1XGSA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 97
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgsA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgsA01
4RGXA 4DNCA 3LSTA 2ELHA 2GGCA 2XVCA 2VBXA 2UXNA 1R23A 5LGUA 3QPHA 1KYZA 4U0VA 2MD5A 5FFZA 4P9UA 2DQLA 3DKWA 2BV6A 2Y75A 2CFXA 4ZWOA 2M8EA 1AWCA 1C22A 4EJWA 1MJBA 3Q9VA 4HOBA 1S29A 2X0LA 2W57A 2GG7A 2BGCA 1BI3A 2H6BA 1CGPA 3PQJA 3PFIA 2XAHA 2LKPA 4NHJA 5E5BA 2K4JA 4D0PA 4ETSA 1KU9A 4PDKA 2GXBA 3MQ0A 2PLYA 4UV8A 2F2EA 2OKNA 4Q4ZF 1IF1A 1R1TA 5CDLA 1ONVA 1W5SA 4P96A 1U78A 1TLHB 2OZUA 1B1BA 5D6FA 5D4RA 3TAVA 3S6BA 4ZYGA 3IWFA 5ERIA 2E7XA 3H3ZA 2GGBA 4UVBA 2BWWA 3E3VA 2JT1A 1F1ZA 2QENA 3F6OA 4MEXF 1G3YA 1XMKA 4HQEA 3TKYA 4MNUA 3DFGA 2K02A 1B9MA 2HQNA 5KVRA 1ZREA 1IAWA 4HX4A 4IKRA 4S2RP 3E5QA 3RPQA 1GXPA 4IJAA 1G4DA 4HF2A 4EVIA 1FY7A 3R61A 3IG4A 4G9YA 1B6AA 4Y13A 1PUEE 5K5RA 4M6YA 4KICA 4RB0A 2DPUA 3F23A 2EV0A 5DCMA 1ZG5A 3J81K 4OMZA 2WC2A 4R60A 1SFUA 2P6SA 2BYVE 3MZHA 1XMAA 1R58A 4R8HA 2VC0A 1TW2A 3L7WA 1FP2A 2QVOA 3LQRA 1IW7F 3BOQA 3V7CA 3BY6A 2RDPA 3LA2A 1U6GA 4FUKA 2D1VA 4Z7MA 3BDDA 2KIFA 5HOOA 3TQNA 3I4PA 2C6YA 1YYVA 1FC3A 1FBUA 4B09A 3RKYA 2AXLA 1BN5A 1STZA 2GA1A 4OINF 4EMSA 3O2PE 1I27A 3E97A 3MEXA 3E6CC 3RTRA 3GWZA 4S00A 3IRQA 4WX9A 2O0YA 2A69F 2LSOA 3K69A 3IRRA 4HF1A 1N51A 3NRVA 1PV9A 2A3SA 4QWQA 3CLOA 3HTUA 1UCRA 4ENNA 3U2RA 2FBKA 2FNAA 2PQ8A 2XV4S 4UNOA 1M35A 4WXHA 2HKXA 1OYIA 4YFKF 2UZKA 4HLXA 1G3WA 5E8GA 4I7HA 1YW7A 2GXGA 1A04A 1OPCA 3J80Z 1PP8F 2Z9OA 1FSHA 4TV7A 2PFBA 3MX6A 3LQQA 2STTA 3SFZA 1O3QA 4GYGA 3WTTC 2PMHA 1P92A 3FHZA 4IVNA 2W84A 2DPDA 2F5FA 3FX3A 3M8FA 3RYRA 3IL2A 4KA4A 4M73A 1HW1A 4HYEA 5IT3A 2W24A 4M72A 1S3JA 3Q9SA 5CYVA 3FMSA 2GU4A 4HF0A 5LHHA 1ZG1A 2FNPA 1J75A 3BJOA 4NQWA 2MBFA 1YG2A 2QQ9A 1SFXA 2STWA 1GHCA 3MZYA 1YS6A 5HLHA 3K1MA 2XKPA 3QU6A 4M9XA 4I0AA 3HHGA 5K5OA 3OOPA 3CDHA 4U76A 5A2QK 1FP1D 2DAOA 4HX8A 2J5OA 2IP2A 2Z5UA 1XCVA 5AONA 4U75A 3T1BA 2DU9A 1J9IA 1QXZA 2M45A 3ML6A 4KIGA 2E1CA 3F6VA 5E1ZB 2TDXA 3ZN1A 5FCFA 3C7JA 4AIHA 2Q93A 5D8LB 1YO5C 4L0ZB 3WTVC 1MKMA 4WCGA 2FSWA 3Q5FA 3PKAA 1I5ZA 1DDNA 2UXXA 2RQPA 1OKRA 3ZQ7A 2CO5A 3RDIA 2CG4A 2P4WA 1K78A 2Z33A 4A5NA 2QUFA 2HEOA 4YIFA 2GZ5A 4LLNA 4ESJA 2HYFA 1TTYA 2ZMEA 4U7DA 1R22A 1KU2A 1TW3A 1W4MA 1W5TA 1JE8A 2V1UA 4P9FA 3T8TA 4FX0A 1MATA 2XAGA 3E5XA 2YX4A 4RS8A 4GYIA 5DD4A 5H6QA 5LRRA 4WWCA 5CVJA 1Y1NA 3KLOA 4FLLA 1WBQA 4M9ZA 2EVCA 2XUBA 5ICEA 1HXDA 1QZYA 2FRHA 1Z7UA 1CF7B 4PCQA 3O6BB 3RYPA 4LLLA 3ERED 4EV0A 2R7DA 4F7ZA 1B4AA 2P99A 2EA2A 1S8NA 4EJOA 1BOAA 1RZ4A 2IPQX 3WGHA 1KQ8A 4UHTA 1F9NA 4A6DA 4AIKA 4L18B 1R5GA 1B59A 3BIQA 3AAFA 3EUHA 3O3KA 4HDUA 1HBXG 1W7PA 4HAMA 1DP7P 3HRMA 2O3FA 3R0JA 2IA0A 1W7PB 4KUMA 4U69A 5ICGA 3GYHX 1HSJA 1JHHA 3J81Z 4CO8A 2VT2A 4KIBA 2HYGD 5IT9K 4HBLA 2V79A 2K86A 3RPUA 3LAPA 1LDJA 1A16A 4EM1A 3CB6A 2UWMA 1LDKB 2EJRA 5HLGA 4A12A 2BHBA 1QGPA 2FU4A 3W6JB 4YG2F 3E6DA 3V4GA 4CZZA 4PGHA 2VXZA 3HTSB 2JRTA 4RZZA 2CW0F 1KYWA 4ZH4F 3V7SA 2XHKA 2VE9A 1TNTA 4IKTA 3EYYA 1KGSA 2ISYA 1FLIA 4YIIA 1QBJA 1T98A 1D8KA 1KU3A 4IF4A 3HRTA 1ZGJA 4L5JA 4S04A 2H09A 1RI7A 1RUOA 4N9HA 1W2MA 2BHCA 1HQCA 1FZPB 1IZ1A 2P5KA 5K5QA 2RGVA 5AIQA 2W25A 5D8KB 3KP4A 1P4AA 1WL6A 4RB2C 3L24A 1XDUA 5CDEA 5BMZA 2P9AA 3BWGA 6PAXA 1QPMA 3HOTA 2L01A 2ZNZA 4HV6A 4ENMA 4U6JA 5A2QZ 4AWXB 3H92A 2BN7A 4KT5C 2EVOA 2NYXA 1MDMB 4XRFA 4R1HA 3F22A 2M87A 4MHGA 1OYYA 1YQAA 1XN7A 2BE5F 5H20A 2IRFG 2D45A 3F8FA 2P5VA 4XBFA 3GFLA 4BHCA 5CE6A 2EFPA 3JTGA 2EWNA 4KNYA 4H0EA 1BI2A 5LEKA 2Q95A 1LB2A 2B3LA 2GG8A 2XAJA 5DD8A 1WL9A 4I2OA 3LAJA 1S6LA 3SXYA 3I5UA 3WGGA 2P7CB 3MATA 4I01A 5ILSA 2GG9A 1XGSA 1QNTA 2CQKA 1KQ0A 5DDGA 4Q5SF 2QQAA 2E1NA 3U1DA 3EDPA 3ZMTA 2QQBA 1DPRA 1K79A 2EFQA 1DPUA 3KEOA 2GIVA 1HW5A 2FEZA 5DUKA 3N97A 5EEHA 4U6WA 3ZMSA 1OR7A 1HKSA 4AIJA 5DV5A 3GFJA 1SD5A 1Y0UA 5CLSA 3LWFA 3WU1B 1IXRC 3ZMVA 2QLZA 1BC8C 3GFMA 3V8LA 2GWRA 4HLYA 4LB5A 1USTA 1U2WA 4PZJA 2O61A 4IPAA 3ECHA 4YFNF 2KJCA 2GG5A 2CYYA 1SD4A 4EJVA 4UV9A 2B3KA 3DEUA 3K1NA 4UVAA 2F5EA 1P4XA 1J2XA 4OMYA 1XSXA 1YVMA 4FO7A 1WSUA 1IN4A 2NQ6A 2A6EF 3HYIA 1K78B 1V3FA 4U73A 1ZG3A 4GXOA 1E17A 1MGTA 5LEJA 4S2TP 5LBQA 2VOPA 3F3XA 3WTWC 1FWZA 1LNWA 1ZARA 5HVQC 1UB9A 4A0ZA 3WODF 4EJUA 1FYMA 5TJJA 3QRFF 2HKOA 1F5TA 1YFHA 1IRGA 4OIPF 2BWSA 2YPRA 3COAC 4OIQF 4EQQA 2O8XA 1CHMA 3M8EA 3MAJA 2XAFA 4LMYA 4WF2A 2FBIA 3U9GA 3VOEA 3FMQA 2M5WA 1W7PD 2QBYB 4ZZDA 1O7LA 3KP2A 1P2FA 5DCMB 2L4MA 4BXUA 2Y0MA 2VE8A 3ULQB 5CVUA 5AIPA 3F8BA 2XIGA 3IU9A 2Q0OA 4HDVA 1C27A 1GXQA 1XGNA 5L3DA 3FXUA 1WKMA 2DTRA 1XSDA 5FLXZ 3E6MA 5J6XA 2QYOA 2XAQA 4GO1A 1Z1DA 1OYWA 4CGZA 3HSEA 4KIFA 1MZBA 4G7OF 2OQGA 1O0XA 3DQVC 3FM3A 3WU0A 5CVVA 1XB4A 4RAYA 5ILUA 3F8MA 5D4SA 4LG0B 2KJBA 3B73A 4LB6B 1O7FA 4MQ9F 2VN2A 1YW9A 1U8RA 2M30A 2Y48A 1FX7A 2JPBA 2CGPA 3OV8A 2ZJ2A 3BPVA 4EGZA 3E5UA 2Q2EA 5LRSA 5DYMA 4RGSA 2EV5A 5LLQA 3N4MA 2A61A 4FLIA 1ULYA 2DK5A 2BEOA 1U5TB 5LHGA 1WI9A 2PBIA 4JBAA 3C3WA 1FOKA 3I0TA 4Z2YA 2VOOA 1T39A 1QZZA 2D2WA 4LK1F 3KP6A 2IW2A 5D5XB 