1XGSA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 97
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgsA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgsA01
1JXSA 5CDLA 2FA5A 4BYYA 2RN7A 2D45A 1XNZA 1XGOA 1WL9A 1XCBA 1S29A 3F8FA 3COAC 2ZJ2A 1T39A 3GO5A 5DUKA 1KU7A 4U71A 1WLRA 1N51A 1SMYF 4YIIA 3S2WA 2VBXA 1ZARA 2LF7A 2MLKA 4FT8A 4O3MA 2A3SA 4KT5C 1G3TA 3TO6A 1F1ZA 4FLJA 3M1EA 1RNLA 1JGSA 2V9VA 1O3SA 3BIQA 4OINF 3IRRA 4EM2A 3WE3A 1FX7A 4HF2A 4KMFA 2JPBA 2DU9A 5FCFA 2YU3A 3E3VA 3WTZA 3EYIA 2XAQA 5E1WA 3KETA 4IHTA 4LFUA 4UV8A 2P98A 5LEKA 3DPLC 4IKUA 1DP7P 3WTYC 3T8TA 4IRIA 1WWXA 4P5OA 4OU0A 1FLIA 4G7ZF 2ETHA 4U6WA 1P4AA 3FXRA 2NQ7A 1H9GA 3F72A 5HS8A 2R7FA 2F5DA 2FSWA 2V3YA 1ZN2A 4AWXB 4RGZ1 1G3WA 1HXDA 1Z91A 1C21A 5ICFA 2CWEA 2XASA 2M1BA 4RGRA 1WBQA 4GYIA 2P7CB 2E1NA 3KEOA 1IN5A 1Q1HA 2NAZA 2BBYA 2FE3A 5HDKA 1KU2A 3F6VA 3T5XA 4I98B 4PGGA 4KMUX 3MWMA 1OYWA 1YQAA 3MX6A 2GU6A 4Z2YA 2HGCA 4G94A 4HW0A 2P99A 5BS6A 5IT9Z 1FBSA 3LWFA 1PUEE 2Q92A 1O3QA 1C24A 2PG4A 5DYMA 4NHJA 1SFXA 2P6TA 4IKSA 2Z33A 3FMRA 2GTXA 3CUQB 2JT1A 3KP5A 1XDSA 1P4XA 1IN8A 3TKYA 3R6SA 1LJ9A 3AAFA 4U0VA 3I4PA 4R1HA 4LLNA 1KP0A 4IVNA 5FD6A 2VBYA 4RB3C 4IKTA 1MJAA 3QU3A 4RAZA 3WG9A 4U75A 2CFXA 4ENNA 4CYDA 1F5TA 2ZO4A 5E18F 2P7VB 1BI2A 3LA3A 3MAJA 2BWXA 4WK8F 2V1DA 1LB2A 1GVJA 2IW2A 1ONVA 3HRTA 4M6XA 4QWQA 5D8LB 3LQRA 5L3BA 1J2XA 3V7RA 2QLZA 3F21A 2Y48A 1REPC 1SD5A 4RGUA 4BHPA 1K78B 4EJVA 2DT5A 2UZKA 4M73A 4HAMA 4ZZDA 3GFIA 2L3DA 4FKCA 2HYGD 4UV9A 2QBYA 2BHCA 1W7PD 4RZYA 1XMAA 5ICCA 3ZQ7A 2Y75A 1RUOA 4HLYA 3DV8A 2Q95A 3QPTA 2XKPA 2GG0A 5H20A 5A2QK 1HKTA 2QYOA 2DW4A 2LKPA 1W5SA 2X0LA 1LVAA 4QLCU 3RVAA 1FP1D 5IT3A 4HV5A 2DBBA 1MKMA 2EV5A 4Y17A 2GG3A 1YS6A 2AXLA 3EETA 1OKRA 2HDCA 3RKWA 1A04A 2RV8A 4R60A 4A0XA 1W7PB 2O8XA 3N4MA 4U70A 1FSHA 2L4AA 4OOIA 5CNXA 3V7SA 3HTSB 2RKHA 4I7HA 4NB5A 3WU0A 2ZNZA 4RAYA 1I27A 2E7XA 1ZAOA 2DPDA 4U0WA 5JR3A 4I09A 4YFNF 3KLOA 2KIUA 3ELKA 4JK1X 2B0LA 2FMYA 4MEXF 2DK8A 2YR2A 2FBKA 1ZRFA 1OYYA 1QXYA 1XGNA 4MQ9F 2OQGA 3WTVC 4L9TA 2IVMA 3PKCA 2Q2EA 3J81Z 2WWYA 4HDVA 1W2MA 4A6WA 