJ 2FRHA 2DTZA 3WTSC 2IA2A 3LA2A 4G7OF 1LE8A 1LEBA 2L9NA 2FMLA 3AKZA 4F93B 5DEQA 3TDZC 1JGSA 3F72A 4G12A 4KT5C 1TWAJ 1YS6A 5D4SA 4BU2A 2Q94A 3KEYA 3C3WA 3A1YA 1XGOA 3JRGA 3JRFA 2MD5A 1OR7C 1R4NB 1BM9A 2A6EF 2QF7A 5EEHA 1Z05A 3JRBA 1H9TA 1G4DA 2DQRA 5HS9A 1A6IA 4FE4A 2BWVA 3TO6A 3Q6DA 2QCOA 1OISA 4D9JA 5M3MJ 2IT0A 1E17A 2F48A 3KP6A 5FJ8J 4JQFA 2LMDA 3VDXA 3GZ6A 3F22A 3HDDA 3ABKH 2BVMA 4BXXJ 1ZGJA 3ESWB 2H1LA 3F21A 2K9LA 1IDZA 4BS9A 5CQGA 1ZH5A 5J47A 4FLJA 2W48A 4BKXA 3R61A 1FTZA 1T38A 2VJIA 3G6EI 5BS6A 3J80Z 4KMFA 3TBIA 1HF0A 1PDNC 4HEA2 1R22A 3V7RA 5HDNA 2HR3A 4XLPF 5LBQA 2NQ7A 1V5GA 5HNFA 2F5VA 1RESA 1YS7A 1LB2A 2OKNA 3DTEA 5J3LA 1LEAA 1O0XA 5CVVA 2LD5A 5TJJA 1QA6A 3ZN0A 1P7JA 2ZNZA 4KIFA 4B48A 1T33A 5A2QK 1IG7A 3S16J 2O03A 2V3ZA 3B02A 2XKOA 1WJAA 4A12A 3ZQLA 3QU3A 4FTHA 5AIQA 1UHMA 4C30A 1JTYA 2H8WA 2XB0X 5JI6A 3JRCA 2EBIA 6PAXA 4HXXA 4ESBA 1PVEA 3TO7A 1TWGJ 1OCPA 5E20A 4BE0A 4ZDOA 2IPQX 1Y1VJ 3F8BA 2BWWA 1H8AC 2OF7A 4KYWA 1XD7A 4FX4A 1ZG5A 4JP0A 2VQLA 2ECCA 1UMQA 2RKHA 3RPUA 4L0ZB 2EB7A 1P4WA 2DYSH 2KDOA 2X85A 1W36C 1ON2A 1R36A 2QQAA 5F08A 2EPFA 5B1BH 4EATA 1K79A 1Z67A 4KMUX 1T95A 2WTEA 5B3SH 1T56A 1EKEA 3KPHA 4H4KC 5F0FA 2JPCA 2ZNYA 3BWGA 1LPQA 2V3XA 3AG3H 3AFHA 4HYEA 3QQAA 3CMMA 4CYCB 1O7FA 2HQ5A 1IUYA 3MKYB 2COBA 1IC8A 2ZBKA 4JK1X 3VWBA 4X6AJ 3IRRA 3AG4H 3M8JA 5KK1A 5DUIA 1KQ8A 4CH7A 1P2FA 3JTGA 1YRNA 2E2HJ 2QSHX 4HF1A 4Y52J 4PJLA 1D1AA 2X6YA 3DPUA 4IEJA 5FGMA 1ZG1A 4EGYA 3CLOA 4XONA 2KJBA 4YFNF 1YLFA 4N4NB 3TDUC 5IOYA 4UB8C 4EM0B 1SAXA 2E1OA 3W6JB 1OKRA 4HDVA 2GU6A 1K6YA 2IP2A 4OU0A 3NEUA 1VQ4I 2EVCA 1RKTA 1SD5A 1XMKA 1HOMA 1ETQA 1B8IA 1H0MA 2NYXA 2MATA 2L4AA 1S7OA 1C0WA 1GXPA 3LSHA 3OSGA 1XGSA 3P9KA 2M1BA 3CB5A 4XLFA 3D27A 1OYIA 3IH3A 2E2JJ 3KFWX 3IH4A 1TWHJ 5JLWA 5K5RA 4XSXF 2BV6A 3JW4A 2QQ9A 2QWWA 2ME0A 1K4TA 1QHGA 4M3FA 2J5PA 1IUFA 5E1ZB 2MC4A 2YX4A 3QPSA 5CLSA 2FU4A 4L5JA 2K7LA 4CCOA 1F36A 4RM3A 2BYVE 3A0HC 4EGEA 4FE7A 2GIVA 4E7HA 4UY8I 4KFCA 1KU7A 2UZKA 5K5OA 3I4NJ 3CCEI 4II2A 1S8NA 3BR0A 3VPRA 2Y9ZA 4L5EA 3Q3SA 3ZMTA 4IHYA 2ME6A 1IN4A 3GTQJ 3DBRB 2WAEA 3CMEI 4FT8A 4RM2A 1ACIA 3S14J 3E6DA 4FETA 3BROA 4Y4RA 3E0JB 4E7ZA 2VJ4A 4ZYAA 4NQWA 5AONA 3TW6A 1HQCA 5DYMA 3IHUA 5F64A 3W6KB 3LWFA 3PIPF 2B0LA 1JTXA 4CCNA 2DPDA 2XIGA 2OU2A 1XCBA 4BDZA 3GWZA 4DZJA 4KUMA 1MBJA 2F2EA 1T2KA 4KISA 2DMTA 2K4BA 1U5TB 1ZRDA 1XB4A 3S3MA 4BEHA 2Y30A 2E36A 1I27A 5DD4A 2BHBA 3S2HJ 4GDFA 1WSUA 5CDLA 3TL4X 1HBXG 1OYYA 4B1RA 2Z33A 2QSGX 