2BWXA 3JW4A 3J80K 1I1GA 4E70A 4A2UA 1NHAA 4KDPA 2K27A 1FYKA 4N9IA 4OU0A 2Q8KA 2NNNA 3I54A 5HLIA 2ACJA 3PQKA 4U0YA 4ZWUA 3TDUC 1ZAOA 2Z99A 4RGUA 1IRFA 3L00A 3EETA 1HSTA 2VBYA 1B9NA 3RIRA 2P5LC 3M9AA 2MATA 1IN5A 1LEAA 3QP5A 5E20A 1T38A 2KIMA 5E1XA 2CSOA 2OBPA 2H94A 1J59A 3BITA 2JPCA 1GVJA 1FYLA 4I02A 2RKHA 2BH3A 3ZN0A 1YJ3A 4K2EA 2X4HA 1LVAA 5JHUA 3IWZA 2K7LA 5TRDA 1SMYF 4MEYF 1YS7A 4LFUA 2IA2A 3VEPA 2Q96A 3KP5A 1QXYA 3ZMDA 1MD0A 5CJ9A 1R1UA 4S05A 3KP7A 2HWVA 5E1WA 3GO5A 2DK8A 2A5YB 3R4KA 2ZNYA 1BM9A 2PEXA 3BIPA 3K0LA 3TOAA 4HW0A 2VODA 1FT9A 1ZLKA 2GG3A 4BH9A 3VB2A 2OA4A 4L9VA 4P55A 2PJPA 4MATA 1R1VA 4DQ2A 3P7NA 4CYDA 2D1HA 1ZN2A 5CVIA 2L54A 4CXFA 1CF7A 4QLCU 3JAMZ 2XGXA 1TQPA 4B28A 4PNCA 1BJAA 3WG9A 4XSZF 1SFEA 5D6EA 4I09A 2XRNA 3T5XA 2ZO4A 1XNZA 3WE3A 4OOKA 2P7VB 3TOBA 4IKSA 5H6RA 2GAUA 4G6DA 3D5LA 3I58A 4FT8A 4IF7A 1ZYRF 1FBSA 5F6FA 4KMUX 2V6CA 1UHWA 2A68F 3IU8A 1BI0A 3L9FA 5JFRA 5ICFA 3SZTA 4HV5A 2BWVA 3DV8A 4A6EA 5JI6A 3F8NA 3V8KA 3ROUA 4M6XA 4MGRA 3I59A 1D3YA 2XKOA 4A0XA 3ELKA 3K2ZA 1H0MA 2ISZA 3TGNA 1IN8A 4IXAA 3WTYC 2V3YA 4PV4A 3TO6A 2KRFA 1RNLA 3JSPA 1KP0A 2ZMEB 3WGIA 2IT0A 1U5TA 1WN1A 2OZ6A 2DT5A 3D0SA 2R7FA 3D27A 1IN7A 3C18A 3JAMK 3GVAA 5L3CA 1X3UA 2W85A 3FM5A 3K1PA 4U1BA 3HOSA 1P6RA 2PN6A 1ZRFA 4RGRA 2CWEA 2KKOA 5FGMA 1D8JA 2EV6A 2QWWA 3CUQB 5BOXA 4BNCA 4BAYA 3KZYA 5HS8A 1BC7C 4IU6A 3C1DA 2V1DA 2ESHA 1V4RA 4M74A 4LK0F 5CDVA 4UUVA 1SMTA 3ECOA 3CTAA 3DXJF 4O6JA 1LJ9A 1PP7U 5CVRA 3HHHA 3DPTA 4M71A 1EH8A 5ED4A 5DCFA 4EGEA 2FBHA 2FF4A 3IKVA 4NB5A 2VC1A 2FMLA 4CHUA 4CICA 1I6XA 3GZ5A 4L0YB 1K6OA 5HDKA 1XSVA 2HOEA 4HA8A 3GLXA 4L9NA 1S7OA 1XCBA 3FXQA 4I98B 1LQ1A 1Z91A 2E7WA 4A5MA 3PKDA 4FX4A 3HRUA 3V8JA 3DF8A 5E17F 2HFHA 1C23A 2V3XA 2J5PA 2WTEA 4U71A 5DEQA 5L3GA 3HSRA 4ZYHA 3PKEA 1BI1A 4P5OA 4GCVA 5K1YA 1UFMA 4LJZF 2V1XA 4MTEA 4IRGA 2XASA 2ZBKA 2ZCWA 4FKCA 1IUYA 1C21A 4UXNA 1ZGAA 5J8FA 4BYYA 1O57A 3KEQA 5D5WB 1R7JA 4EM2A 2GU5A 4G7ZF 3FMRA 1WY2A 3RI4A 2GZWA 3RORA 2JZYA 4XSXF 2NQ7A 2LF8A 4ESBA 3CO7C 1JGSA 5D5VB 4I0BA 5DUIA 2A07F 3KZZA 3RKWA 5KK1A 3BPXA 4LD5A 2AS5F 3IU7A 1HKTA 4IDYA 2G7HA 5J8CA 1RIOH 1AOYA 1TBXA 4O5VA 2BBYA 4OIRF 2L3DA 3RJPA 4ZZLA 4JUQA 1D5VA 1DUXC 2EK5A 2HDCA 3BJAA 2Q94A 2Q92A 2RVCA 1SD7A 1H9GA 3DPLC 1L0OC 2OQRA 4EJTA 5BPIA 2L02A 5FFXA 1Z6RA 1YW8A 4WXDA 3ISPA 2EA4A 2A6HF 3KCCA 3R0AA 3ZP5A 1P4WA 1KU7A 5HS7A 4AVPA 3K9TA 1C0WA 4Y17A 1UHMA 1IN6A 4R79A 2MA3A 1JAWA 4IHSA 1TQMA 1K7AA 3S2WA 1ZH5A 1J7KA 1G3SA 3CUOA 4Y15A 4A6WA 4FO8A 1TQIA 2OAZA 1VTNC 3QPTA 2ETHA 3W6KB 5L3FA 2F5DA 4RB3C 4MTDA 3TO9A 1J5YA 4GGGA 1EH7A 2H27A 3T0YA 3MFKA 4M9SA 3M1EA 4IECA 1MDMA 3SZPA 4UVCA 1JXSA 2DFIA 2COMA 3VODA 4U6EA 4ASNA 2NAZA 5FD5A 2FOKA 3TO7A 4L9TA 2LDUA 2NRAC 2OU2A 3F8CA 3GXOA 5FD6A 4EM0B 4G8XA 1BBYA 3JSOA 4ON0A 2HGCA 5BPDA 1S7AA 2FQ3A 1OMIA 5FO5A 2YSRA 5HDNA 3VFZA 2EFOA 3GUDA 1R00A 2ADUA 2VBWA 4ZNGA 2V3ZA 3DP7A 2GG2A 2HS5A 4CDGA 3I59B 2NNYA 3KFWX 5FLXK 2QM3A 4U7BA 2FMYA 4JK1X 1QQIA 3GX4X 4KMFA 1MJ9A 1I1SA 3B02A 2P6TA 3P9KA 4XLNF 5ICCA 2Z3YA 5BQTA 4PGGA 2YU3A 5D5UB 5F64A 1G6NA 1C24A 5E8IA 2LF7A 3QAHA 2DBBA 4BQAA 2B0LA 3CJNA 3KETA 3GW2A 3IC7A 3QP6A 2ZSGA 2FE3A 2EFNA 1T0FA 1ZRCA 3ABTA 2O6GE 4HX7A 2PG4A 1WLRA 4U6ZA 2ZFWA 3I53A 1YLFA 2F5CA 3QU3A 2XROA 2MC3A 2L4AA 1G3TA 5IT9Z 3J7AO 2GU6A 4G6QA 3V7RA 1SD6A 4IRIA 2DW4A 2VONA 3EQLF 1IXCA 1W7VA 2EFWA 2HR3A 3KE2A 5BS6A 2ZXJA 5HDGA 1EV7A 3HIFA 4Q48A 4XLPF 4YFXF 2MLGA 3FZVA 2IA1A 4IHTA 1KA8A 5F1RA 3RKXA 4FLJA 3TB5A 2ESNA 3ABUA 2HTJA 3KP3A 2P8TA 3L7GA 3ZMUA 1E2XA 2RNJA 4IKUA 1F4KA 1BIBA 1JHFA 3SQNA 3WTXC 3G73A 1REPC 3MCZA 2NS0A 3PKCA 2OD5A 4FHTA 2O03A 1L3LA 1FPQA 2G9WA 1XD7A 3ZMZA 1WRJA 1ODDA 2MH9A 2GTXA 3GF2A 2PI0A 1Z9CA 1H9TA 4G7HF 2H6CA 1IXSB 5HS9A 3WE2A 3SHFA 4RB1A 2MLKA 5FCHA 3E6BA 3CTZA 4ZYEA 3WTUC 3F72A 3LA7A 5EEGA 4HZFA 2PMUA 1ZRDA 2HQRA 1U3EM 2HZTA 1Z05A 3FWEA 2WV0A 3T8RA 2JSCA 4U88A 2WWYA 3EYIA 2ZKZA 4KYWA 4ZYDA 1FNNA 2B3HA 2M1BA 4N0BA 5E18F 1ZHFA 4RGZ1 4U6CA 3P9CA 3WTSC 1YIOA 4LLGF 4BHBA 3GZ6A 5ILVA 2BHDA 5CIKA 3NEUA 2BHAA 3PKBA 3NQOA 1PDNC 4QR8A 5L3BA 1USSA 3REOA 4ENKA 1LEBA 1BIAA 1WWXA 1HKQA 3P9IA 4A6VA 2YR2A 2QBYA 3CUQA 1Z6TA 3R60A 4B8XA 3L09A 1ZLJA 2YX7A 5L3EA 1XDSA 2LNBA 4ENJA 5LGNA 4A0YA 4BHPA 3MWMA 3HRSA 1QXWA 3CO6C 3CB5A 1O3RA 3CUQC 1FSEA 3ZPLA 4HQMA 4L5IA 1WQ2A 2RC4A 3TDZC 1U5TC 3M7GA 1QO0D 2V9VA 3L2CA 2GG0A 3LFKA 4KM3A 1LDDA 3GEZA 5JR3A 2RN7A 3LA3A 3F21A 4ESFA 2MH2A 3FXRA 2VT3A 3FF5A 2IVMA 2BWTA 3BP8A 1ON1A 5CNXA 3I71A 2G7UA 2K4BA 2GA2A 4L9JA 3WTZA 4ZWPA 4EGYA 2GQQA 5LGTA 1O3SA 2DI3A 2GU7A 1R36A 3H3UA 1RUNA 3JTHA 5FB2A 4HXXA 4Q47A 3IKTA 2RV8A 4OOIA 2QZ8A 4KFCA 1T6SA 1Q1HA 2IJLA 1R5HA 2P98A 4WXCA 2G6PA 4RAZA 3HSFA 3Q6DA 4OIOF 4G94A 4FLKA 5JVTA 2VBZA 1XGOA 1KQ9A 2IW5A 1T2KA 4MQVA 2FA5A 4RZYA 4JQFA 3G3ZA 3IHUA 3BROA 3RVAA 3I64A 1EH6A 2BWYA 4KN7X 2EVMA 4S01A 2BB7A 3MR1A 4O3MA 2R3SA 4AD9A 4U70A 2BWUA 3BJ6A 1MJAA 4KN4X 4U0WA 3R6SA 2KIUA 4IRHA 1TNSA 4WK8F 3HUGA 3GFIA 1FBQA 2HOWA 1HW2A 2HTSA 1J0RA 2JTVA 1O3TA 1XGMA 1YTYA 5LHIA 2DO7A 2DLLA 2FXAA 2EB7A 2DQRA 4LGWA 3BZ6A 3QOPA 1ON2A 3KLNA 1SAXA 4LG0A