2VE8A 1T38A 2XVCA 3R4KA 4ESBA 3FMSA 2CSOA 2F5EA 1IN4A 1G3YA 2HEOA 4AD9A 3TQNA 3CB5A 2V79A 2E7WA 2BEOA 2HQNA 2JZYA 1TQMA 1T98A 2HKOA 3HHGA 3KLNA 1C22A 2H09A 1OYIA 1SD4A 2O61A 5E8GA 1R1VA 2NQ6A 2EK5A 1ZRDA 3C7JA 4ENKA 1J7KA 4JBAA 3VODA 2NNYA 4KIGA 2K27A 4PDKA 1G3SA 3KEQA 2P5KA 4F7ZA 1MATA 4YIFA 2EV6A 4IU6A 4JQFA 3RJPA 1WSUA 4BNCA 4HLXA 3ECHA 2W84A 3B02A 3N97A 1DDNA 2FBHA 1R5GA 2DTRA 1IXCA 2L01A 3IU9A 4U69A 2V3ZA 3F8CA 1WL6A 2A61A 3CB6A 5H6QA 2O03A 3CO7C 4LG0B 1CF7A 2GZWA 4ZH4F 2DK5A 4S2RP 2R7DA 1YG2A 3BDDA 2PI0A 3KP6A 3R0AA 5DCMA 2DQRA 1HSTA 4LB5A 1FNNA 2E1CA 1V4RA 2GZ5A 1JHFA 5CVRA 3J80K 3RORA 2K86A 1FYMA 3WTTC 1A16A 4BAYA 5CVJA 3I59B 2PMUA 3EDPA 1S8NA 2A69F 4KNYA 2ISZA 5DD4A 4XLPF 1QNTA 3WU1B 3H3UA 2W24A 2IP2A 4OMZA 1GHCA 2RVCA 1UCRA 1R36A 1S7AA 3ZMDA 2B3KA 2H6BA 4B8XA 5D8KB 2R3SA 5JHUA 3MR1A 3PFIA 2M30A 5HLHA 3I71A 2VT3A 4XSXF 1LEBA 1U78A 3RYPA 2IA2A 1TBXA 1SFEA 2MH9A 4PV4A 5E20A 2G7HA 4U6EA 1YW7A 3O2PE 5EEHA 2IRFG 1MDMB 4PZJA 1USTA 4KIBA 4B28A 5CYVA 4ZWUA 4P96A 4Q4ZF 4HOBA 4G6DA 2EV0A 2P4WA 3IWFA 3JTHA 1BOAA 2Z5UA 5ICEA 2FNPA 5E17F 1HKSA 4FX0A 4RGSA 1T2KA 1MJ9A 2B3HA 3CUOA 2P8TA 3KP4A 3E5XA 2XROA 3Q9VA 3P9IA 4XLNF 1QZYA 3QRFF 2FRHA 2PBIA 4UXNA 2CG4A 3DPTA 4U1BA 2STWA 4ZZLA 3S6BA 2ISYA 5KK1A 3IU8A 1J0RA 4A6VA 2ADUA 3HSEA 5LGUA 3ABUA 5K5OA 2ACJA 2MD5A 2HOWA 5AONA 4LMYA 3RPQA 1XGSA 2EB7A 1FBQA 1U5TA 1HW1A 1LDJA 2VBWA 1XDUA 1RI7A 1FP2A 5LRSA 5LGTA 3P7NA 2F2EA 1Y0UA 1C0WA 2VC1A 3ROUA 3QOPA 1YLFA 5LHGA 3IC7A 3IRQA 2EFPA 1UB9A 2AS5F 3K1PA 4ASNA 1I1SA 1DPRA 1Z05A 3QAHA 4YFKF 2KRFA 3DXJF 1P4WA 3LA2A 2VXZA 3ZPLA 2D1HA 3QPHA 2Q96A 1HQCA 1R22A 4BH9A 1KQ8A 4MGRA 5ILSA 4P55A 4S00A 3PKAA 4EV0A 3H3ZA 3FMQA 4OIPF 4UVAA 2WC2A 3GFJA 4EQQA 1IRFA 5BPIA 4IRGA 1U3EM 4WF2A 2XKOA 2YPRA 2DAOA 2BV6A 4ETSA 2BWSA 3SZPA 2CW0F 4ZWOA 3ABTA 4U73A 3TOBA 3LFKA 1H0MA 4EM0B 1B9NA 2JPCA 2HTJA 5LRRA 4EJWA 4IF7A 1XSVA 3JAMK 3P9KA 5D6EA 3D27A 2BHBA 3BIPA 4CXFA 1LDDA 1IN7A 4HQEA 3DFGA 3PKEA 3V8LA 3BROA 2GG2A 3E6BA 2PMHA 1MJBA 3F3XA 3NQOA 1LQ1A 2FU4A 2IT0A 2MC3A 5ICGA 2BWWA 3LAPA 1YFHA 2RDPA 4BHBA 1L0OC 1WI9A 3Q5FA 