4OOIA 4RGSA 1LDDA 2L7MP 4OINF 4OAZA 5ICCA 3VEPA 2E60A 1X3ZB 2DU9A 4P1WA 4XIDA 1RUOA 4AC0A 1JXSA 4AUXA 4BH9A 3W2AA 3FKIJ 2RNGA 2PQ8A 4HX4A 1RKWA 1QZYA 4IKUA 4X0GA 2G7UA 4MIMA 1HW2A 2DFEA 3DF8A 1IGNA 4C3JJ 2HVSA 2GIZA 3WGHA 4AIHA 1WRJA 3M07A 1V4RA 4OOKA 1J5YA 3GUDA 1R4MB 2O5RA 4S2RP 1TNTA 2DBBA 5J40A 1J7KA 2PBIA 5E3OA 4ESJA 1FSEA 4QPOA 3HOYJ 5EYRA 1QRYA 3SDGA 2IS2A 2F6CA 2HKOA 3MFKA 4HAMA 1MH3A 3Q9SA 4V2FA 4P96A 2PLYA 2KMUA 2DAOA 5CPRB 3T0YA 3WE3A 2CYYA 1P92A 3CESA 1YG2A 2FE3A 1IRXA 2R4GA 5IYCJ 3RQIA 2G9WA 2ID3A 2WY8Q 4XSZF 3DP7A 4BHCA 2JT1A 2X6XA 3PKBA 3S6BA 4EV0A 3I59B 2W25A 3SZTA 5LEKA 2Z5UA 1JKOC 1G3WA 4IRGA 2VUMJ 3K4KA 2F5DA 1R00A 2Q8KA 1SAUA 3AG1H 3K4NA 3LAPA 1RIOH 4IL6C 4UVAA 4XORA 4U6JA 4LD5A 2K02A 2L4MA 2EIKH 2MA3A 2KLOA 4FHTA 3KLOA 3OOUA 1D0YA 5JHUA 2R7SA 4F52A 1XSVA 2O61A 1IV6A 3FBNB 1HW5A 1K4SA 3TMOA 2OD5A 4LLGF 3ZQQA 2IRFG 2H1KA 1RPWA 1A04A 1IV8A 2QLZA 1V5FA 3ABUA 5HDKA 3RJPA 2E2IJ 2E5ZA 2MABA 3CO7C 3PNTA 2WAQA 3A4CA 5LEJA 1D1BA 4WCGA 2CQXA 1K61A 2HQAA 1J0RA 3BG9A 2R3SA 5E3NA 4KJZA 2DCEA 3H5NA 3OY9A 3K9TA 2EIJH 5IY5H 2WV1A 3GZ5A 5CVUA 2XGEA 5HDGA 3KYCB 2ELKA 2XDVA 2V1UA 2HKXA 4A0XA 2EV0A 3CC4I 1ETWA 1XX5A 2K3PA 3ELKA 3OS2A 1BIAA 5FFXA 1WY2A 3WTVC 5KCMA 4LIVA 4D0PA 5HLIA 2DI3A 3GTPJ 4XLCA 2DDAA 2JUGA 1OR7A 5F6FA 3PSFA 1HLVA 2DN0A 2VBWA 2EV6A 4XKWA 3RCOA 2NVXJ 3FHNA 3AL0B 2BWYA 3TAVA 4LB5A 3HUGB 1V3FA 4CZCA 1JKRC 3DXJF 4U7BA 1POGA 2L7ZA 3EYYA 3MAJA 3CTZA 1P4AA 4NBQA 4JX5A 3E5XA 2PN6A 1HA8A 2ZXHA 2P6TA 2IXSA 2J5OA 3RKXA 3WGGA 3TP0A 2X1CA 4PSXA 2E1MC 2AHQA 4DYRA 4ZDPA 1X3WB 5HLHA 1WZ2A 2XF6A 3IUOA 1I6HJ 1WJBA 5CKTA 1O3TA 1WLRA 2HYJA 5DUKA 4Z2YA 3E7LA 2HWVA 3CMYA 2WADA 2E34A 1JE8A 2CW8A 4DBQA 1QNTA 3LFUA 2O7OA 4CCKA 4ZWUA 3WG7H 2IBDA 4DQ2A 3LA7A 2COMA 1GUUA 3L2QA 3TO9A 2BY3A 3CF5F 2HEOA 1J09A 2HOSA 3L00A 4KM3A 2DMUA 1ZKGA 3QRFF 3PIOF 4A3KJ 4EEFG 1QPIA 4A3IJ 1FIPA 2UXXA 1XSXA 2HQRA 3I64A 2W24A 2EZIA 3O8HA 1YI2I 4XM3A 4LG0A 1FYKA 4HNVA 4UUSB 2LKXA 2MD0A 3BZKA 4FASD 4IF4A 3DEWA 3P9IA 5CQEA 4ZWOA 3HRUA 5DCFA 3E6BA 3G1LA 5F27A 3LA3A 4MQ9F 2D45A 4M74A 4U0VA 3F8NA 2HU9A 5IT9K 1MMAA 3KYDB 4JX6A 1I1SA 2F5CA 1SD4A 1DPUA 1R9TJ 1HSTA 2JSPA 5IP6A 1NG7A 3HOTA 5J1YA 1Y39A 1MBGA 3H9JA 2HGCA 1FOWA 4C9YA 4CHUA 2UWMA 2KL4A 1YO5C 3J7AO 5E79C 4E4HA 1ERDA 2R5YB 3MD2A 2QVOA 4RGZ1 4A93J 2H6BA 2M0CA 2ZFWA 1XN7A 2Y2ZA 1FYLA 4G6QA 1GT0C 2KIFA 3FM5A 2X9DA 5FROA 2GA2A 4XQFA 3ASOH 1JT0A 3DPLC 3C2BA 4S01A 3U2RA 4ZYDA 1MD0A 5CNXA 1N51A 4S05A 1PJRA 