chains in the Genus database with same CATH superfamily
2DJNA 4RGXA 2HDDA 4DNCA 3LSTA 4HRIA 5LD2C 3ZOBA 4ZTJA 2ELHA 2GGCA 2XVCA 2VBXA 2VJJA 1EF4A 2UXNA 4PUSA 2NVXJ 1R23A 1V5EA 4XN3A 3AG3H 3ASNH 4XLAA 5LGUA 3QPHA 5IYCJ 1KYZA 4AYBA 1ETXA 4U0VA 3D1NI 2MD5A 5FFZA 2BVMA 2DQLA 4P9UA 3DKWA 2BV6A 2Y75A 2CFXA 4ZWOA 2M8EA 1AWCA 1C22A 1D1CA 4EJWA 1MJBA 3Q9VA 4HOBA 1S29A 2X0LA 2W57A 3C2HA 3O8GA 4DJAA 2GG7A 2BGCA 3RZOJ 1BI3A 4RAGA 3HL2A 2I8DA 3QPSA 2R7UA 1LE8B 2H6BA 5IYDJ 1CGPA 3IH3A 3PQJA 3PFIA 2LKXA 2XAHA 3BTIA 2QA4I 2LKPA 4NHJA 3A01B 5E5BA 2K4JA 3JRBA 1ETOA 4D0PA 4ETSA 1KU9A 4PDKA 2GXBA 4D5CA 3MQ0A 1BOBA 2PLYA 2DMPA 4UV8A 2F2EA 4NBQA 3S93A 3DWLE 2OKNA 4Q4ZF 3M07A 2G0EA 1IF1A 4UY8I 3AL0C 1R1TA 2XPUA 2KISA 2EBIA 2XF5A 1ONVA 1W5SA 3BR6A 2P0WA 4P96A 1U78A 3K4MA 1TLHB 3S1MJ 4IHVA 2OZUA 3A0HC 3H9QA 3CMYA 1B1BA 2WA0A 5D6FA 5D4RA 3TAVA 3S6BA 3VYTB 3IWFA 5ERIA 4ZYGA 2E7XA 3J7ZI 1OCRH 3DBRB 2D5VA 2LMDA 3G2BA 3H3ZA 3GTKJ 2GGBA 1RPWA 4UVBA 2BWWA 4BQQA 3E3VA 2JT1A 1F1ZA 2QENA 2Z1DA 3F6OA 4MEXF 1G3YA 3CJQB 1XMKA 2X1CA 1ETWA 4HQEA 3TKYA 2XB0X 1H88C 2DMQA 2HVRA 1MMSA 4MNUA 4DIQA 3DFGA 2K02A 2M8GX 1B9MA 2HQNA 3I9V2 5KVRA 1ZREA 1X3ZB 2X6YA 1IAWA 2A5WA 4HX4A 2KLOA 4IKRA 3BT9A 4S2RP 3E5QA 3L1PA 3RPQA 1GXPA 4IJAA 1G4DA 4HF2A 3PM1A 4EVIA 4PFPA 1FY7A 3R61A 3IG4A 2W82A 4G9YA 1VQLI 1B6AA 4Y13A 2KT0A 5K5RA 1PUEE 2HU9A 4KT6A 4M6YA 2ZMEC 4KICA 4RB0A 2BXYA 5IOZA 2DPUA 3F23A 2EV0A 5DCMA 2ZXHA 1ZG5A 3RQIA 3GTQJ 3J81K 4OMZA 5EG0A 4ANJA 3CDLA 2WC2A 4R60A 1SFUA 2P6SA 2L9SA 2ZSHB 2BYVE 4BGDA 3MZHA 1RETA 3MD2A 1XMAA 1TWAJ 1R58A 4R8HA 5FROA 4CSWA 2VC0A 1TW2A 3Q0VA 4A3LJ 2MC4A 3L7WA 1Y39A 1FP2A 3TL4X 2QVOA 3LQRA 4JYKA 5K7FA 1IW7F 3BOQA 3V7CA 3FXJA 3BY6A 3LSIA 2H1LA 2RDPA 3DEWA 2WBMA 3LA2A 2ICWG 2A05A 3LSHA 1U6GA 2KRHA 4NC7A 4XK4A 4FUKA 2D1VA 1MNDA 1AKHB 4Z7MA 3BDDA 2EZKA 3W2WA 2KIFA 4E6KG 4EGEA 2VQLA 5HOOA 3VYSB 5DTDA 1XX5A 3FBIB 3TQNA 4XRMA 2ID6A 3I4PA 2C6YA 4XNFA 1YYVA 1FC3A 2CU7A 1FBUA 4B09A 3RKYA 1YX3A 2AXLA 4J19A 4NDLA 2HQ5A 1GV5A 1BN5A 1STZA 2GA1A 2X85A 4OINF 3O2PE 4EMSA 4BXXJ 1MMDA 1I27A 1VQMI 4RDUA 3E97A 3MEXA 3E6CC 3LFUA 1VQ5I 3RTRA 2FD5A 3GWZA 4S00A 3IRQA 4IHWA 5B3SH 4WX9A 3PO3J 2O0YA 3MMYB 2A69F 2LSOA 3K69A 4ZJZA 3IRRA 3QOEA 1ZR4A 4HF1A 1N51A 3C2GA 1U9NA 2M7BA 2XSJC 4X1EA 3NRVA 1PV9A 1XMXA 2A3SA 1VQNI 4QWQA 3CLOA 3HTUA 4AYBN 1UCRA 4F92B 2LKSA 3PFYA 4PJLA 4ENNA 2DA7A 3OOUA 3U2RA 2FBKA 2FNAA 2PQ8A 2XV4S 4UNOA 2JRMA 3H1CA 4WXHA 2HKXA 1M35A 1OYIA 4YFKF 2UZKA 4HLXA 1G3WA 5E8GA 4I7HA 4A69C 1YW7A 1BR2A 2GXGA 1APLC 1A04A 1OPCA 1LPQA 1JI8A 3J80Z 3S1RJ 1JJ8C 4M3DA 3CP8A 1PP8F 2Z9OA 1X19A 1FSHA 4TV7A 2PFBA 3HC7A 3MX6A 2PJRA 4AIDA 4CCLA 3LQQA 3Q0UA 2COBA 4YEJA 2STTA 3SFZA 4MLOA 2QKLB 1O3QA 4GYGA 3WTTC 1VQ7I 2PMHA 5EEAA 1P92A 3FHZA 5IP9J 4IVNA 2CS3A 1QVTA 2W84A 3IH4A 3HOUJ 3HG9A 1TWCJ 2ZFUA 1JTYA 2Y31A 1TT5B 2GBYA 4N4NB 5F0CA 2DPDA 2F5FA 3FX3A 4F52A 3M8FA 2DTZA 1RRJA 3RYRA 3IL2A 3QYBA 5K7ZA 4KA4A 4M73A 2MD0A 3J7AY 1HW1A 4HYEA 3SEZA 5IT3A 2W24A 2R5YA 4M72A 1S3JA 3Q9SA 5CYVA 2NXNB 2X1EA 3ZQHA 1VQ4I 3FMSA 1QPIA 2GU4A 4HF0A 5LHHA 1ZG1A 2FNPA 1J75A 4NUBA 2M2EA 3BJOA 4NQWA 1V54H 3FXLA 2MBFA 2OCEA 1D0YA 3PSIA 2IEKA 1YG2A 2QQ9A 1SFXA 2STWA 1IJWC 1GHCA 3E7LA 3MZYA 1YS6A 5HLHA 3K1MA 2XKPA 2W00A 1RKWA 3QU6A 4XMYA 4B48A 4M9XA 2IGMA 4I0AA 2HOAA 3HHGA 2LLKA 5GPAA 3JREA 5K5OA 3CCVI 3D5SC 5EJCA 2Y69H 3DTIA 2KMUA 2E2HJ 3OOPA 1Z67A 3CDHA 4U76A 5A2QK 3X2QH 1FP1D 4XORA 2DAOA 4HX8A 2J5OA 2E71A 3OYKA 3H5RA 2IP2A 2Z5UA 1XCVA 4UB6C 5AONA 4U75A 3T1BA 2DU9A 2MGQA 1YRNB 1J9IA 1QXZA 1QZEA 3K4LA 2M45A 3ERMA 3QYEA 3ML6A 1H89C 1JT0A 4FE7A 3MZ8A 1S72I 2DDAA 4KIGA 5TISC 1VQ8I 1JGGA 3NAUA 2E1CA 3F6VA 5E1ZB 2TDXA 4BE0A 2GOXB 3ZN1A 4EATA 5FCFA 3C7JA 4AIHA 4Y4RA 3S3OA 2Q93A 1HDDC 1WHUA 2WB1N 5D8LB 5TGTA 1YO5C 4L0ZB 3WTVC 2IBDA 1X1PA 1MKMA 2CW7A 4WCGA 1YITI 2FSWA 1D1AA 2R7WA 3Q5FA 3PKAA 1I5ZA 1BW5A 3FXOA 1DDNA 2L2OA 2UXXA 2RQPA 1S7EA 3PJRA 1OKRA 3ZQ7A 2CO5A 3RDIA 2E2IJ 1JTXA 2CG4A 5F27A 2P4WA 3BG6A 2Z33A 4UUSA 1K78A 3UR3C 1ZQ3P 4A5NA 2R4GA 2HQAA 4D7MA 2DT6A 3HKZN 3CZ6A 4EEFG 1XS9A 1V5GA 1GV2A 2QUFA 1R9TJ 2DMUA 2E1OA 2HEOA 2F5VA 4YIFA 2GZ5A 4LLNA 4Y33A 1YE9A 4ESJA 1WCMJ 1SVOA 2HYFA 2L7FP 1TTYA 2ZMEA 4U7DA 1R22A 1KU2A 1HCRA 1IRXA 1TW3A 1W4MA 1W5TA 2CH0A 1JE8A 1GT0C 4AVZA 2V1UA 1QHGA 4P9FA 3ONQA 3T8TA 4FX0A 1MATA 2XAGA 3E5XA 2YX4A 2AHQA 4RS8A 3HM5A 4GYIA 5DD4A 5H6QA 3OYCA 5LRRA 2LY9A 4WWCA 2GIZA 2JA5J 3LSKA 2P81A 4C3HJ 5CVJA 1Y1NA 3KLOA 4FLLA 1WBQA 4M9ZA 3JR9A 4IOCF 2EVCA 4Z6YA 2M7AA 2XB5A 2XUBA 4QSHA 1A31A 5ICEA 1HXDA 4F3QA 1QZYA 3MKWB 2LBFB 3HPHA 2FRHA 4BS9A 5E3MA 1Z7UA 1CF7B 2VQCA 4B1RA 3S15J 1NTCA 2OTLI 4PCQA 3O6BB 3RYPA 4LLLA 3ERED 2A6TA 2VKHA 1IRZA 2VLAA 4EV0A 2R7DA 4F7ZA 4B3AA 3HOXJ 1NH3A 4FETA 1B4AA 2LVSA 1N77A 2P99A 2VQGA 2R5ZB 2EA2A 1S8NA 4EJOA 1BOAA 1RZ4A 2R5ZA 5CQGA 2IPQX 3WGHA 1KQ8A 4UHTA 3JRCA 2DA2A 1HOMA 1NK3P 3L2VA 2EIMH 1R4MB 2QGUA 1YIJI 1F9NA 4A6DA 4AIKA 1IGNA 2GM4A 4ZDOA 4L18B 1QU3A 1R5GA 1B59A 3Q0WA 3BIQA 