4IKRA 1R58A 4UUVA 1BC8C 1F4KA 1QBJA 3U1DA 4HA8A 2FNAA 4KYWA 2KIMA 3CUQC 3R0JA 3QP5A 5KVRA 1PDNC 2BH3A 4FLKA 2RGVA 2BN7A 2OU2A 3W6JB 2BE5F 5HOOA 2OZUA 1M35A 1BC7C 1F9NA 2ZBKA 2VE9A 2GQQA 5DCMB 1HKQA 4RB0A 3CJNA 1KYZA 5E1XA 1QPMA 4XBFA 5AIQA 3WTSC 2PQ8A 1ZHFA 2ZCWA 4HZFA 2OZ6A 3RKXA 3WE2A 1S7OA 1SMTA 4M74A 5E1ZB 2KKOA 1Z1DA 3BPXA 2Q0OA 4CGZA 4IECA 1GXPA 5D5VB 1D8KA 2D1VA 4DNCA 3MATA 3I53A 4KA4A 2ZMEB 4JUQA 2KJBA 3WGHA 5K1YA 1YS7A 2Z3YA 4CO8A 3GFLA 5L3CA 2XAGA 1ZYRF 2LF8A 2MBFA 5LHHA 4FLLA 3ZN0A 3BY6A 2O6GE 3RYRA 1OMIA 1IRGA 2XIGA 4GYGA 4AVPA 1ZREA 2Y0MA 1I5ZA 3PQJA 3NEUA 1XGMA 2FBIA 4OMYA 3HRMA 2PLYA 4EMSA 3FX3A 2FF4A 3ZMUA 1U8RA 2GAUA 3PQKA 1FYKA 3ECOA 2A6EF 5A2QZ 1S3JA 1FYLA 4TV7A 1HW2A 3ERED 4UHTA 2MLGA 4RB2C 4G7HF 1QXZA 2GG7A 1STZA 4L0YB 3HSRA 2PFBA 5ERIA 1G6NA 2NNNA 5L3GA 2UXNA 3MCZA 1IF1A 3R61A 5BQTA 2EFOA 3T0YA 4ZYDA 3KFWX 3KZYA 2K7LA 1MD0A 5L3EA 4M9ZA 3Q9SA 3VOEA 2H94A 1O7LA 4WXDA 2DPUA 2XV4S 2CQKA 1P2FA 1TLHB 4NQWA 2HWVA 3V7CA 1B9MA 2YSRA 3JSPA 2IJLA 1EH6A 1P6RA 2HKXA 4ZWPA 4HF1A 1FZPB 1D5VA 2VBZA 1TNTA 1FBUA 2H6CA 1YO5C 2HFHA 1BI1A 1ON1A 3SXYA 5CLSA 4MHGA 2OBPA 4A5MA 2DFIA 1IAWA 2JSCA 4LD5A 1XSXA 3TAVA 3QU6A 1QGPA 5LBQA 2STTA 1MZBA 4LK1F 3J7AO 2Z9OA 1ZRCA 5CVIA 5DEQA 1IZ1A 3R60A 1CHMA 4QR8A 2L54A 3IKTA 2A68F 2HOEA 1TNSA 1C23A 4KDPA 1XB4A 2P9AA 1O0XA 4HF0A 3O6BB 3I58A 1UFMA 1XN7A 2BWUA 2JTVA 5BOXA 4G7OF 2MATA 1YYVA 4UVBA 4ESFA 2VOOA 2BWVA 3M8EA 3V4GA 3I5UA 3L09A 2K4BA 4MEYF 5FLXK 3LA7A 4FHTA 4RB1A 5AIPA 2LDUA 4EGYA 3VEPA 4HQMA 1K7AA 5D6FA 1Z7UA 5CJ9A 5K5QA 3EYYA 5ILVA 3WTWC 1BBYA 2MH2A 1JE8A 3I0TA 1LEAA 3ML6A 1NHAA 3G3ZA 3IWZA 2ZKZA 2OA4A 2QQ9A 1EV7A 4EJOA 5L3DA 4MTEA 1DPUA 3I54A 1IXRC 2B3LA 1S6LA 4BXUA 3GEZA 3HTUA 4XSZF 1X3UA 2UWMA 4R79A 2O0YA 3FF5A 4PGHA 1I6XA 3TDUC 1Z6TA 3HYIA 4Q5SF 5E8IA 2VODA 2VONA 1XD7A 2X4HA 2RC4A 3M9AA 4I0AA 1KGSA 5CE6A 5D5WB 1R00A 1G4DA 4D0PA 4L9VA 3WTXC 1SFUA 2GWRA 2M8EA 2C6YA 5LHIA 2CO5A 3GFMA 3BOQA 3E5QA 5L3FA 1EH8A 5F1RA 5CIKA 2GA2A 4XRFA 2VN2A 1SD7A 1KQ9A 4WWCA 3LSTA 3ZMZA 2NYXA 5D4SA 5HS7A 4U6ZA 4P9UA 4O5VA 4U6CA 3SFZA 3MZHA 2IPQX 3REOA 