2FX0A 1ORKA 2KT0A 3EUKL 3FXJA 4C2MJ 4ZH4F 3ECOA 1BI2A 2ZC2A 3OYAA 1IXSB 1YVMA 3QP5A 2DK8A 4WXCA 5GAGJ 1A6QA 4E70A 4MFDA 4BNCA 2EFNA 3O3KA 1ETYA 1LJ9A 4A3GJ 2KP6A 2FEZA 4F91B 1MBKA 1Z1DA 1K7AA 4RGRA 2JA6J 1W1WE 4CSWA 2LLKA 4CCMA 1AKHA 4ZYEA 2MYSA 1LUJB 2HPMA 1IO2A 3FIWA 3QODA 4XMYA 3HB9A 3MZHA 3IH2A 1TLHB 3SEQA 3M3YJ 4G6DA 5HVQC 3HZJA 1MMGA 2ZMEB 4FO7A 3N05A 3W6VA 2XF5A 3VYSB 4LG3A 3HOUJ 2WA0A 2I10A 4PDKA 2VE9A 4Q4ZF 2JN6A 3IAM2 1AOYA 3OYKA 1SD7A 4I09A 2KIMA 1Y8RB 3GTKJ 4U6ZA 2AQEA 2M2EA 1LE8B 4MATA 2QEXI 2EFQA 2ELHA 3KEQA 3K70D 1BJAA 3U9GA 2ESHA 1JAWA 2L5QA 2OUMA 3DU6A 1ITYA 1UELB 5DS9A 3J81Z 3WTWC 1VTNC 3HSRA 3OL3A 2FNPA 1VQ5I 3IKTA 4I0BA 3OL4A 2GG7A 3NAUA 1IRGA 3JSPA 4KIBA 2R7WA 3DPTA 3OYNA 2YS9A 1B9NA 2BHYA 4ZYHA 3K1PA 4CCJA 5LRSA 3T8TA 4I02A 2B3LA 3GMEA 1V54H 4BHPA 4MTDA 3OIPA 1X3UA 2DFHA 1R6RA 2GG5A 2TDXA 3PSIA 2GU5A 3PQJA 5ILSA 1YW9A 4WX9A 4KICA 4MEXF 4F7ZA 4HZFA 3CCRI 3ABTA 2HVQA 2M8EA 4BY7J 3DU5A 4OWRB 2BY0A 2CUEA 2LYCA 3S8PA 3QPTA 4CCLA 1VQLI 1HKQA 2Z99A 3BG7A 4ABZA 2L0KA 3DBHB 1VQPI 3FXLA 1UG0A 4KNYA 1XNZA 2LKSA 2VOOA 2MH9A 1SVLA 3KEOA 1ZR4A 1EF4A 2V1NA 5EEAA 2JJ7A 1V5EA 3L2UA 1FLIA 2EWNA 2M87A 1TW3A 3T5XA 3FHZA 1ZG3A 2IGMA 3E6MA 4YIIA 2IA0A 3MMYB 2E71A 5FD5A 4DZPA 4Y7NJ 3FWEA 1QBJA 2BWUA 4IKRA 1UAAA 3K4LA 1JKPC 2W85A 4B44A 4IXAA 5K7ZA 5HNHA 3QPHA 2MLGA 2VQGA 3CO6C 4BXUA 1VQOI 2M4KA 4N0BA 1AWCA 3K70C 2GGBA 2MBFA 5GPCA 4IKTA 2K27A 2DYRH 5ILUA 4U6WA 1QPMA 1G59A 2XF7A 5IP7J 3E97A 3JCUC 2K85A 5JLXA 1R1VA 2KKOA 2V7FA 3RPQA 2V26A 2OA4A 2OQGA 5JR3A 1DU0A 4E7JA 2PJPA 2RQPA 3RSNA 2DO7A 1UFMA 4UB6C 1MSEC 2KRHA 5FB2A 2VB6A 1TQIA 3HG9A 2R7RA 4IKFA 2R7UA 3KP4A 4ZJZA 4FLIA 5E8IA 3S3OA 3FM3A 4QPQA 3WGIA 2ZO4A 2M30A 3IU7A 3HC7A 2GZ5A 2ECBA 4ZYGA 3PUFA 2EFPA 4XKBA 3DLAA 4CDGA 1LNWA 4WK8F 3K4BA 4AIJA 3FXUA 2O8KA 3H3VK 4BGDA 2LY2A 1SFOJ 2B7EA 4ASNA 4PNCA 5C3EJ 2O3FA 3RKWA 2Q2EA 3AAFA 1HC8A 3S1QJ 2GOMA 3L2CA 2XV4S 4P9UA 1C21A 1FY7A 3EQLF 3I5UA 4A5MA 5J1RA 2W82A 3OYEA 3Q9VA 2V9VA 2RC4A 2BHDA 4NC8A 4BE2A 3WHCA 2E19A 1HKTA 2CSOA 3BIQA 5FFZA 2G7HA 1YRNB 2R7XA 3CF2A 3DFGA 3RDIA 3ZMDA 5H6RA 4PCQA 2ACJA 4A6VA 5DV5A 2Y69H 4DOZA 5EGOA 3BR1A 4A3JJ 4M73A 3BQZA 2UV1A 4LIUA 3B6AA 3GYHX 3HYIA 1HXDA 1WJDA 1H9GA 3H35A 3DEUA 2R7TA 5IT3A 2M34A 4EJTA 3B6CA 5GAEJ 1WGXA 2CV0A 1VQ6I 5DDGA 1Z3YA 3ZQIA 3KYLA 2NAZA 1KYWA 3HRSA 1E3HA 1Y8QB 2GXAA 2OTLI 3ZPLA 1QZZA 4RDUA 3TB5A 1B8IB 1FBQA 4PGGA 2PJRB 1CGPA 3P5JA 4I2OA 4I98B 1QU3A 2P7VB 1VQKI 1GDTA 4U7DA 