3AAFA 1EJ9A 3EUHA 2MYSA 3O3KA 4HDUA 1HBXG 1W7PA 4HAMA 2HOTA 1DP7P 3HRMA 2O3FA 3R0JA 4HEA2 2IA0A 2MFZA 1W7PB 1B72B 1A5JA 5EZGA 4DYCA 4A3FJ 4W97A 4KUMA 4U69A 1MBHA 5ICGA 3GYHX 3CCLI 3K7AJ 1HSJA 3K2AA 1JHHA 3J81Z 2FJ1A 4CO8A 2VT2A 4KIBA 1A35A 2HYGD 1GUUA 4V19K 3LMMA 2K40A 5IT9K 4HBLA 5K7HA 2V79A 2K86A 1ZK8A 1X4OA 1Z3XA 3LSMA 3RPUA 3LAPA 1LDJA 1A16A 3DKYA 3ZQQA 4EM1A 2ZSIB 3CB6A 3JRIA 2UWMA 1LDKB 2EJRA 5HLGA 4A12A 2BHBA 1QGPA 3DBHB 2FU4A 3W6JB 5FKLA 4YG2F 3E6DA 3V4GA 2UUZA 4CZZA 2RAEA 4PGHA 2VXZA 5C4XJ 3HTSB 2JRTA 4RZZA 2CW0F 2VPLA 3ZQLA 1KYWA 4ZH4F 3V7SA 2XHKA 1DQUA 2VE9A 1TNTA 1O4XA 1WZ2A 4IKTA 1WJFA 4ITVA 3EYYA 1IDZA 1KGSA 2ISYA 1FLIA 4YIIA 1QBJA 3S1QJ 1T98A 1D8KA 3L2WA 1KU3A 4IF4A 3HRTA 2L9NA 1DU0A 4E7ZA 3CC4I 3DTKA 1ZGJA 1VZ0A 4XKWA 2E5ZA 4L5JA 4S04A 2L9RA 1PUFA 4RLQA 2H09A 1RI7A 3DTEA 1RUOA 2HXIA 1HC8A 4N9HA 1W2MA 2BHCA 1HQCA 1WJBA 1PUFB 1FZPB 1IZ1A 2ZJRF 2P5KA 1IUFA 2RGVA 2BW3B 5AIQA 1KZHA 2W25A 4CCJA 5K5QA 5D8KB 3KP4A 1P4AA 4DYRA 1WL6A 4RB2C 3L24A 4BEHA 3CLQA 3SDGA 3A4CA 4RM2A 1XDUA 3AKZA 5CDEA 3RZDJ 5BMZA 1EA3A 2P9AA 3BWGA 4X0GA 6PAXA 1QPMA 3HOTA 4KITB 3PNVA 2L01A 2ZNZA 1T33A 3HBLA 4HV6A 4N4OB 4ENMA 4U6JA 5A2QZ 4AWXB 1D5YA 3H92A 2R5YB 2BN7A 2XRLA 4KT5C 3OSFA 1R4NB 2EVOA 5B1AH 4IEJA 2NYXA 1MDMB 3S14J 1LKXA 4XRFA 2LBFA 4R1HA 3F22A 2M87A 2V26A 4MHGA 1OYYA 1YQAA 1XN7A 2BE5F 2M0MA 5H20A 3DLLF 2IRFG 4IOAF 2D45A 3F8FA 5IPAA 2P5VA 2VKVA 4XBFA 1FIAA 3GFLA 4BHCA 3PUBA 2EFPA 1FJLA 2JA7J 3OSGA 5CE6A 4IQJA 1OCZH 1MBEA 2Z2SB 3JTGA 5M5YJ 1ZKGA 2EWNA 4KNYA 2NOGA 2QQ8A 4H0EA 2JWTA 3C2BA 1BI2A 4MFDA 2R7VA 5LEKA 1BR1A 3MKLA 2Q95A 1RESA 1LB2A 2B3LA 2GG8A 2XAJA 5DD8A 3W6VA 3IH2A 2AQFA 1WL9A 2B7EA 4I2OA 4BY7J 4XQFA 3LAJA 1MNEA 1S6LA 1T08B 3G1LA 3SXYA 3I5UA 3HGGA 3CQZJ 4LIUA 3WGGA 1K83J 4D7NA 2P7CB 3GBGA 4CCOA 2VI6A 3MATA 4I01A 5ILSA 3BC8A 2GG9A 1OFCX 2EIJH 2F4OB 1XGSA 1Y8QB 1VQPI 3ZR8X 1QNTA 2CQKA 3CCSI 3A02A 4OAYA 5EZHA 3GCMA 1KQ0A 5DDGA 5EGOA 3J7YJ 4Q5SF 2QQAA 3Q3SA 4UUTA 2YUSA 4U87A 2E1NA 3U1DA 1OLTA 3EDPA 2DFEA 1OCTC 2XF6A 2DODA 3K4CA 3ZMTA 3FK7A 2QQBA 1DPRA 1SC7A 2Y2ZA 5J47A 4RBOA 1K79A 1JUMA 1VQOI 2EFQA 4YIRX 1DPUA 3K4BA 3KEOA 1MBGA 5FLVA 2GIVA 4A93J 1HW5A 2FEZA 5DUKA 3N97A 5EEHA 4U6WA 4XN0A 2B63J 3ZMSA 1OR7A 3K4NA 1HKSA 3TMOA 5J4YA 4AIJA 5DV5A 3GFJA 2EIKH 4AC0A 2OTJI 1SD5A 4D5FA 1Y0UA 5CLSA 3D5RC 3LWFA 3WU1B 2WAEA 1IXRC 4CA0A 3ZXSA 4II2A 3ZMVA 2QLZA 1BC8C 3GFMA 3V8LA 4IO9F 2GWRA 4HLYA 4LB5A 1USTA 1U2WA 4PZJA 1X3WB 4IPAA 2O61A 5F0FA 3ECHA 4YFNF 1HDPA 1R5ID 3H9JA 4IHXA 2KJCA 4DYQA 2GG5A 2CYYA 1SD4A 4EJVA 4PSXA 2H1KA 3S17J 4BE1A 4UV9A 1DGRM 2XPVA 2B3KA 4PFOA 2V1NA 3DEUA 3K1NA 1GLNA 1W1WE 3FKJA 2F5EA 4UVAA 4XLCA 1P4XA 4BJ6C 1J2XA 4DOZA 4OMYA 1XSXA 1YVMA 4FO7A 1VI0A 4ZYAA 3WHCA 1WSUA 1IN4A 4C9YA 2NQ6A 4LIVA 2A6EF 3HYIA 2H8WA 3JCUC 2I10A 3IV5A 2L0KA 1XTAA 1K78B 1JKQC 1U8BA 3NARA 3QQAA 5J1RA 5JLWA 1V3FA 1IO2A 4U73A 5CDLA 2GXAA 1ZG3A 4GXOA 2L7ZA 1E17A 1MGTA 1WJDA 4PK4A 5LEJA 4S2TP 1F36A 5LBQA 2VOPA 1JKPC 3F3XA 3WTWC 1R71A 1Q1VA 1FWZA 1LNWA 1VNDA 1ZARA 4HPQA 5HVQC 1UB9A 3OR1C 4A0ZA 2KRCA 4UB8C 3WODF 3ASOH 3A01A 3I4MJ 4EJUA 1FYMA 4MFEA 5TJJA 3QRFF 2HKOA 2LK2A 1F5TA 1YFHA 2F4IA 3FDYA 1IRGA 4OIPF 3K6GA 1PVEA 3OYBA 2BWSA 2MG4A 2YPRA 3COAC 4OIQF 1D0ZA 2CUZA 4EQQA 2O8XA 4IKFA 2DCEA 4NC8A 1CHMA 3M8EA 3MAJA 2XAFA 1ETVA 4LMYA 1QA6A 4WF2A 4A3MJ 1Z77A 2FBIA 3U9GA 2LTPA 4CCMA 1UJ8A 3VOEA 3FMQA 4HSRA 2JUCA 5KCMA 2CQ7A 2M5WA 2LY1A 1W7PD 2QBYB 2VQHA 4Y52J 1WH7A 4ZZDA 1O7LA 3KP2A 1P2FA 3GTMJ 2OC6A 2L4MA 5DCMB 4BXUA 2Y0MA 1RR7A 2K9MA 2GOMA 3K4KA 2R7RA 2IXSA 2BZTA 2JMWA 3H0GJ 2VE8A 4OAZA 3ULQB 2NVUB 5CVUA 5AIPA 5FKOA 3FISA 3F8BA 2XIGA 3IU9A 3F9KA 2Q0OA 3F0CA 4HDVA 1C27A 2CUJA 1VFCA 1X58A 3U1KA 1GXQA 1WVRA 4F55A 1XGNA 3B6AA 5L3DA 3FXUA 2X48A 1WKMA 5J4VA 2DTRA 1XSDA 5FLXZ 3OYLA 1SVLA 3E6MA 5J6XA 2CUEA 2QYOA 2XAQA 3DBLB 5JLXA 1TWGJ 3LOCA 4GO1A 3I55I 1K4SA 3MKZA 4BY1J 1Z1DA 1OYWA 3SJMA 4CGZA 1Z21A 5EYRA 3HSEA 4I99C 4BXFA 4KIFA 1MZBA 4G7OF 4XICA 2OQGA 1O0XA 3K4JA 3DQVC 3FM3A 3WU0A 5CVVA 1XB4A 4RAYA 5ILUA 1SVMA 2CFOA 3F8MA 5D4SA 4LG0B 3NWTA 2KJBA 3B73A 2HVQA 4IHYA 4LB6B 1O7FA 5KHDA 3H5NA 5GPCA 4MQ9F 2VN2A 3HB9A 1YW9A 3OS2A 2WY8Q 1U8RA 2M30A 2Y48A 3TW7A 1FX7A 1BL0A 2JPBA 3BLYA 2CGPA 3OV8A 2ZJ2A 3BPVA 4EGZA 3HKZA 2VJ5A 3E5UA 5HODA 2Q2EA 5LRSA 5DYMA 4M3BA 4RGSA 1I50J 2EV5A 4CCNA 5LLQA 3N4MA 1CQTA 3CJRB 1W5CC 4JP0A 2A61A 4FLIA 5KAIC 1ULYA 2DK5A 2X51A 2BEOA 5GAHJ 3MVPA 1TL8A 1U5TB 5LHGA 4HG2A 1WI9A 2PBIA 4JBAA 2QKMB 3P5JA 5M5XJ 3C3WA 1FOKA 1FIPA 3I0TA 4Z2YA 4NNJA 2VOOA 4C3IJ 2E1MC 1QZZA 1T39A 2D2WA 3OYIA 2IS1A 4LK1F 1T0FC 2V4JC 3KP6A 2IW2A 3HOYJ 2ID3A 5D5XB 2BWXA 3JW4A 3J80K 1I1GA 3LL7A 4E70A 4A2UA 1IV6A 1OCCH 1NHAA 2K9NA 2M9HA 4J01A 2JN6A 4AM3A 4KDPA 2K27A 1BA5A 1FYKA 2HZDA 3UKGA 4N9IA 4OU0A 2Q8KA 1JKRC 2W1OA 3DPUA 2NNNA 3I54A 5HLIA 2LD5A 3NWSA 3CMEI 2CW8A 2ACJA 3PQKA 4U0YA 4ZWUA 3CCMI 1HLVA 3H36A 3TDUC 1W36D 1ZAOA 2WAFA 2Z99A 3G6EI 4RGUA 1ZGWA 2BHZA 1IRFA 1H8AC 1IG7A 1R49A 3L00A 1TP4A 1A6QA 3EETA 1HSTA 2VBYA 1B9NA 1Y0NA 3RIRA 