2OQRA 5F64A 1ZG5A 4DQ2A 3SZTA 2FQ3A 3CO6C 4N9HA 4R8HA 3GXOA 1JAWA 5H6RA 2FOKA 4A5NA 4RS8A 1K6OA 3RTRA 1K78A 1H9TA 4IDYA 2NS0A 4ZYHA 4AIHA 5DDGA 3BITA 4GCVA 4HDUA 3F6OA 2GU4A 3ZN1A 3F8NA 1ZLKA 3U9GA 2GIVA 3HUGA 4G6QA 1LNWA 1ULYA 3KP7A 5JI6A 4KM3A 3W6KB 1D3YA 2EVOA 2EA4A 4OIRF 2EFWA 3DKWA 2QBYB 4CICA 4U88A 2H27A 1WQ2A 1ON2A 1L3LA 1YJ3A 1HBXG 1ZG3A 2GG5A 4IXAA 2EFQA 3T8RA 5FB2A 4KICA 3BJOA 4I01A 3FXQA 4WX9A 3HRUA 3ISPA 4GGGA 5HDNA 2W57A 3V8KA 1W7PA 4WCGA 4YG2F 3EUHA 3L9FA 3RIRA 5ILUA 4ZYGA 3BP8A 5CDEA 3F22A 3CLOA 2Q94A 2QQAA 5DUIA 3TB5A 4RGXA 4IPAA 3GW2A 1IXSB 3M7GA 4UNOA 5LGNA 2QWWA 3ULQB 4EM1A 2OD5A 2XGXA 2XUBA 4LGWA 5HVQC 3HIFA 4ON0A 5ED4A 2DO7A 4LJZF 2HTSA 4L9NA 3P9CA 3KZZA 1TW3A 2IA0A 4KIFA 3GVAA 2XAJA 2L4MA 1B1BA 2XRNA 3FM3A 4BHCA 4U7DA 3HSFA 3FHZA 3DF8A 3F8BA 1RIOH 2HR3A 2D2WA 5EEGA 4M71A 4ENJA 3L7WA 3GLXA 4EGZA 2XAHA 3ZMSA 3U2RA 1W7VA 1WRJA 1IN6A 4HXXA 4OIQF 1KYWA 4CZZA 3T1BA 5FFXA 1E17A 2DI3A 1TQIA 4S05A 1AWCA 1RUNA 5J8CA 3TDZC 2K02A 4BQAA 5D5UB 3CDHA 1KU9A 2W25A 2P5VA 2RQPA 3TO9A 2V1UA 1D8JA 4M6YA 4IF4A 3LQQA 5JVTA 5J8FA 1W4MA 2VT2A 4FO7A 2BWTA 3WODF 4HBLA 1B4AA 3L7GA 5BPDA 2FEZA 1ZGAA 4A0YA 2KJCA 3B73A 1GXQA 3C18A 2MA3A 2EWNA 3PKDA 5BMZA 4A6EA 4LLGF 3WTUC 3JAMZ 1UHMA 3OOPA 5FD5A 4L9JA 4HX4A 3DP7A 2WV0A 2VOPA 5IT9K 1AOYA 2ELHA 3E6CC 2QQBA 3GZ5A 3WGIA 1B6AA 2J5OA 1T0FA 1YIOA 4UVCA 1WY2A 4LG0A 1ODDA 1U2WA 4WXHA 5D4RA 1TTYA 3BJ6A 2GGCA 2UXXA 4LK0F 3KCCA 4KUMA 1CF7B 2P5LC 3D0SA 5CDVA 1CGPA 1BI3A 4ESJA 1R23A 1FSEA 4G8XA 3M8FA 3K69A 4E70A 3G73A 3I59A 2DQLA 1W5TA 1WN1A 2Q8KA 1PP7U 4S04A 1Y1NA 5HDGA 2HZTA 1TQPA 3BWGA 4KFCA 2GG9A 4RZZA 4P9FA 2BHDA 1O3TA 3I64A 3H92A 4I0BA 4OOKA 2EVCA 1OR7A 1QO0D 3RI4A 2QZ8A 2QENA 5K5RA 1HSJA 3IL2A 4FX4A 2ZFWA 1Z6RA 2G6PA 2M45A 4S2TP 3TGNA 2Q93A 1MDMA 4LB6B 4Q48A 1J9IA 2M5WA 1EH7A 3MEXA 3HOSA 2NRAC 4GO1A 3GX4X 3IG4A 5TRDA 4AIKA 2GA1A 2DLLA 3K2ZA 2EA2A 3FZVA 3GF2A 2XAFA 2F5CA 3GZ6A 5DV5A 4ENMA 5DD8A 2M87A 2G7UA 1V3FA 4PNCA 2YX7A 1BIBA 1R1TA 2V1XA 3KP2A 2GU5A 1FC3A 3JTGA 1K79A 5CVVA 3KP3A 4H0EA 4YFXF 4EVIA 1YW8A 5FO5A 3GWZA 2OAZA 5FGMA 3PKBA 3HOTA 