2R93J 5FCHA 2KIQA 2MW8A 1RUNA 1GHCA 3D1NI 1Z7LA 2GBYA 1Z77A 4L9VA 3V8LA 3I9V2 5CIKA 3HOZJ 2LSOA 4U87A 2KQRA 1TQPA 3H0DA 3OOPA 3MEXA 1MATA 3C1DA 4HW0A 3SEZA 3BOQA 3TOAA 3CMAI 4RLFA 1BA5A 3WE2A 1RZ4A 2BWSA 2G6PA 3N97A 2VODA 3VSLA 1GVDA 3EDPA 1A31A 1G3YA 5FKOA 2LP0A 2ZSGA 2EINH 5EG0A 4G7ZF 1CQTA 4U71A 2NRAC 1Z7UA 2EQRA 3DTIA 2EFOA 1LQ1A 3PKAA 5IPAA 3G1OA 3LL7A 2NXNB 2RGVA 1QXZA 2CUJA 3GTOJ 2QBYA 1WL6A 3HOVJ 2XROA 3COAC 3ZQGA 2GU7A 3OYBA 2NS8A 4AVPA 5CDEA 2Y31A 3IL2A 5L3CA 1OQYA 4Y33A 5E3LA 2NOJB 3VYRB 4CA0A 2JVGA 2XRNA 3L9FA 1KU2A 1YX3A 3LQRA 3ERMA 4BEHB 3B73A 4EM1A 3HOSA 3IWZA 5GP9A 1UG2A 1ZGWA 1A5JA 3LSTA 3GVAA 2HOWA 1QVUA 1S3JA 1SVOA 1QHHD 4M72A 4AYBN 3HSFA 4RGXA 4A6DA 1I3AA 1UCRA 3UR3C 2NVUB 3H9QA 2STTA 1JHFA 2M3AA 2K40A 2HQNA 3M7GA 3MWMA 1WWXA 5BMZA 1FPQA 1ETKA 1SFXA 1FSHA 1IW7F 1I1GA 3FXRA 1X58A 1W7VA 3IU9A 4RZZA 1Z3XA 4O5VA 2WAFA 4IJAA 2VE8A 3CCMI 3N4MA 2H8RA 4ENMA 4B8XA 3G1MA 1RC9A 5L3FA 1JUSA 1LKXA 1SVMA 4M9XA 4BJ5C 1XG1A 1SMYF 3ONQA 4HX7A 3HSEA 2F5EA 4IRIA 3WTYC 1G6NA 4RAFA 2KFDA 4IRHA 2B63J 1X1AA 2BH3A 4B43A 1LVKA 3E3VA 1CHMA 1BOAA 1ZGAA 5M5YJ 2W1OA 4ZZLA 2YUSA 4O6JA 2P0WA 3Q5FA 2AO9A 1E2XA 5KHDA 4OIRF 4M9ZA 4AIKA 3GFLA 3L09A 2IS6A 3DKXA 1CF7A 2P99A 4M3DA 2AS5F 3DKYA 3LOCA 1IN6A 2QKMB 2GG8A 1FP2A 2QQBA 2XUBA 3SHFA 3JRHA 4GO1A 2Q95A 4U0YA 3IU8A 1AHDP 1YJWI 1OLTA 1VZ0A 2R0QC 2IAIA 1FX7A 2XVCA 3S3NA 2BHZA 4IDYA 2BHCA 2VKHA 2TCTA 1QXYA 4LITA 3G71I 3CCVI 2RDPA 1TP4A 5E8GA 5FD6A 3PL8A 4PGHA 3A01A 1O4XA 2E5NA 2JWTA 3HM5A 1MIJA 1PUFA 3L24A 3H36A 1IF1A 4NHJA 1BC8C 4M6YA 1Y56A 2OQRA 3S1RJ 1FT9A 2AXLA 2K9MA 1N78A 1FC3A 2GZWA 2V3YA 1T0FC 4XLHA 3L2RA 2GTXA 3OR1C 5JVGF 5FRNA 4DIQA 2NS0A 2XSJC 1MNEA 1WI3A 2M9HA 4GFBA 4QR8A 1P9QC 5ICEA 3MZYA 2FQ3A 2OC6A 2RV8A 3RKQA 5AIPA 5J8CA 1KP0A 1B1BA 4XRSA 5LRRA 4YFKF 1ZREA 1ETXA 4XR6A 3OYIA 3ERED 3C2HA 2X48A 4R8HA 1SC7A 2JVHA 1L3LA 1D8KA 3BJ6A 3A02A 4PZJA 2GGCA 2VBZA 5E18F 2BE5F 2FOKA 2RAEA 3K7AJ 5F1JA 2QSFX 2EZLA 1UHSA 2FQ4A 2UUZA 5LD2C 3WU0A 2NNYA 1X4PA 2DMQA 1I50J 1WVRA 4IPAA 4M6VA 5K5QA 5HLGA 4LOCA 4EQQA 2IW5A 2KIUA 4LMYA 1DGWY 3G4SI 2PI0A 2VC1A 5TGTA 2HNHA 4B3XA 3K69A 3EUAA 4KIGA 1JT6A 2ZJQF 3GEZA 3FXQA 4I6ZA 3V8JA 5D6EA 3W2VA 2GA1A 1X2NA 3QOEA 1ENHA 1KQ9A 3BC8A 1YHQI 3KE2A 2D1HA 1XS9A 2JSCA 2K5CA 3H3ZA 3D5RC 3S32A 4U6EA 1MH4A 4PJMA 4U6CA 1EH7A 2EK5A 1O57A 2MSYA 2DA6A 2ISYA 3MCZA 1R58A 3IC7A 3CUQA 3J80K 3DKWA 2M45A 2AQFA 4UXNA 2O0YA 5EZGA 4MFEA 1EA3A 4MTEA 2W4SA 2M5WA 3RZOJ