2P5LC 3M9AA 2MATA 4HNTA 1IN5A 1LEAA 3CC2I 3QP5A 5E20A 4BJTA 1T38A 2KIMA 5E1XA 2CSOA 2OBPA 2H94A 3BG7A 1J59A 3BITA 2OPTA 2JPCA 1GVJA 3KIOA 1FYLA 4I02A 2RKHA 2BH3A 1I3AA 3PNYA 2HOSA 3ZN0A 2L7KA 3VDXA 1YJ3A 4BQNA 2DOAA 2Y0SN 4K2EA 3GTPJ 3G1OA 1WJ5A 4XRSA 4NC6A 2X4HA 1LVAA 5JHUA 1AA7A 1MMGA 3A03A 3PNTA 3IWZA 5E3LA 2X1DA 2K7LA 1MBFA 5TRDA 2PJRB 1Z0XA 4BDYA 1SMYF 1S9HA 4MEYF 4ABZA 1YS7A 4LFUA 3E0JB 2IA2A 3VEPA 1JJ6C 2KL4A 1U9OA 4CYCA 2Q96A 3KP5A 2OJED 5FRNA 5M5WJ 1QXYA 3ZMDA 4F93B 4ZC3A 2DA5A 1JT6A 1MD0A 5CJ9A 1R1UA 4DGWB 4S05A 3KP7A 2CQQA 2HWVA 3IP4B 3K70C 5E1WA 3GO5A 3AL0B 2DK8A 2A5YB 3R4KA 4A3BJ 1OJLA 2ZNYA 4E7HA 1BM9A 2PEXA 4DBQA 3BIPA 2K9LA 1JUSA 3K0LA 1Z3YA 3TOAA 4HW0A 2VODA 1FT9A 5GAGJ 1ZLKA 2GG3A 2KZGA 4BH9A 3ABMH 1OISA 2QSFX 3VB2A 2OA4A 3M3YJ 4L9VA 4P55A 2PJPA 4MATA 3ESWB 2Q2EB 3FXKA 1ETKA 1IDYA 1R1VA 4DQ2A 1WJCA 3P7NA 1DU6A 3HOZJ 2WAQA 4CYDA 2D1HA 1ZN2A 5CVIA 2L54A 1F43A 4CXFA 3IAM2 1CF7A 2DJIA 4QLCU 5J1YA 1BW6A 3JAMZ 2XGXA 4XKCA 1TQPA 4B28A 4PNCA 1BJAA 2Y30A 3WG9A 2HNHA 2IGOA 2VASA 1ZTRA 4XSZF 1XG1A 3HGYA 1SFEA 3KX2A 5D6EA 1RC9A 4I09A 2XC7A 2IS2A 2XRNA 3HJEA 3T5XA 3G71I 1WGXA 2ZO4A 3KYLA 1AU7A 1XNZA 3WE3A 4M3GA 2R7SA 4OOKA 2W48A 2P7VB 5E79C 2BXZA 3TOBA 4IKSA 5H6RA 2GAUA 4QTRA 4G6DA 3D5LA 9ANTA 3I58A 4FT8A 2NOJB 1YHQI 2DOEA 4IF7A 2OF7A 1LE8A 3I56I 1ZYRF 1FBSA 5F6FA 4KMUX 2V6CA 1UHWA 2A68F 3BTCA 1YRNA 3IU8A 1BI0A 3L9FA 3AG2H 2Q1ZB 2PMZN 5JFRA 5ICFA 3SZTA 4HV5A 2BWVA 3DV8A 3LSGA 4A6EA 2K9SA 5JI6A 2L5QA 3F8NA 2BOLA 3OL4A 4DZPA 3CF2A 2NVYJ 2QEXI 1UAAA 4LITA 2VKEA 3V8KA 3OL3A 4M6XA 3ROUA 3VSLA 4ZDPA 1ERDA 4MGRA 3I59A 1D3YA 2LRDA 3KZIC 2XKOA 3PIOF 3OS1A 4A0XA 1G2HA 1Y56A 1BR4A 2VUMJ 3ELKA 1V55H 2HDWA 3K2ZA 1FEXA 2QSGX 3JRHA 3CC7I 1X2MA 1VF9A 1H0MA 3TGNA 1IN8A 4IXAA 2ISZA 1ENHA 3WTYC 2V3YA 5IOYA 4IX7A 2LC2A 4PV4A 3TO6A 2KIQA 2KRFA 5J40A 1RNLA 3JSPA 2V9KA 4NQWB 1KP0A 2ZMEB 1K4TA 1Y1WJ 2O5RA 3WGIA 3OYGA 2IT0A 1U5TA 2BY0A 4C3JJ 1AHDP 1WN1A 1S5LC 2OZ6A 2DT5A 4MIMA 3CJTB 1NG6A 3D0SA 2R7FA 1PYVA 1QHHD 3LSRA 3D27A 3H5AA 2PMZA 3SZGA 1IN7A 3C18A 3JAMK 4HNVA 2LH9A 2XSDC 3GVAA 5L3CA 3BCBA 1X3UA 2W85A 3BQZA 3FM5A 3CCUI 3K1PA 4U1BA 3E1SA 3HOSA 1P6RA 2PN6A 4DBRA 1ZRFA 4RGRA 2BW3A 2VB6A 2CWEA 3RQ4A 2KKOA 5FGMA 1D8JA 2EV6A 2F6CA 2QWWA 3CUQB 3S8PA 3ZGKA 5BOXA 4BNCA 1RKTA 2KHMA 4KISA 4BAYA 2JA6J 3FHNA 3KZYA 3DCFA 3OYFA 2LYCA 5HS8A 5GADJ 3VWBA 2KDOA 1BC7C 2JA8J 4IU6A 3C1DA 1NK2P 4XIDA 2V1DA 2E2JJ 3V42A 2ESHA 1V4RA 1E3HA 4M74A 4IZZA 4LK0F 5CDVA 1K61A 2V6EA 4UUVA 1SMTA 2DN0A 3FK6A 4XM3A 4II3A 3ECOA 3CTAA 5F08A 3DXJF 3HOWJ 4O6JA 1LJ9A 1PP7U 3VYRB 3L2QA 1X1CA 3TP0A 5CVRA 2MW8A 4OWRB 3HHHA 3DPTA 1LFBA 4M71A 1EH8A 3HPGA 5ED4A 5DCFA 1UELB 3OYEA 2FBHA 3FBNB 2FF4A 3IKVA 3GTJJ 5EF6A 2ECBA 2K3FA 4NB5A 2VC1A 5HNHA 2FMLA 2HI3A 1A6IA 3JRGA 2ZB9A 4L5EA 2ZC2A 3B6CA 2EILH 3S2HJ 3ZQIA 4CHUA 2IS6A 4IQ4A 2N8GA 4CICA 1I6XA 3GZ5A 4L0YB 1K6OA 5HDKA 1XSVA 2FOWA 3RPUD 2LP0A 3BG3A 1LUJB 2HOEA 2EH3A 2NVQJ 3IUOA 3VSKA 2V9PA 4HA8A 2R7OA 4GRIA 4M6VA 3GLXA 3CMAI 4L9NA 1S7OA 1XCBA 3FXQA 4I98B 1FTTA 1LQ1A 1W0TA 2RNGA 1T56A 1Z91A 5FKKA 2E7WA 4A5MA 3G1MA 3PKDA 3OMYA 2JK3A 2LFBA 2R7QA 4I76A 3GTOJ 4FX4A 1YOVB 3HRUA 4E4HA 3V8JA 3DF8A 1YJ9I 5E17F 2HFHA 4B44A 1C23A 2V3XA 5IYBJ 2J5PA 2WTEA 4U71A 5EGOB 1SFKA 3H9GA 1JKOC 4M3FA 2R0QC 5DEQA 2RQQA 1LFPA 5L3GA 3HSRA 2DDBA 2WY7Q 1X1DA 3GTGJ 4BUPA 4ZYHA 3PKEA 5EDNA 1BI1A 2VL8A 5IP6A 4P5OA 3TP3A 2TRTA 3CCQI 4GCVA 3KPHA 4I6ZA 2BVLA 5K1YA 1UFMA 4LJZF 2V1XA 4MTEA 3PIPF 4IRGA 3ZQGA 2XASA 2ZBKA 2ZCWA 3AG4H 1E3PA 4FKCA 2VJIA 1IUYA 1C21A 5IP7J 4UXNA 1ZGAA 4X6AJ 5J8FA 5F04A 4BYYA 1O57A 3KEQA 2JVHA 2IAIA 5D5WB 1R7JA 2DA6A 4EM2A 4G7ZF 4D9JA 2GU5A 3FMRA 1WY2A 5M3FJ 3RI4A 2GZWA 1I6HJ 1WPKA 3RORA 2JZYA 4XSXF 2NQ7A 1FOWA 2LF8A 4ESBA 3CO7C 3S32A 2KZVA 1JGSA 5D5VB 2M0CA 4I0BA 5DUIA 2A07F 3KZZA 3RKWA 5KK1A 3BPXA 2MSYA 4LD5A 2AS5F 3BR5A 2K3PA 3IU7A 1HKTA 4IDYA 4YELA 1Y6IA 2G7HA 5BNGA 5J8CA 2HPIA 1TWFJ 1RIOH 1AOYA 3KYDB 1TBXA 2XGCA 4O5VA 3SEQA 3WHBA 5KAFC 2BBYA 4OIRF 2L3DA 3RJPA 4ZZLA 4BKXA 4JUQA 1D5VA 1DUXC 3EUAA 2EK5A 2HDCA 3BJAA 4RLFA 2Q94A 2JUGA 2Q92A 2RVCA 1SD7A 1X1AA 1H9GA 3OYDA 1MMAA 2WADA 3CCYA 3DPLC 1L0OC 3L2UA 2OQRA 2XDVA 2CV1A 4EJTA 1OQYA 5BPIA 2X6XA 2L02A 2BHYA 5FFXA 1Z6RA 1YW8A 4WXDA 3ISPA 2EA4A 4BACA 4CH7A 2A6HF 3KCCA 3R0AA 3ZP5A 1P4WA 1KU7A 2K85A 5HS7A 4AVPA 1MIJA 3K9TA 3KEYA 5H2FC 1C0WA 2E5NA 4Y17A 2CV2A 1UHMA 3L2RA 2OUMA 1EKEA 1IN6A 5C44J 3ABKH 4XRSG 4R79A 2MA3A 1JAWA 1UG2A 3HDDA 4IHSA 2HYJA 1TQMA 4V2GA 3BQYA 1K7AA 3S2WA 2VIXA 1ZH5A 1J7KA 1G3SA 3CUOA 1XC5A 2ZXWH 4Y15A 1GDTA 4A6WA 4D1QA 1P7JA 3ZQFA 3RSNA 3S2DJ 4XOPA 1V5FA 5FKMA 4FO8A 1TQIA 4F91B 2OAZA 1VTNC 1QRYA 2DA1A 3QPTA 2R7ZJ 2ETHA 3W6KB 5L3FA 2F5DA 3CF5F 2JQ7A 1POGA 2DFHA 4BEHB 1RR8C 2DFFA 3QPLA 4RB3C 3G4SI 4MTDA 4PJNA 1TZLA 3TO9A 5CKTA 2R92J 2R7XA 4PJMA 4C30A 4XLHA 1J5YA 4GGGA 3FXMA 4A3GJ 2OV7A 1EH7A 2H27A 3TEDA 1FOYA 2E19A 3T0YA 4PJ0C 3MFKA 1HF0A 4M9SA 3M1EA 4IECA 3HXLA 4B47A 1MDMA 1N25A 3SZPA 3FKIJ 1YJWI 4UVCA 4QIWN 1VQ9I 1D1BA 3S3MA 1AKHA 2EZIA 1QVUA 