3VB2A 4L18B 3LAJA 1FPQA 2YX4A 4HYEA 1XMKA 4HV6A 4Q47A 3CTZA 1FWZA 2V3XA 4IJAA 1C27A 1FT9A 4L5JA 4EGEA 3C1DA 1BN5A 3V8JA 4M9XA 2IA1A 2O3FA 1USSA 2BB7A 1U5TB 1U5TC 1YW9A 4EJUA 2BHAA 4LLLA 3D5LA 3DEUA 4Y15A 3J81K 4EJTA 1FY7A 5LLQA 4B09A 1O57A 4A6DA 2ESHA 4U76A 3BPVA 2ESNA 1JHHA 4CDGA 1J59A 5HLGA 4CHUA 3FM5A 3K0LA 2WTEA 1KQ0A 3CTAA 4GXOA 2KIFA 1ZGJA 3K1MA 4M9SA 2EFNA 2COMA 4ZYEA 1QZZA 6PAXA 1Z9CA 3ZP5A 3L2CA 3WGGA 1BM9A 3F8MA 1IUYA 3RKYA 3Q6DA 5HS9A 3FXUA 5HLIA 2ZSGA 4M72A 3E5UA 3MQ0A 4MQVA 3ZMTA 2J5PA 4Z7MA 1MGTA 2CYYA 2Z99A 1KU3A 1PV9A 2BYVE 3F23A 2FXAA 1BIAA 2PEXA 5E5BA 3RPUA 3KE2A 1I1GA 1BI0A 3IU7A 3E6DA 4K2EA 3MFKA 4O6JA 2A07F 2GU7A 2V6CA 4FLIA 2HQRA 4HX7A 2RNJA 2EJRA 2EVMA 4IHSA 1SD6A 1R5HA 1E2XA 2GXBA 1J5YA 2ZNYA 5FLXZ 2BGCA 1SAXA 2QM3A 1P92A 1XCVA 3NRVA 2FMLA 3L00A 3RDIA 2G9WA 4I2OA 4N0BA 2GG8A 4WXCA 2LNBA 3JW4A 3BJAA 4U0YA 4Y13A 3CUQA 1R7JA 2IW5A 3ZMVA 2XHKA 4A2UA 1O7FA 4MTDA 2PN6A 2F5FA 3OV8A 2HS5A 3HHHA 2QUFA 3JSOA 1J75A 3QP6A 2A5YB 1KA8A 2P6SA 1YTYA 3SHFA 4L0ZB 2W85A 3E6MA 1XSDA 4U6JA 5JFRA 3E97A 3MZYA 4A0ZA 2QVOA 1ZG1A 4FUKA 4KN4X 3GYHX 1RZ4A 1YVMA 3J80Z 2VC0A 5CVUA 3GUDA 3C3WA 1DUXC 3L24A 4N9IA 3IKVA 3TOAA 4S01A 1QQIA 3SQNA 2TDXA 1TW2A 3K1NA 3FWEA 2ZMEA 5LEJA 5D5XB 4ZNGA 3EQLF 1ZLJA 5F6FA 1IW7F 4AIJA 1LDKB 1PP8F 5DCFA 1B59A 4OIOF 3VFZA 2CGPA 5FCHA 2BWYA 5TJJA 4MNUA 1O3RA 1UHWA 3BZ6A 4A12A 1U6GA 4FO8A 1QXWA 2K4JA 1HW5A 2A6HF 3TO7A 2GGBA 4I02A 2LSOA 4L5IA 1ZH5A 2GXGA 1BJAA 4KN7X 1VTNC 4HX8A 2ZXJA 4U7BA 1R1UA 3K9TA 3HRSA 1WKMA 2HYFA 1OPCA 3DQVC 3O3KA 4G9YA 4IRHA 2PJPA 1T6SA 1FOKA 2L02A 2JRTA 5FFZA 5J6XA 4MATA 4PCQA 3IHUA 2OKNA
chains in the Genus database with same CATH superfamily
1LPQA 1JXSA 2AO9A 1I39A 3BG3A 5CDLA 3DBLB 1YJWI 1VNDA 2FA5A 4BYYA 4XMYA 3LL7A 2RN7A 2L9VA 3OSFA 3S2HJ 2D45A 1XNZA 1JUSA 1X1AA 1LFUP 1XGOA 5DM7F 1B8IA 3Q3SA 1WL9A 1XCBA 2IS1A 1S29A 3F8FA 2CV1A 2DOAA 3COAC 2R7XA 3A02A 1TWFJ 2ZJ2A 5GADJ 1T39A 3GO5A 5DUKA 3M07A 1KU7A 4U71A 1WLRA 1N51A 1SMYF 4YIIA 3S2WA 2Y2ZA 1GV2A 2XGEA 3FXLA 4NQWB 2VBXA 4JX6A 1HDDC 1ZARA 2K85A 1DGRM 2LF7A 2MLKA 2GXAA 4FT8A 