chains in the Genus database with same CATH topology
5ED4A 3NQOA 1XGNA 1W2MA 1Q1HA 5HS8A 1ZARA 4R79A 1BBYA 3GFMA 5HOOA 1YW7A 1FZPB 2E1NA 4S04A 3QAHA 4RZYA 3PQKA 5L3BA 2ZJ2A 4QWQA 3KLNA 3SFZA 4I01A 4LG0B 3V8KA 2A3SA 1IXRC 3RI4A 1FNNA 3M8EA 1C24A 4FLKA 3RIRA 2PEXA 4HX8A 4G94A 4PV4A 5D8LB 4RAYA 4GYGA 3BPXA 4HF2A 3FF5A 2Y0MA 1YW8A 2YR2A 4ETSA 4IF7A 2FSWA 4N9IA 4G9YA 1NHAA 3OV8A 2OZUA 1HSJA 2GWRA 4U69A 1WN1A 1D5VA 4DNCA 2IVMA 1S6LA 2HOEA 4UVCA 1G3TA 4K2EA 2XAJA 4I0AA 4IU6A 1REPC 3LAJA 3TKYA 2L02A 1WKMA 2GG9A 1W7PA 5D6FA 5E1WA 2Y48A 1RNLA 3GFIA 1EH8A 2BHAA 1IRFA 4GXOA 2C6YA 1MDMA 1DDNA 1XSDA 2QYOA 2HYFA 3BITA 3CTAA 1IN8A 4AD9A 1BI1A 4IECA 2XAFA 4U88A 4BYYA 3HRTA 4LLLA 2HS5A 3DQVC 1O7LA 4U1BA 3BDDA 1R1TA 4LLNA 4M6XA 2ZCWA 3WODF 4Y15A 3R0AA 3MATA 3BY6A 1FP1D 2XAGA 2EA2A 1FBUA 2CG4A 3CDHA 3VB2A 3R0JA 3GXOA 1J9IA 2HTJA 4YG2F 3MR1A 1EH6A 2P5VA 4XRFA 1Z9CA 3HHGA 1LDJA 3R4KA 3K2ZA 1U6GA 1S29A 5A2QZ 1U78A 1ODDA 5F1RA 1SMTA 2VT3A 1P6RA 2CGPA 2L01A 3JSOA 4Q5SF 1SFEA 2O8XA 1J2XA 1MJBA 2PMHA 3KP5A 2QENA 1ZYRF 4A0ZA 3RTRA 4RB3C 4CXFA 1LDKB 2STWA 2WV0A 2FBHA 5EEGA 2LF8A 2DT5A 2JTVA 4ZWPA 2Z9OA 1W5SA 5ERIA 3ZMVA 3FMRA 4EJOA 2BN7A 1XCVA 1KA8A 3GO5A 3ROUA 5CYVA 3JTHA 2VN2A 3BJAA 1OPCA 4M9SA 1UB9A 4LK1F 2W84A 2ADUA 2NQ6A 2QUFA 4EGZA 2D2WA 4EMSA 3IG4A 2K4JA 5E1XA 3S2WA 5CJ9A 1K78A 4S00A 2QZ8A 1ZLJA 2PFBA 2E1CA 1C27A 3C18A 1PP7U 1YTYA 5CE6A 4LB6B 2B3KA 3SZPA 4ZZDA 2ETHA 2ESNA 2YX7A 4N9HA 1U2WA 4FLLA 1IN5A 3FMQA 4WXHA 4MEYF 4WXDA 4P55A 3HTUA 3CUOA 3BP8A 5J8FA 4L9NA 4UUVA 5LHIA 3KP3A 3ML6A 4TV7A 2X0LA 4M71A 4BHBA 4A5NA 3F6VA 4HOBA 1R1UA 5TRDA 3TQNA 1BN5A 1YJ3A 3F8MA 3KZZA 1ON1A 3D5LA 4HA8A 1U5TC 3TGNA 1QXWA 1Z91A 3HIFA 1DUXC 3R6SA 1B6AA 2MC3A 1F4KA 3GFJA 3KCCA 2HYGD 3I4PA 2RVCA 5D8KB 2BGCA 4EJWA 3CB6A 4HQMA 1LVAA 3IRQA 2EVMA 5LGTA 3REOA 4GYIA 3DV8A 1ZAOA 4KDPA 1PV9A 5LLQA 5FLXZ 2ZXJA 1WQ2A 4U0WA 1OMIA 4KN4X 2GU4A 3ULQB 4G8XA 2YU3A 2DLLA 5D4RA 1D8JA 4CICA 2HFHA 1R7JA 2CQKA 2UXNA 2ZKZA 2XGXA 3WG9A 2P5KA 2VBYA 2VT2A 3RKYA 2YSRA 4L9TA 1O3RA 1XDUA 2A5YB 3KETA 1CF7B 2A68F 4EM2A 3RYRA 3BIPA 3I0TA 3L7GA 3QP6A 4L18B 3IWFA 1A16A 5HS7A 1KGSA 5KVRA 4XLNF 2FBKA 2P8TA 2YPRA 3O2PE 4EJUA 2EV5A 3BPVA 4RAZA 1T6SA 1QQIA 2KRFA 1ULYA 5DCMA 2JRTA 2LKPA 5CVRA 3LQQA 2DPUA 4OIOF 4OIPF 4IVNA 2KJCA 2K86A 2B3HA 2OZ6A 1MJAA 2JZYA 1QO0D 2NNNA 3V7CA 4EJVA 1BI0A 3F8FA 3TOBA 4MHGA 3ZP5A 2CO5A 4CGZA 2PMUA 1USTA 1O3QA 2D1VA 1ZRFA 3FMSA 2L54A 3J81K 1S7AA 5BOXA 4G7HF 3WU1B 4BAYA 3KP2A 3I58A 