1JXSA 5CQEA 2DFIA 2COMA 3DEEA 3BG9A 3VODA 4U6EA 1MBKA 2DT7B 2JJ7A 4ASNA 4FISA 2NAZA 3OIQA 2I5UA 5FD5A 4A3DJ 2F48A 2FOKA 2ME0A 4JX6A 2IS4A 3TO7A 4L9TA 1WJEA 2Y9YA 2LDUA 2NRAC 4BU2A 2OU2A 4XLEA 3F8CA 4FE4A 1FOXA 5KNLA 3GXOA 3OS0A 4JOMA 5FD6A 5HNFA 4EM0B 3DU6A 4G8XA 1R6RA 4MO7A 4E7IA 1BBYA 2VXDA 3JSOA 4ON0A 1I39A 2HGCA 5BPDA 1S7AA 2QF7A 4BDZA 2FQ3A 1OMIA 3ZQCA 2BY3A 5FO5A 2YSRA 5HDNA 3BCAA 3OR2C 3JRAA 3S3NA 3VFZA 2EFOA 3GUDA 1R00A 2ADUA 3OYAA 2VBWA 1ACIA 4ZNGA 1I3QJ 2Y0SA 2V3ZA 3DP7A 2CQXA 2GG2A 1ITYA 2HS5A 3OYMA 4CDGA 3I59B 3IAS2 5C3EJ 2NNYA 3KFWX 4UUSB 5FLXK 2QM3A 2H8RA 1HA8A 4U7BA 2FMYA 5GAEJ 1MSEC 4JK1X 3ZCOA 4BQOA 1N75A 1U0JA 1QQIA 3GTLJ 5FRMA 3GX4X 4KMFA 3S1NJ 1MJ9A 2IGKA 2KPMA 1I1SA 3B02A 3JRFA 2P6TA 1TWHJ 3P9KA 4XLNF 2JSPA 2EPFA 5ICCA 2Z3YA 1FTZA 3M1CA 3LSPA 5BQTA 4PGGA 2YU3A 5D5UB 3QODA 5FJ8J 4BE2A 5F64A 1G6NA 3WU2C 1ZELA 3BR2A 1Y1VJ 1C24A 2V7FA 5E8IA 1WI3A 2LF7A 3QAHA 2DBBA 5HLTA 5J3LA 4BQAA 2B0LA 3CJNA 3KETA 2VPRA 3AG1H 3H35A 2OCCH 3BZCA 3GW2A 3IC7A 4DZJA 4B43A 3QP6A 2ZSGA 2FE3A 3OWTA 2E35A 2KDZA 2EFNA 1OCPA 1T0FA 2DOFA 1ZRCA 3AFHA 2WAQN 3ABTA 3TW6A 2O6GE 4HX7A 2PG4A 3PO2J 1BJZA 1WLRA 4BL0B 2IGNA 4U6ZA 2ZFWA 2WB1A 3I53A 3I4NJ 1UHSA 1YLFA 5GP9A 3M4OJ 2DA3A 2YS9A 2ZJPF 2F5CA 3QU3A 4QPOA 2XROA 2MC3A 2L4AA 3OY9A 1G3TA 4BJ5C 4C2TA 1IV8A 3J7AO 5IT9Z 3A2KA 3OIOA 2GU6A 4A3CJ 2ZJQF 4G6QA 3PUFA 3V7RA 5LFAA 3CCJI 1B72A 1SD6A 5JHFA 5DM7F 4IRIA 1G8XA 4JX4A 2Z16A 4FASD 2DW4A 1A36A 2VONA 1ETQA 3CP2A 2ECCA 3CD6I 2CUFA 3CDIA 3EQLF 1IXCA 1W7VA 2EFWA 2HR3A 3BZKA 3O8HA 2CV0A 4XONA 4YRVA 3KE2A 2QSHX 5BS6A 3HUGB 2ZXJA 5HDGA 2DMTA 1EV7A 4C2MJ 3HIFA 4Q48A 4XLPF 4GFBA 4YFXF 2MLGA 3OYHA 3FZVA 2IA1A 2E36A 4IHTA 3PSFA 2E60A 2HXOA 1KA8A 5F1RA 3RKXA 4FLJA 2DYSH 3TB5A 2ESNA 2F4MB 5GTIC 3ABUA 2HTJA 3KP3A 1VQ6I 2P8TA 3LSJA 3RKQA 3L7GA 2O9LA 3W3CA 1IC8A 3ZMUA 1WFXA 2ELKA 3EUHC 1MMNA 1E2XA 2DXIA 2DA4A 3HOVJ 2M3AA 1LVKA 2RNJA 1SAXA 1E3OC 1Z7LA 4IKUA 1YJNI 1F4KA 5FLMJ 1BIBA 1JHFA 2NS7A 1TT0A 3SQNA 3WTXC 4KJZA 4LOCA 2ME6A 3G73A 3MCZA 1SEUA 1REPC 2NS0A 3SFIA 3BR1A 3PKCA 2OD5A 4FHTA 1G59A 1DP3A 2O03A 1L3LA 2VKDA 1FPQA 4QPQA 4W1UA 2G9WA 1XD7A 3DU5A 4E7SA 3ZMZA 4Y7NJ 1WRJA 1ODDA 1FMVA 3CCEI 2MH9A 1XPXA 2FX0A 2GTXA 3GF2A 2PI0A 2LY2A 1Z9CA 3BTJA 3SYTA 2Y9ZA 1DGWY 1H9TA 3CMMA 4G7HF 4XKBA 1MH3A 1IXSB 2H6CA 2XAUA 2R7TA 5HS9A 3WE2A 3RCOA 3SHFA 2AXTC 4RB1A 5DM6F 1D0XA 3BG5A 2MLKA 4ZTFA 5FCHA 1ETYA 3UNGC 3E6BA 3GZNB 3CTZA 2YU9J 4ZYEA 4XL9A 3K10A 3CCRI 3WTUC 2XF7A 4E7LA 1M1EB 2O8KA 1P9QC 4V2FA 3PL8A 3F72A 2EINH 4PSWA 3LA7A 3WG7H 2K5CA 3W2VA 5EEGA 3HZJA 4HZFA 1X4PA 3SDBA 2PMUA 1ZRDA 2E1MB 2HQRA 4HSTA 5M3MJ 4P1WA 1U3EM 1E0EA 2HZTA 1Z05A 3S16J 2TCTA 5IY5H 5B66C 3FWEA 2WV0A 3T8RA 5FKNA 2JSCA 4U88A 2WWYA 5B1BH 3EYIA 2ZKZA 3OYNA 2LG4A 3OYJA 4KYWA 4ZYDA 3FIWA 1FNNA 4E7KA 2B3HA 3A0BC 1K6YA 2JVGA 2M1BA 4N0BA 5E18F 1ZHFA 4RGZ1 4U6CA 4RM3A 2M4KA 1T95A 2FQ4A 1NG7A 1LFUP 1UMQA 3P9CA 3WTSC 1YIOA 4LLGF 4BHBA 3GZ6A 3W2AA 2WV1A 2PX9A 5ILVA 1UZCA 3I3LA 5F1JA 2GLOA 3DKXA 2BHDA 5CIKA 3NEUA 2RREA 4PJJA 2BHAA 4S0HB 5CPRB 2CJJA 3PKBA 4CZCA 3NQOA 4ZDLA 1PDNC 1N78A 1SANA 2X6OA 4QR8A 5L3BA 1USSA 4HNUA 3REOA 2LREA 5F0HA 4ENKA 1LEBA 1BIAA 1PJRA 1WWXA 2VJ4A 5E3NA 1WH5A 1HKQA 4XOTA 1SAUA 3P9IA 4A3IJ 1OR7C 2NS8A 4A6VA 2YR2A 4M3EA 2QBYA 3CUQA 1X1BA 1Z6TA 3R60A 4B8XA 1TC3C 1B8IB 2ELJA 3L09A 2BY2A 1ZLJA 2YX7A 5L3EA 1XDSA 1VQKI 3H0DA 2LNBA 4ENJA 2FUG2 5LGNA 4A0YA 2L9VA 4BHPA 2L7MP 3MWMA 3ABLH 3HRSA 1QXWA 3CO6C 4RA2A 5J1UA 2XPWA 3CB5A 2X6WA 4FQGA 4G12A 1O3RA 1P7IA 3CUQC 2R93J 2B9SA 2HPMA 3QYFA 1FSEA 3ZPLA 2K9QA 2EZLA 4HQMA 4L5IA 4A3KJ 1J09A 1W0UA 1WQ2A 2LOOA 2O7OA 3EPZA 4A3JJ 1X2NA 4B3XA 2RC4A 3TDZC 1ORKA 1U5TC 2DYRH 3M7GA 1QO0D 4CCKA 2LR8A 2V9VA 3L2CA 2GG0A 3LFKA 3MN2A 4KM3A 2KQRA 1LDDA 3ZRGA 3GEZA 5JR3A 2RN7A 2E34A 2XGEA 3CESA 3LA3A 4G6TB 3F21A 4ESFA 3FXRA 1MBJA 2MH2A 4RAFA 2VT3A 3FF5A 2IVMA 3BTLA 1YI2I 3BP8A 2BWTA 5B5EC 1MSFC 1ON1A 3TBIA 3BR3A 5CNXA 3I71A 4GDFA 2G7UA 2M4GA 1SFOJ 2K4BA 2GA2A 4L9JA 1Y8RB 5EG0B 1OCOH 3WTZA 4XLFA 5DS9A 4J00A 3U21A 1UG0A 3DLAA 4RMNA 4H4KC 2AO9A 3GMEA 4EGYA 4ZWPA 3JRDA 2GQQA 5LGTA 1O3SA 2DI3A 1MW7A 3A1YA 2HVSA 2GU7A 1R36A 3H3UA 1YX5A 1RUNA 3HEFA 3JTHA 1GVDA 5FB2A 4HXXA 4Q47A 3IKTA 2RV8A 4OOIA 2QZ8A 3EUKL 4BBSJ 4KFCA 1T6SA 5GTHC 3GLLA 1Q1HA 2AQEA 3K70D 4AU7A 1T8IA 3QWLA 2IJLA 1R5HA 3LNQA 2P98A 4WXCA 2G6PA 4JX5A 3M8JA 4RAZA 3HSFA 3Q6DA 3OIPA 4CYCB 4OIOF 4BBRJ 4G94A 4FLKA 5JVTA 2VBZA 1XGOA 2KFDA 2W4SA 1KQ9A 2IW5A 5E3OA 1T2KA 4IL6C 2M34A 4MQVA 2FA5A 4RZYA 2XGDA 4JQFA 2JA2A 3G3ZA 1W36C 3IHUA 3BROA 3RVAA 3I64A 4B4CA 1EH6A 2BWYA 4KN7X 2EVMA 2X9DA 4S01A 2BB7A 3VPRA 3MR1A 4O3MA 2R3SA 4AD9A 3H3VK 4U70A 2BWUA 3BJ6A 3BR0A 2QCOA 1MJAA 1JUPA 4Y3OA 4KN4X 2CMPA 1ZR2A 2CRGA 4U0WA 2ZXIA 4CUGA 1KONA 3R6SA 2KIUA 4IRHA 1TNSA 4WK8F 3HUGA 4XKVA 5C4JJ 3GFIA 4C2UA 1WJAA 3KYCB 4E7JA 1FBQA 2EQRA 2DMNA 2HOWA 4DW6A 4XR6A 4FTHA 4LG3A 1HW2A 2KP6A 2HTSA 1J0RA 2JTVA 1O3TA 3MKYB 1XGMA 3VYUB 1B8IA 2BY1A 1FMWA 2MABA 1YTYA 5LHIA 4A3EJ 2DO7A 2DLLA 2EZHA 4AUXA 2NVTJ 2FXAA 2EB7A 1MNMC 2UV1A 2DQRA 4LGWA 3BZ6A 4FCYA 2W7NA 1MH4A 3N05A 3QOPA 1ON2A 3KLNA 5JVGF 2CQNA 4LG0A