3CC4I 2VQGA 1JI8A 1OCPA 1WHUA 4O3MA 2A3SA 5IY5H 4KT5C 1G3TA 3TO6A 1F1ZA 3CCJI 4FLJA 3M1EA 4XR6A 1RNLA 2KZGA 1FOXA 1JGSA 2QEXI 3A2KA 1PJRA 2V9VA 4I99C 1O3SA 3BIQA 4LIVA 4BDYA 3QYEA 4OINF 1WFXA 1ERDA 3IRRA 4EM2A 3WE3A 4AU7A 1VQ5I 1FX7A 4HF2A 4KMFA 1V5GA 1I50J 3LFUA 2WB1N 2E35A 2JPBA 3S1QJ 2DU9A 2JK3A 5FCFA 2YU3A 2MC4A 1TWAJ 3E3VA 3WTZA 3DBRB 4ZDPA 1Y8QB 4BKXA 2WY8Q 2XAQA 3S32A 3EYIA 5E1WA 2XSJC 2R7RA 3KETA 4KISA 4IHTA 1P7IA 4LFUA 4UV8A 2XF5A 2P98A 5LEKA 2Z2SB 4A3EJ 1MMNA 3DPLC 4IKUA 2IS2A 2DMQA 1DP7P 1OCRH 5FRNA 3WTYC 3T8TA 4IRIA 1WWXA 4P5OA 4OU0A 1FLIA 4G7ZF 4Y7NJ 4G6TB 2X1CA 2ETHA 2JVHA 1ETYA 2HOSA 1P4AA 4U6WA 3FXRA 1QU3A 3FHNA 2NQ7A 1H9GA 3F72A 2CUJA 3KIOA 5HS8A 3QODA 1K61A 3K4MA 4MIMA 3U21A 2R7FA 2F5DA 1Y1VJ 2FSWA 2V3YA 1ZN2A 4AWXB 4RGZ1 1G3WA 3PSIA 1HXDA 2R4GA 1Z91A 1LFBA 5M5WJ 1C21A 5ICFA 1JUMA 2CWEA 2H1KA 2UV1A 2XASA 1U0JA 2M1BA 4H4KC 4RGRA 1WBQA 4GYIA 4A69C 2P7CB 2E1NA 3KEOA 1IN5A 1W0UA 4YELA 3CP8A 1Q1HA 2NAZA 2BBYA 2VPRA 5HLTA 2FE3A 5HDKA 1KU2A 3F6VA 3T5XA 4I98B 4PGGA 4KMUX 4MFDA 3MWMA 1OYWA 1YE9A 1YQAA 3MX6A 4I76A 4C3IJ 2GU6A 1S5LC 4KT6A 3S1RJ 4Z2YA 4XRSG 5J1RA 2HGCA 4G94A 3H9QA 4HW0A 1A5JA 2P99A 5BS6A 5IT9Z 1JT0A 4NNJA 1FBSA 2L5QA 2DDAA 3G1LA 3OL4A 3LWFA 1ITYA 2A05A 1PUEE 2Q92A 1O3QA 2X9DA 1EJ9A 3KEYA 1C24A 2PG4A 5DYMA 4NHJA 1OCOH 1WJEA 1SEUA 4PSXA 2NVQJ 1SFXA 3L2WA 2ZFUA 2P6TA 1ACIA 5B1BH 4IKSA 1PUFB 2Z33A 3ZR8X 5JLWA 3FMRA 1V5EA 2ZJPF 3HOZJ 2GTXA 3CUQB 1JJ6C 2ELJA 2JT1A 3KP5A 1XDSA 2V1NA 2K3PA 1P4XA 1IN8A 1JT6A 3HDDA 3ZQHA 3TKYA 4PJ0C 2ECCA 3R6SA 1LJ9A 3AAFA 4U0VA 3I4PA 4R1HA 3A01A 4LLNA 1KP0A 3AG3H 1Z3YA 2EQRA 4IVNA 5CKTA 5FD6A 2VBYA 3PNTA 3MKLA 4RB3C 4IKTA 1MJAA 3QU3A 4RAZA 4XKVA 2LP0A 3G71I 1B72B 2HQ5A 3WG9A 4U75A 2CFXA 4ENNA 3SYTA 4CYDA 2QA4I 1F5TA 3JRAA 2ZO4A 5J4YA 5E18F 2P7VB 1BI2A 2DFFA 3LA3A 2ZSIB 3MAJA 5K7FA 2BWXA 2CV0A 3BR1A 1V54H 3OYHA 4WK8F 3BTCA 2V1DA 1LB2A 1QPIA 2FUG2 3SDGA 1GVJA 2IW2A 1ONVA 2M7BA 3HRTA 2K40A 4ZJZA 4M6XA 4QWQA 5D8LB 5GPAA 3LQRA 5L3BA 1J2XA 3V7RA 2VKDA 2QLZA 2LR8A 3F21A 1HCRA 1BW5A 1ETKA 2Y48A 1REPC 1SD5A 4RGUA 3S14J 4S0HB 2DTZA 1UZCA 