2IA1A 2VXZA 2CWEA 5L3GA 2Z3YA 3D0SA 1EV7A 4IHSA 1Z6RA 1GXQA 3U1DA 3C7JA 3ZN1A 3VODA 4YFXF 3H92A 1F9NA 2V1XA 3CUQB 3FZVA 3F23A 2GXBA 4U70A 4U76A 4RB0A 3VFZA 4Q48A 4GCVA 1I5ZA 2H09A 5D5VB 1ZHFA 1WI9A 5J6XA 4FO8A 2Q96A 3L7WA 2FBIA 5IT9Z 1XMAA 1BI3A 2FMYA 4LGWA 2V79A 1TW2A 3KZYA 4GGGA 3WTUC 4HQEA 2VBXA 1U3EM 4LK0F 1R23A 5LGUA 4EVIA 2XAHA 3PKEA 3LFKA 4L0YB 3R60A 1BC7C 1KU3A 2HDCA 4ZNGA 1STZA 2Q93A 2CW0F 1RI7A 3G3ZA 4L9JA 3GX4X 4MGRA 2P5LC 1HKSA 4MNUA 1D3YA 3RYPA 4ENNA 4ESFA 2BEOA 2XHKA 4HLYA 4IKSA 2BWXA 5L3DA 3BJOA 1DP7P 2H6CA 3MQ0A 4CYDA 4P9FA 5H6QA 4FKCA 3QU6A 1JHHA 5FLXK 1TBXA 4JUQA 3G73A 2LDUA 3F6OA 3QOPA 3T1BA 2L3DA 1F1ZA 3V4GA 4KN7X 1MZBA 1W7PB 2HTSA 2P4WA 3K1NA 2H27A 4A0YA 1WL9A 4HF0A 5CVIA 5ICFA 4UV9A 3F8CA 1Y1NA 1UHWA 2VC0A 1TTYA 5K1YA 1MDMB 1Y0UA 2GAUA 1M35A 4ON0A 5FCFA 1MJ9A 2A69F 4HDUA 2EA4A 1DPRA 1WBQA 2BBYA 4OIQF 3JAMZ 2VONA 3K1MA 2VOPA 3SQNA 2IW2A 3T8RA 2LF7A 3NRVA 3M9AA 2GG0A 1F5TA 3ECHA 3EETA 1U5TA 5ICGA 4B28A 2DW4A 4B09A 2GXGA 3F3XA 3M8FA 2GG2A 1P4XA 3PKCA 5FO5A 1K6OA 2P98A 2EFWA 2HZTA 4OMYA 3IKVA 3WTXC 1BIBA 2BWTA 2RNJA 5D5UB 3P7NA 3P9CA 1YYVA 1FBSA 1L0OC 3V7SA 3ZMUA 2JPBA 2QM3A 2EJRA 2FA5A 1ONVA 3O6BB 4Y17A 4Q47A 1QGPA 3HRMA 2V1DA 2XKPA 4XBFA 2MH2A 4Y13A 1YQAA 4RS8A 3I59A 2P6SA 5CDVA 1PUEE 1B9MA 3PFIA 4AWXB 4BQAA 4UHTA 4FX0A 3K0LA 3VOEA 1R5HA 5BQTA 4ENJA 2A6HF 5CVJA 3M1EA 1MKMA 5ILVA 4S2TP 2BB7A 4U73A 1ZN2A 5JVTA 1OYWA 2DQLA 1J75A 4A6WA 2WC2A 3SXYA 3HTSB 4KA4A 2OAZA 3EUHA 2V6CA 5D5WB 2Q0OA 5L3EA 1J59A 4HV6A 1K78B 4LJZF 5D5XB 2DFIA 4WWCA 3ISPA 4JBAA 3BZ6A 1GVJA 5DD8A 3GF2A 4L5IA 1O3SA 1YIOA 4FUKA 2O6GE 1XGMA 4RGUA 2FNAA 2DK5A 4MQVA 2RN7A 3PKDA 3H3UA 3HUGA 3RORA 2Q92A 4LFUA 1KQ0A 1IAWA 3MX6A 2DTRA 2XAQA 1PP8F 1B59A 4H0EA 4CO8A 4O3MA 2FXAA 2W57A 3KP7A 2P7CB 3CJNA 1KYZA 1SFUA 2H94A 2PG4A 2X4HA 1FWZA 1U8RA 2E7WA 5BPIA 4I7HA 4UV8A 4HBLA 5LGNA 1IZ1A 2LNBA 2IJLA 5BPDA 1TQMA 3RVAA 3I53A 4HV5A 1YFHA 3E6CC 5LHGA 3GW2A 4A2UA 3E5QA 4U75A 1Z6TA 2FF4A 4IHTA 1T0FA 1W5TA 4QLCU 1FYMA 5LHHA 5E5BA 3ZMSA 2A07F 2E7XA 2R7FA 1ZLKA 1FOKA 3JAMK 1TNSA 3GLXA 1XDSA 4NB5A 4ENKA 1SD6A 4P5OA 5E17F 4R1HA 1I6XA 1C23A 2A61A 4CZZA 4YIFA 2MLKA 4UVBA 2R7DA 4Z7MA 3EYIA 4UNOA 3ZQ7A 3CUQC 1W4MA 2CFXA 1HW1A 3I71A 2F5FA 1KU9A 3FX3A 3HHHA 3WTZA 1IN7A 4R60A 3ZMZA 2Y75A 1T98A 4HLXA 1G3SA 1MGTA 2WWYA 2GQQA 3E5UA 4RB2C 2XASA 1USSA 5JFRA 2OBPA 2ISZA 2EVOA 5H20A 2QBYB 1W7PD 1IXCA 1R5GA 1B4AA 4WF2A 2P9AA 1ZRCA 5DCMB 4OMZA 2ZMEA 3I54A 4A6EA 1T39A 2GG3A 3WTTC 