chains in the Genus database with same CATH topology
4RGXA 4DNCA 3LSTA 2ELHA 2GGCA 2XVCA 2VBXA 2UXNA 1R23A 5LGUA 3QPHA 1KYZA 4U0VA 2MD5A 5FFZA 4P9UA 2DQLA 3DKWA 2BV6A 2Y75A 2CFXA 4ZWOA 2M8EA 1AWCA 1C22A 4EJWA 1MJBA 3Q9VA 4HOBA 1S29A 2X0LA 2W57A 2GG7A 2BGCA 1BI3A 2H6BA 1CGPA 3PQJA 3PFIA 2XAHA 2LKPA 4NHJA 5E5BA 2K4JA 4D0PA 4ETSA 1KU9A 4PDKA 2GXBA 3MQ0A 2PLYA 4UV8A 2F2EA 2OKNA 4Q4ZF 1IF1A 1R1TA 5CDLA 1ONVA 1W5SA 4P96A 1U78A 1TLHB 2OZUA 1B1BA 5D6FA 5D4RA 3TAVA 3S6BA 4ZYGA 3IWFA 5ERIA 2E7XA 3H3ZA 2GGBA 4UVBA 2BWWA 3E3VA 2JT1A 1F1ZA 2QENA 3F6OA 4MEXF 1G3YA 1XMKA 4HQEA 3TKYA 4MNUA 3DFGA 2K02A 1B9MA 2HQNA 5KVRA 1ZREA 1IAWA 4HX4A 4IKRA 4S2RP 3E5QA 3RPQA 1GXPA 4IJAA 1G4DA 4HF2A 4EVIA 1FY7A 3R61A 3IG4A 4G9YA 1B6AA 4Y13A 1PUEE 5K5RA 4M6YA 4KICA 4RB0A 2DPUA 3F23A 2EV0A 5DCMA 1ZG5A 3J81K 4OMZA 2WC2A 4R60A 1SFUA 2P6SA 2BYVE 3MZHA 1XMAA 1R58A 4R8HA 2VC0A 1TW2A 3L7WA 1FP2A 2QVOA 3LQRA 1IW7F 3BOQA 3V7CA 3BY6A 2RDPA 3LA2A 1U6GA 4FUKA 2D1VA 4Z7MA 3BDDA 2KIFA 5HOOA 3TQNA 3I4PA 2C6YA 1YYVA 1FC3A 1FBUA 4B09A 3RKYA 2AXLA 1BN5A 1STZA 2GA1A 4OINF 4EMSA 3O2PE 1I27A 3E97A 3MEXA 3E6CC 3RTRA 3GWZA 4S00A 3IRQA 4WX9A 2O0YA 2A69F 2LSOA 3K69A 3IRRA 4HF1A 1N51A 3NRVA 1PV9A 2A3SA 4QWQA 3CLOA 3HTUA 1UCRA 4ENNA 3U2RA 2FBKA 2FNAA 2PQ8A 2XV4S 4UNOA 1M35A 4WXHA 2HKXA 1OYIA 4YFKF 2UZKA 4HLXA 1G3WA 5E8GA 4I7HA 1YW7A 2GXGA 1A04A 1OPCA 3J80Z 1PP8F 2Z9OA 1FSHA 4TV7A 2PFBA 3MX6A 3LQQA 2STTA 3SFZA 1O3QA 4GYGA 3WTTC 2PMHA 1P92A 3FHZA 4IVNA 2W84A 2DPDA 2F5FA 3FX3A 3M8FA 3RYRA 3IL2A 4KA4A 4M73A 1HW1A 4HYEA 5IT3A 2W24A 4M72A 1S3JA 3Q9SA 5CYVA 3FMSA 2GU4A 4HF0A 5LHHA 1ZG1A 2FNPA 1J75A 3BJOA 4NQWA 2MBFA 1YG2A 2QQ9A 1SFXA 2STWA 1GHCA 3MZYA 1YS6A 5HLHA 3K1MA 2XKPA 3QU6A 4M9XA 4I0AA 3HHGA 5K5OA 3OOPA 3CDHA 4U76A 5A2QK 1FP1D 2DAOA 4HX8A 2J5OA 2IP2A 2Z5UA 1XCVA 5AONA 4U75A 3T1BA 2DU9A 1J9IA 1QXZA 2M45A 3ML6A 4KIGA 2E1CA 3F6VA 5E1ZB 2TDXA 3ZN1A 5FCFA 3C7JA 4AIHA 2Q93A 5D8LB 1YO5C 4L0ZB 3WTVC 1MKMA 4WCGA 2FSWA 3Q5FA 3PKAA 1I5ZA 1DDNA 2UXXA 2RQPA 1OKRA 3ZQ7A 2CO5A 3RDIA 2CG4A 2P4WA 1K78A 2Z33A 4A5NA 2QUFA 2HEOA 4YIFA 2GZ5A 4LLNA 4ESJA 2HYFA 1TTYA 2ZMEA 4U7DA 1R22A 1KU2A 1TW3A 1W4MA 1W5TA 1JE8A 2V1UA 4P9FA 3T8TA 4FX0A 1MATA 2XAGA 3E5XA 2YX4A 4RS8A 4GYIA 5DD4A 5H6QA 5LRRA 4WWCA 5CVJA 1Y1NA 3KLOA 4FLLA 1WBQA 4M9ZA 2EVCA 2XUBA 5ICEA 1HXDA 1QZYA 2FRHA 1Z7UA 1CF7B 4PCQA 3O6BB 3RYPA 4LLLA 3ERED 4EV0A 2R7DA 4F7ZA 1B4AA 2P99A 2EA2A 1S8NA 4EJOA 1BOAA 1RZ4A 2IPQX 3WGHA 1KQ8A 4UHTA 1F9NA 4A6DA 4AIKA 4L18B 1R5GA 1B59A 3BIQA 3AAFA 3EUHA 3O3KA 4HDUA 1HBXG 1W7PA 4HAMA 1DP7P 3HRMA 2O3FA 3R0JA 2IA0A 1W7PB 4KUMA 4U69A 5ICGA 3GYHX 1HSJA 1JHHA 3J81Z 4CO8A 2VT2A 4KIBA 2HYGD 5IT9K 4HBLA 2V79A 2K86A 3RPUA 3LAPA 1LDJA 1A16A 4EM1A 3CB6A 2UWMA 1LDKB 2EJRA 5HLGA 4A12A 2BHBA 1QGPA 2FU4A 3W6JB 4YG2F 3E6DA 3V4GA 4CZZA 4PGHA 2VXZA 3HTSB 2JRTA 4RZZA 2CW0F 1KYWA 4ZH4F 3V7SA 2XHKA 2VE9A 1TNTA 4IKTA 3EYYA 1KGSA 2ISYA 1FLIA 4YIIA 1QBJA 1T98A 1D8KA 1KU3A 4IF4A 3HRTA 1ZGJA 4L5JA 4S04A 2H09A 1RI7A 1RUOA 4N9HA 1W2MA 2BHCA 1HQCA 1FZPB 1IZ1A 2P5KA 5K5QA 2RGVA 5AIQA 2W25A 5D8KB 3KP4A 1P4AA 1WL6A 4RB2C 3L24A 1XDUA 5CDEA 5BMZA 2P9AA 3BWGA 6PAXA 1QPMA 3HOTA 2L01A 2ZNZA 4HV6A 4ENMA 4U6JA 5A2QZ 4AWXB 3H92A 2BN7A 4KT5C 2EVOA 2NYXA 1MDMB 4XRFA 4R1HA 3F22A 2M87A 4MHGA 1OYYA 1YQAA 1XN7A 2BE5F 5H20A 2IRFG 2D45A 3F8FA 2P5VA 4XBFA 3GFLA 4BHCA 5CE6A 2EFPA 3JTGA 2EWNA 4KNYA 4H0EA 1BI2A 5LEKA 2Q95A 1LB2A 2B3LA 2GG8A 2XAJA 5DD8A 1WL9A 4I2OA 3LAJA 1S6LA 3SXYA 3I5UA 3WGGA 2P7CB 3MATA 4I01A 5ILSA 2GG9A 1XGSA 1QNTA 2CQKA 1KQ0A 5DDGA 4Q5SF 2QQAA 2E1NA 3U1DA 3EDPA 3ZMTA 2QQBA 1DPRA 1K79A 2EFQA 1DPUA 3KEOA 2GIVA 1HW5A 2FEZA 5DUKA 3N97A 5EEHA 4U6WA 3ZMSA 1OR7A 1HKSA 4AIJA 5DV5A 3GFJA 1SD5A 1Y0UA 5CLSA 3LWFA 3WU1B 1IXRC 3ZMVA 2QLZA 1BC8C 3GFMA 3V8LA 2GWRA 4HLYA 4LB5A 1USTA 1U2WA 4PZJA 2O61A 4IPAA 3ECHA 4YFNF 2KJCA 2GG5A 2CYYA 1SD4A 4EJVA 4UV9A 2B3KA 3DEUA 3K1NA 4UVAA 2F5EA 1P4XA 1J2XA 4OMYA 1XSXA 1YVMA 4FO7A 1WSUA 1IN4A 2NQ6A 2A6EF 3HYIA 1K78B 1V3FA 4U73A 1ZG3A 4GXOA 1E17A 1MGTA 5LEJA 4S2TP 5LBQA 2VOPA 3F3XA 3WTWC 1FWZA 1LNWA 1ZARA 5HVQC 1UB9A 4A0ZA 3WODF 4EJUA 1FYMA 5TJJA 3QRFF 2HKOA 1F5TA 1YFHA 1IRGA 4OIPF 2BWSA 2YPRA 3COAC 4OIQF 4EQQA 2O8XA 1CHMA 3M8EA 3MAJA 2XAFA 4LMYA 4WF2A 2FBIA 3U9GA 3VOEA 3FMQA 2M5WA 1W7PD 2QBYB 4ZZDA 1O7LA 3KP2A 1P2FA 5DCMB 2L4MA 4BXUA 2Y0MA 2VE8A 3ULQB 5CVUA 5AIPA 3F8BA 2XIGA 3IU9A 2Q0OA 4HDVA 1C27A 1GXQA 1XGNA 5L3DA 3FXUA 1WKMA 2DTRA 1XSDA 5FLXZ 3E6MA 5J6XA 2QYOA 2XAQA 4GO1A 1Z1DA 1OYWA 4CGZA 3HSEA 4KIFA 1MZBA 4G7OF 2OQGA 1O0XA 3DQVC 3FM3A 3WU0A 5CVVA 1XB4A 4RAYA 5ILUA 3F8MA 5D4SA 4LG0B 2KJBA 3B73A 4LB6B 1O7FA 4MQ9F 2VN2A 1YW9A 1U8RA 2M30A 2Y48A 1FX7A 2JPBA 2CGPA 3OV8A 2ZJ2A 3BPVA 4EGZA 3E5UA 2Q2EA 5LRSA 5DYMA 4RGSA 2EV5A 5LLQA 3N4MA 2A61A 4FLIA 1ULYA 2DK5A 2BEOA 1U5TB 5LHGA 1WI9A 2PBIA 4JBAA 3C3WA 1FOKA 3I0TA 4Z2YA 2VOOA 1T39A 1QZZA 2D2WA 4LK1F 3KP6A 2IW2A 5D5XB 2BWXA 3JW4A 3J80K 1I1GA 4E70A 