1X1CA 4B48A 4BHPA 1K78B 1E3PA 4EJVA 2DT5A 3UNGC 2UZKA 2UUZA 1WJBA 4M73A 1DU0A 4HAMA 4ZZDA 3BR0A 2GLOA 5F0HA 2AQEA 3GFIA 2L3DA 1MBKA 2V26A 4HSTA 4AYBN 1TWGJ 4FKCA 2HYGD 1ZKGA 4YEJA 4A3GJ 2M9HA 2IBDA 4UV9A 2QBYA 5FRMA 3HUGB 4N4OB 3QYBA 2LMDA 2VKHA 3AG1H 1JKOC 4MFEA 4V19K 3P5JA 2BHCA 1W7PD 4RZYA 3NARA 1XMAA 2MG4A 2EZKA 5ICCA 1FTZA 3BZCA 2MD0A 4CCJA 3ZQ7A 2Y75A 1RUOA 2EPFA 4HLYA 1JKQC 3DV8A 2Q95A 3QPTA 2XKPA 2GG0A 5H20A 5IP9J 2WY7Q 1Y1WJ 1ENHA 5A2QK 2HDWA 1HKTA 2QSHX 2QYOA 3TP0A 2DW4A 2LKPA 1W5SA 2Z1DA 4U87A 4E7LA 1AKHB 1SFKA 2X0LA 1LVAA 4QLCU 3RVAA 1FP1D 5IT3A 2W4SA 4HV5A 2L7ZA 4ANJA 4XKBA 2KDZA 4XONA 2DBBA 1XTAA 1N78A 2NS8A 2ZXIA 1MKMA 2EV5A 4Y17A 2GG3A 3TL4X 1YS6A 2AXLA 3EETA 4Y3OA 1OKRA 2HDCA 3RKWA 2O9LA 1Z3XA 1A04A 1TC3C 2RV8A 4R60A 2FD5A 4A0XA 4A3JJ 1W7PB 2LYCA 2O8XA 4II2A 3N4MA 3BR3A 2BY1A 4UB6C 1I3AA 3QYFA 2AHQA 3Q0UA 3FXJA 4U70A 1FSHA 2L4AA 4OOIA 4BU2A 5CNXA 4FTHA 5J4VA 3V7SA 3VPRA 3HTSB 5E3MA 5J47A 2RKHA 4I7HA 4LG3A 2MW8A 3LMMA 4NB5A 3ZGKA 1MBEA 1MH4A 2XDVA 3WU0A 2ZNZA 4RAYA 1I27A 4BE1A 3HPGA 2E7XA 1ZAOA 2DPDA 4U0WA 1QHGA 4RAGA 5JR3A 4I09A 4XLCA 3X2QH 3KLOA 3QQAA 5GAHJ 2KIUA 4YFNF 5GPCA 3ELKA 4JK1X 4LOCA 4A3BJ 4V2GA 2B0LA 2Y31A 4ABZA 4CH7A 2X85A 2FMYA 1RETA 4MEXF 2DK8A 2YR2A 5IPAA 5EG0A 2FBKA 2F4IA 1FOWA 1ZRFA 1OYYA 3CCUI 1QXYA 1XGNA 2IXSA 3AL0B 4MQ9F 2OQGA 1BJZA 5K7ZA 1P7JA 3WTVC 2DT7B 1VQMI 4L9TA 2IVMA 3PKCA 2Q2EA 3J81Z 2WWYA 4HDVA 2XAUA 4D5CA 1W2MA 2V9KA 3DPUA 4A6WA 2VE8A 3HGYA 1T38A 5IYDJ 1VF9A 2XVCA 4F92B 2DOEA 1MBGA 3R4KA 3JRHA 4ESBA 3FMSA 2CSOA 2F5EA 2M0MA 1VQNI 2A6TA 1IN4A 1R9TJ 1G3YA 3Q0VA 3ASOH 2PMZN 2HEOA 4AD9A 3OS2A 3TQNA 3CB5A 2R5YA 5F27A 2HXIA 2V79A 2E7WA 2BEOA 2HQNA 2LBFA 4P1WA 2JZYA 1A31A 1TQMA 2PJRA 1T98A 2HKOA 3HHGA 3FDYA 3KLNA 2H09A 1OYIA 3W3CA 1C22A 1SD4A 1R71A 2O61A 5E8GA 1R1VA 2NQ6A 2EK5A 1SC7A 2N8GA 1NG6A 4E7JA 1ZRDA 3C7JA 4ENKA 2NXNB 4A3IJ 4G12A 4FCYA 3VYTB 1J7KA 2OTLI 3H3VK 4JBAA 3VODA 3W6VA 4UUTA 4D7NA 1OCTC 1TP4A 2NNYA 4KIGA 2K27A 4PDKA 1D1CA 1G3SA 3KEQA 5F0FA 2XPVA 2P5KA 4F7ZA 3GTGJ 2ELKA 4YIFA 1MATA 2EV6A 4B1RA 4IU6A 4JQFA 3DTEA 3RJPA 1WSUA 