1C22A 2FRHA 3WTSC 2IA2A 3LA2A 4G7OF 1LEBA 2FMLA 5DEQA 3TDZC 1JGSA 3F72A 4KT5C 1YS6A 5D4SA 2Q94A 3C3WA 1XGOA 2MD5A 2A6EF 1BM9A 5EEHA 1Z05A 1G4DA 1H9TA 2DQRA 5HS9A 2BWVA 3TO6A 3Q6DA 1E17A 2IT0A 3KP6A 4JQFA 3GZ6A 3F22A 1ZGJA 3F21A 1ZH5A 4FLJA 3R61A 1T38A 5BS6A 3J80Z 4KMFA 1PDNC 3V7RA 1R22A 5HDNA 2HR3A 4XLPF 5LBQA 2NQ7A 1YS7A 1LB2A 2OKNA 1LEAA 1O0XA 5CVVA 5TJJA 3ZN0A 2ZNZA 4KIFA 5A2QK 2O03A 2V3ZA 3B02A 2XKOA 4A12A 3QU3A 5AIQA 1UHMA 5JI6A 6PAXA 4HXXA 4ESBA 3TO7A 5E20A 2IPQX 3F8BA 2BWWA 4KYWA 1XD7A 4FX4A 1ZG5A 2RKHA 3RPUA 4L0ZB 2EB7A 1P4WA 1ON2A 1R36A 2QQAA 1K79A 4KMUX 2WTEA 2JPCA 2ZNYA 3BWGA 2V3XA 4HYEA 1O7FA 1IUYA 2ZBKA 4JK1X 3IRRA 5KK1A 5DUIA 1KQ8A 1P2FA 3JTGA 4HF1A 1ZG1A 5FGMA 4EGYA 3CLOA 2KJBA 4YFNF 1YLFA 3TDUC 4EM0B 1SAXA 3W6JB 1OKRA 4HDVA 2GU6A 2IP2A 4OU0A 3NEUA 2EVCA 1SD5A 1XMKA 1H0MA 2NYXA 2MATA 2L4AA 1S7OA 1C0WA 1GXPA 1XGSA 3P9KA 2M1BA 3CB5A 3D27A 1OYIA 3KFWX 5K5RA 4XSXF 2BV6A 3JW4A 2QQ9A 2QWWA 5E1ZB 2J5PA 4RB1A 5CLSA 2YX4A 2FU4A 4L5JA 2K7LA 2BYVE 4EGEA 2GIVA 4KFCA 1KU7A 2UZKA 5K5OA 1S8NA 3ZMTA 1IN4A 4FT8A 3E6DA 3BROA 4NQWA 5AONA 1HQCA 5DYMA 3IHUA 5F64A 3W6KB 3LWFA 2B0LA 2DPDA 2XIGA 2OU2A 1XCBA 3GWZA 4KUMA 1T2KA 2F2EA 2K4BA 1U5TB 1ZRDA 1XB4A 1I27A 5DD4A 2BHBA 1WSUA 5CDLA 1HBXG 1OYYA 2Z33A 4OOIA 4RGSA 1LDDA 4OINF 5ICCA 3VEPA 2DU9A 1JXSA 1RUOA 4BH9A 2PQ8A 4HX4A 1QZYA 4IKUA 2G7UA 1HW2A 3DF8A 3WGHA 4AIHA 1WRJA 1V4RA 4OOKA 1J5YA 3GUDA 4S2RP 1TNTA 2DBBA 1J7KA 2PBIA 4ESJA 1FSEA 2HKOA 3MFKA 4HAMA 3Q9SA 4P96A 2PLYA 2DAOA 3T0YA 3WE3A 2CYYA 1P92A 1YG2A 2FE3A 2G9WA 4XSZF 3DP7A 4BHCA 2JT1A 3PKBA 3S6BA 4EV0A 3I59B 2W25A 3SZTA 5LEKA 2Z5UA 1G3WA 4IRGA 2F5DA 1R00A 2Q8KA 3LAPA 1RIOH 4U6JA 4UVAA 4LD5A 2K02A 2L4MA 2MA3A 4FHTA 3KLOA 5JHUA 2O61A 1XSVA 1HW5A 2OD5A 4LLGF 2IRFG 1A04A 2QLZA 3ABUA 5HDKA 3RJPA 3CO7C 5LEJA 4WCGA 1J0RA 2R3SA 3K9TA 5CVUA 3GZ5A 5HDGA 2V1UA 2HKXA 4A0XA 2EV0A 3ELKA 1BIAA 5FFXA 1WY2A 3WTVC 4D0PA 5HLIA 2DI3A 1OR7A 5F6FA 2VBWA 2EV6A 2BWYA 3TAVA 4LB5A 1V3FA 3DXJF 4U7BA 3EYYA 3MAJA 3CTZA 1P4AA 3E5XA 2PN6A 2P6TA 2J5OA 3RKXA 3WGGA 5HLHA 1O3TA 1WLRA 5DUKA 4Z2YA 2HWVA 1JE8A 1QNTA 4ZWUA 4DQ2A 3LA7A 2COMA 3TO9A 2HEOA 3L00A 4KM3A 3QRFF 2UXXA 1XSXA 2HQRA 3I64A 2W24A 4LG0A 1FYKA 4IF4A 4ZWOA 3P9IA 3HRUA 5DCFA 3E6BA 4MQ9F 3LA3A 2D45A 4U0VA 4M74A 3F8NA 5IT9K 1I1SA 2F5CA 1SD4A 1DPUA 1HSTA 3HOTA 2HGCA 4CHUA 2UWMA 1YO5C 3J7AO 2QVOA 4RGZ1 2H6BA 2ZFWA 1XN7A 1FYLA 4G6QA 2KIFA 3FM5A 2GA2A 3DPLC 4S01A 3U2RA 4ZYDA 1MD0A 5CNXA 1N51A 4S05A 