4A2UA 1NHAA 4KDPA 2K27A 1FYKA 4N9IA 4OU0A 2Q8KA 2NNNA 3I54A 5HLIA 2ACJA 3PQKA 4U0YA 4ZWUA 3TDUC 1ZAOA 2Z99A 4RGUA 1IRFA 3L00A 3EETA 1HSTA 2VBYA 1B9NA 3RIRA 2P5LC 3M9AA 2MATA 1IN5A 1LEAA 3QP5A 5E20A 1T38A 2KIMA 5E1XA 2CSOA 2OBPA 2H94A 1J59A 3BITA 2JPCA 1GVJA 1FYLA 4I02A 2RKHA 2BH3A 3ZN0A 1YJ3A 4K2EA 2X4HA 1LVAA 5JHUA 3IWZA 2K7LA 5TRDA 1SMYF 4MEYF 1YS7A 4LFUA 2IA2A 3VEPA 2Q96A 3KP5A 1QXYA 3ZMDA 1MD0A 5CJ9A 1R1UA 4S05A 3KP7A 2HWVA 5E1WA 3GO5A 2DK8A 2A5YB 3R4KA 2ZNYA 1BM9A 2PEXA 3BIPA 3K0LA 3TOAA 4HW0A 2VODA 1FT9A 1ZLKA 2GG3A 4BH9A 3VB2A 2OA4A 4L9VA 4P55A 2PJPA 4MATA 1R1VA 4DQ2A 3P7NA 4CYDA 2D1HA 1ZN2A 5CVIA 2L54A 4CXFA 1CF7A 4QLCU 3JAMZ 2XGXA 1TQPA 4B28A 4PNCA 1BJAA 3WG9A 4XSZF 1SFEA 5D6EA 4I09A 2XRNA 3T5XA 2ZO4A 1XNZA 3WE3A 4OOKA 2P7VB 3TOBA 4IKSA 5H6RA 2GAUA 4G6DA 3D5LA 3I58A 4FT8A 4IF7A 1ZYRF 1FBSA 5F6FA 4KMUX 2V6CA 1UHWA 2A68F 3IU8A 1BI0A 3L9FA 5JFRA 5ICFA 3SZTA 4HV5A 2BWVA 3DV8A 4A6EA 5JI6A 3F8NA 3V8KA 3ROUA 4M6XA 4MGRA 3I59A 1D3YA 2XKOA 4A0XA 3ELKA 3K2ZA 1H0MA 2ISZA 3TGNA 1IN8A 4IXAA 3WTYC 2V3YA 4PV4A 3TO6A 2KRFA 1RNLA 3JSPA 1KP0A 2ZMEB 3WGIA 2IT0A 1U5TA 1WN1A 2OZ6A 2DT5A 3D0SA 2R7FA 3D27A 1IN7A 3C18A 3JAMK 3GVAA 5L3CA 1X3UA 2W85A 3FM5A 3K1PA 4U1BA 3HOSA 1P6RA 2PN6A 1ZRFA 4RGRA 2CWEA 2KKOA 5FGMA 1D8JA 2EV6A 2QWWA 3CUQB 5BOXA 4BNCA 4BAYA 3KZYA 5HS8A 1BC7C 4IU6A 3C1DA 2V1DA 2ESHA 1V4RA 4M74A 4LK0F 5CDVA 4UUVA 1SMTA 3ECOA 3CTAA 3DXJF 4O6JA 1LJ9A 1PP7U 5CVRA 3HHHA 3DPTA 4M71A 1EH8A 5ED4A 5DCFA 4EGEA 2FBHA 2FF4A 3IKVA 4NB5A 2VC1A 2FMLA 4CHUA 4CICA 1I6XA 3GZ5A 4L0YB 1K6OA 5HDKA 1XSVA 2HOEA 4HA8A 3GLXA 4L9NA 1S7OA 1XCBA 3FXQA 4I98B 1LQ1A 1Z91A 2E7WA 4A5MA 3PKDA 4FX4A 3HRUA 3V8JA 3DF8A 5E17F 2HFHA 1C23A 2V3XA 2J5PA 2WTEA 4U71A 5DEQA 5L3GA 3HSRA 4ZYHA 3PKEA 1BI1A 4P5OA 4GCVA 5K1YA 1UFMA 4LJZF 2V1XA 4MTEA 4IRGA 2XASA 2ZBKA 2ZCWA 4FKCA 1IUYA 1C21A 4UXNA 1ZGAA 5J8FA 4BYYA 1O57A 3KEQA 5D5WB 1R7JA 4EM2A 2GU5A 4G7ZF 3FMRA 1WY2A 3RI4A 2GZWA 3RORA 2JZYA 4XSXF 2NQ7A 2LF8A 4ESBA 3CO7C 1JGSA 5D5VB 4I0BA 5DUIA 2A07F 3KZZA 3RKWA 5KK1A 3BPXA 4LD5A 2AS5F 3IU7A 1HKTA 4IDYA 2G7HA 5J8CA 1RIOH 1AOYA 1TBXA 4O5VA 2BBYA 4OIRF 2L3DA 3RJPA 4ZZLA 4JUQA 1D5VA 1DUXC 2EK5A 2HDCA 3BJAA 2Q94A 2Q92A 2RVCA 1SD7A 1H9GA 3DPLC 1L0OC 2OQRA 4EJTA 5BPIA 2L02A 5FFXA 1Z6RA 1YW8A 4WXDA 3ISPA 2EA4A 2A6HF 3KCCA 3R0AA 3ZP5A 1P4WA 1KU7A 5HS7A 4AVPA 3K9TA 1C0WA 4Y17A 1UHMA 1IN6A 4R79A 2MA3A 1JAWA 4IHSA 1TQMA 1K7AA 3S2WA 1ZH5A 1J7KA 1G3SA 3CUOA 4Y15A 4A6WA 4FO8A 1TQIA 2OAZA 1VTNC 3QPTA 2ETHA 3W6KB 5L3FA 2F5DA 4RB3C 4MTDA 3TO9A 1J5YA 4GGGA 1EH7A 2H27A 3T0YA 3MFKA 4M9SA 3M1EA 4IECA 1MDMA 3SZPA 4UVCA 1JXSA 2DFIA 2COMA 3VODA 4U6EA 4ASNA 2NAZA 5FD5A 2FOKA 3TO7A 4L9TA 2LDUA 2NRAC 2OU2A 3F8CA 3GXOA 5FD6A 4EM0B 4G8XA 1BBYA 3JSOA 4ON0A 2HGCA 5BPDA 1S7AA 2FQ3A 1OMIA 5FO5A 2YSRA 5HDNA 3VFZA 2EFOA 3GUDA 1R00A 2ADUA 2VBWA 4ZNGA 2V3ZA 3DP7A 2GG2A 2HS5A 4CDGA 3I59B 2NNYA 3KFWX 5FLXK 2QM3A 4U7BA 2FMYA 4JK1X 1QQIA 3GX4X 4KMFA 1MJ9A 1I1SA 3B02A 2P6TA 3P9KA 4XLNF 5ICCA 2Z3YA 5BQTA 4PGGA 2YU3A 5D5UB 5F64A 1G6NA 1C24A 5E8IA 2LF7A 3QAHA 2DBBA 4BQAA 2B0LA 3CJNA 3KETA 3GW2A 3IC7A 3QP6A 2ZSGA 2FE3A 2EFNA 1T0FA 1ZRCA 3ABTA 2O6GE 4HX7A 2PG4A 1WLRA 4U6ZA 2ZFWA 3I53A 1YLFA 2F5CA 3QU3A 2XROA 2MC3A 2L4AA 1G3TA 5IT9Z 3J7AO 2GU6A 4G6QA 3V7RA 1SD6A 4IRIA 2DW4A 2VONA 3EQLF 1IXCA 1W7VA 2EFWA 2HR3A 3KE2A 5BS6A 2ZXJA 5HDGA 1EV7A 3HIFA 4Q48A 4XLPF 4YFXF 2MLGA 3FZVA 2IA1A 4IHTA 1KA8A 5F1RA 3RKXA 4FLJA 3TB5A 2ESNA 3ABUA 2HTJA 3KP3A 2P8TA 3L7GA 3ZMUA 1E2XA 2RNJA 4IKUA 1F4KA 1BIBA 1JHFA 3SQNA 3WTXC 3G73A 1REPC 3MCZA 2NS0A 3PKCA 2OD5A 4FHTA 2O03A 1L3LA 1FPQA 2G9WA 1XD7A 3ZMZA 1WRJA 1ODDA 2MH9A 2GTXA 3GF2A 2PI0A 1Z9CA 1H9TA 4G7HF 2H6CA 1IXSB 5HS9A 3WE2A 3SHFA 4RB1A 2MLKA 5FCHA 3E6BA 3CTZA 4ZYEA 3WTUC 3F72A 3LA7A 5EEGA 4HZFA 2PMUA 1ZRDA 2HQRA 1U3EM 2HZTA 1Z05A 3FWEA 2WV0A 3T8RA 2JSCA 4U88A 2WWYA 3EYIA 2ZKZA 4KYWA 4ZYDA 1FNNA 2B3HA 2M1BA 4N0BA 5E18F 1ZHFA 4RGZ1 4U6CA 3P9CA 3WTSC 1YIOA 4LLGF 4BHBA 3GZ6A 5ILVA 2BHDA 5CIKA 3NEUA 2BHAA 3PKBA 3NQOA 1PDNC 4QR8A 5L3BA 1USSA 3REOA 4ENKA 1LEBA 1BIAA 1WWXA 1HKQA 3P9IA 4A6VA 2YR2A 2QBYA 3CUQA 1Z6TA 3R60A 4B8XA 3L09A 1ZLJA 2YX7A 5L3EA 1XDSA 2LNBA 4ENJA 5LGNA 4A0YA 4BHPA 3MWMA 3HRSA 1QXWA 3CO6C 3CB5A 1O3RA 3CUQC 1FSEA 3ZPLA 4HQMA 4L5IA 1WQ2A 2RC4A 3TDZC 1U5TC 3M7GA 1QO0D 2V9VA 3L2CA 2GG0A 3LFKA 4KM3A 1LDDA 3GEZA 5JR3A 2RN7A 3LA3A 3F21A 4ESFA 2MH2A 3FXRA 2VT3A 3FF5A 2IVMA 2BWTA 3BP8A 1ON1A 5CNXA 3I71A 2G7UA 2K4BA 2GA2A 4L9JA 3WTZA 4ZWPA 4EGYA 2GQQA 5LGTA 1O3SA 2DI3A 2GU7A 1R36A 3H3UA 1RUNA 3JTHA 5FB2A 4HXXA 4Q47A 3IKTA 2RV8A 4OOIA 2QZ8A 4KFCA 1T6SA 1Q1HA 2IJLA 1R5HA 2P98A 4WXCA 2G6PA 4RAZA 3HSFA 3Q6DA 4OIOF 4G94A 4FLKA 5JVTA 2VBZA 1XGOA 1KQ9A 2IW5A 1T2KA 4MQVA 2FA5A 4RZYA 4JQFA 3G3ZA 3IHUA 3BROA 3RVAA 3I64A 1EH6A 2BWYA 4KN7X 2EVMA 4S01A 2BB7A 3MR1A 4O3MA 2R3SA 4AD9A 4U70A 2BWUA 3BJ6A 1MJAA 4KN4X 4U0WA 3R6SA 2KIUA 4IRHA 1TNSA 4WK8F 3HUGA 3GFIA 1FBQA 2HOWA 1HW2A 2HTSA 1J0RA 2JTVA 1O3TA 1XGMA 1YTYA 5LHIA 2DO7A 2DLLA 2FXAA 2EB7A 2DQRA 4LGWA 3BZ6A 3QOPA