4ZH4F 3ECOA 1BI2A 1IXSB 1YVMA 3QP5A 2DK8A 4WXCA 4E70A 4BNCA 2EFNA 3O3KA 1LJ9A 2FEZA 1Z1DA 1K7AA 4RGRA 4ZYEA 3MZHA 1TLHB 4G6DA 5HVQC 2ZMEB 4FO7A 4PDKA 2VE9A 4Q4ZF 1AOYA 1SD7A 4I09A 2KIMA 4U6ZA 4MATA 2EFQA 2ELHA 3KEQA 1BJAA 3U9GA 2ESHA 1JAWA 3J81Z 3WTWC 1VTNC 3HSRA 2FNPA 3IKTA 4I0BA 2GG7A 1IRGA 3JSPA 4KIBA 3DPTA 1B9NA 4ZYHA 3K1PA 5LRSA 3T8TA 4I02A 2B3LA 4BHPA 4MTDA 1X3UA 2GG5A 2TDXA 2GU5A 3PQJA 5ILSA 1YW9A 4WX9A 4KICA 4MEXF 4F7ZA 4HZFA 3ABTA 2M8EA 3QPTA 1HKQA 2Z99A 4KNYA 1XNZA 2VOOA 2MH9A 3KEOA 1FLIA 2EWNA 2M87A 1TW3A 3T5XA 3FHZA 1ZG3A 4YIIA 3E6MA 5FD5A 2IA0A 4IKRA 2BWUA 3FWEA 1QBJA 2W85A 4IXAA 3QPHA 2MLGA 3CO6C 4BXUA 4N0BA 1AWCA 2GGBA 2MBFA 4IKTA 2K27A 5ILUA 4U6WA 1QPMA 3E97A 1R1VA 2KKOA 3RPQA 5JR3A 2OA4A 2OQGA 2PJPA 2RQPA 2DO7A 1UFMA 5FB2A 1TQIA 3KP4A 4FLIA 5E8IA 3FM3A 3WGIA 2ZO4A 2M30A 3IU7A 2GZ5A 4ZYGA 2EFPA 4WK8F 4CDGA 1LNWA 4AIJA 3FXUA 4ASNA 4PNCA 2O3FA 3RKWA 2Q2EA 3AAFA 3L2CA 2XV4S 4P9UA 1C21A 1FY7A 3EQLF 3I5UA 4A5MA 3Q9VA 2V9VA 2RC4A 2BHDA 1HKTA 2CSOA 3BIQA 5FFZA 2G7HA 3DFGA 3RDIA 3ZMDA 5H6RA 4PCQA 2ACJA 4A6VA 5DV5A 4M73A 3GYHX 3HYIA 1HXDA 1H9GA 3DEUA 5IT3A 4EJTA 5DDGA 2BH3A 2NAZA 1KYWA 3HRSA 3ZPLA 1QZZA 3TB5A 1FBQA 4PGGA 4I2OA 1CGPA 4I98B 2P7VB 4U7DA 5FCHA 1GHCA 1RUNA 4L9VA 3V8LA 5CIKA 2LSOA 1TQPA 3OOPA 3MEXA 1MATA 3C1DA 4HW0A 3BOQA 3TOAA 3WE2A 1RZ4A 2BWSA 2G6PA 3N97A 2VODA 3EDPA 1G3YA 2ZSGA 4G7ZF 4U71A 2NRAC 1Z7UA 3PKAA 1LQ1A 2EFOA 2RGVA 1QXZA 2QBYA 1WL6A 2XROA 3COAC 2GU7A 4AVPA 5CDEA 3IL2A 5L3CA 2XRNA 3L9FA 1KU2A 3LQRA 3B73A 4EM1A 3HOSA 3IWZA 3LSTA 3GVAA 2HOWA 1S3JA 4M72A 3HSFA 4RGXA 4A6DA 1UCRA 2STTA 1JHFA 3M7GA 2HQNA 3MWMA 1WWXA 5BMZA 1FPQA 1SFXA 1FSHA 1IW7F 1I1GA 3FXRA 1W7VA 3IU9A 4RZZA 4O5VA 4IJAA 2VE8A 3N4MA 4ENMA 4B8XA 5L3FA 4M9XA 1SMYF 4HX7A 3HSEA 2F5EA 4IRIA 3WTYC 1G6NA 4IRHA 3E3VA 1CHMA 1BOAA 1ZGAA 4ZZLA 4O6JA 3Q5FA 1E2XA 4OIRF 4M9ZA 4AIKA 3GFLA 3L09A 1CF7A 2P99A 2AS5F 1IN6A 2GG8A 1FP2A 2QQBA 2XUBA 3SHFA 4GO1A 2Q95A 4U0YA 3IU8A 1FX7A 2XVCA 4IDYA 2BHCA 1QXYA 2RDPA 5E8GA 5FD6A 4PGHA 3L24A 1IF1A 4NHJA 1BC8C 4M6YA 2OQRA 1FT9A 2AXLA 1FC3A 2GZWA 2V3YA 2GTXA 2NS0A 4QR8A 5ICEA 3MZYA 2FQ3A 2RV8A 5AIPA 5J8CA 1KP0A 1B1BA 5LRRA 4YFKF 1ZREA 3ERED 1L3LA 4R8HA 1D8KA 3BJ6A 4PZJA 2GGCA 2VBZA 5E18F 2BE5F 2FOKA 3WU0A 2NNYA 4IPAA 5K5QA 5HLGA 4EQQA 2IW5A 2KIUA 4LMYA 2PI0A 2VC1A 3K69A 4KIGA 3GEZA 3FXQA 3V8JA 5D6EA 2GA1A 1KQ9A 3KE2A 2D1HA 2JSCA 3H3ZA 4U6EA 4U6CA 1EH7A 2EK5A 1O57A 2ISYA 3MCZA 1R58A 3IC7A 3CUQA 3J80K 3DKWA 2M45A