2BVMA 3L2VA 1PYVA 4BNCA 2EZIA 4HLXA 3ECHA 2W84A 3B02A 3HPHA 3N97A 1DDNA 1XX5A 3M3YJ 2FBHA 1R5GA 1QZEA 3OR2C 1XC5A 2DTRA 4QPOA 1IXCA 2CUEA 2AQFA 5M3FJ 2DOFA 2L01A 3IU9A 2E71A 1N25A 5FKLA 2X6WA 4U69A 4C9YA 2GM4A 2V3ZA 3F8CA 1WI3A 4RBOA 1WL6A 4QSHA 1N75A 1MSFC 2A61A 2L9SA 3CB6A 1BL0A 5H6QA 1IC8A 1SANA 1X19A 2O03A 2CU7A 3CO7C 4HPQA 4LG0B 3D5RC 1CF7A 2O8KA 2EIMH 2GZWA 4ZH4F 2DK5A 4S2RP 2R7DA 3OYCA 3HOWJ 1MMSA 1YG2A 4AC0A 3BDDA 4X1EA 4II3A 2PI0A 3KP6A 3R0AA 4FE4A 5DCMA 2DQRA 2JN6A 1HSTA 3ERMA 2R7TA 4CYCB 4LB5A 3C2HA 2R7WA 1X2NA 2CV2A 1FNNA 1HDPA 2E1CA 3S17J 1V4RA 1MMDA 2GZ5A 4C3JJ 3PIPF 1JHFA 3BR2A 4C2TA 1K6YA 3CCQI 4XQFA 5JHFA 3OOUA 5CVRA 3J80K 4B44A 3JR9A 1U9OA 2K86A 3RORA 2L7MP 1FYMA 3WTTC 1A16A 4BAYA 5CVJA 3I59B 4IQ4A 2VJ5A 2PMUA 3EDPA 2DA5A 1S8NA 2A69F 4KNYA 2ISZA 5DD4A 4XLPF 1ZR2A 1QNTA 3F0CA 1YRNA 3WU1B 3H3UA 2W24A 1X2MA 2IP2A 4OMZA 1GHCA 2RVCA 1UCRA 1R36A 4D9JA 1S7AA 3ZMDA 2KQRA 4CZCA 3ZCOA 2B3KA 2H6BA 4B8XA 5D8KB 2R3SA 4KITB 5JHUA 3MR1A 2QKLB 3PFIA 2M30A 5HLHA 4HG2A 3I71A 2VT3A 4XSXF 1LEBA 1LUJB 1U78A 3RYPA 4IX7A 1YJ9I 1F36A 4HSRA 2IA2A 3BT9A 1X1BA 1TBXA 3CJRB 4PJJA 3S1MJ 1SFEA 1S7EA 2MH9A 4PV4A 1VQ7I 5E20A 3LOCA 2G7HA 3OYFA 1DP3A 4U6EA 1YW7A 3O2PE 3JRIA 2JUGA 3VSLA 5EEHA 2IRFG 1MDMB 3D5SC 4PZJA 3NAUA 1USTA 4RM3A 1DGWY 4KIBA 3TEDA 4B28A 3OL3A 5CYVA 4ZWUA 4P96A 4Q4ZF 3MKZA 4HOBA 1NTCA 3H1CA 5KNLA 4G6DA 5B3SH 2BW3A 2EV0A 5EZGA 3B6CA 4AM3A 2P4WA 4IHXA 3IWFA 3JTHA 2CW8A 2Z16A 1BOAA 2V9PA 3WG7H 2D5VA 3PSFA 2Z5UA 4XKWA 2LY2A 5ICEA 2FNPA 2KRCA 3FK7A 1HKSA 5E17F 3FKIJ 4YIRX 3GZNB 4FX0A 1FIAA 4RGSA 1T2KA 1MJ9A 2B3HA 3CUOA 2P8TA 2CQNA 3E5XA 3KP4A 1MNMC 2XROA 3Q9VA 2BOLA 3CCEI 3P9IA 2L9RA 3OYMA 3RQIA 2DMNA 1D1BA 4XLNF 1QZYA 4UUSB 1DQUA 3G2BA 2KL4A 4C3HJ 3QRFF 1AU7A 2FRHA 5H2FC 2PBIA 4UXNA 2CG4A 3DPTA 4U1BA 3OYAA 2DJNA 2STWA 4FETA 4ZZLA 3S6BA 2ISYA 5KK1A 2OC6A 1E0EA 3IU8A 2LREA 3BG6A 2OF7A 1T8IA 2JA5J 1J0RA 4A6VA 5CQGA 1EKEA 2ADUA 4CCKA 4N4NB 3HSEA 5LGUA 3HOYJ 3ABUA 5K5OA 1G2HA 3IH4A 2ACJA 3K4CA 5B5EC 2MD5A 1ZGWA 3S3NA 3GTOJ 2HOWA 5AONA 4LMYA 4JX4A 3RPQA 1XGSA 2EB7A 1VQ6I 1FBQA 4W97A 2EIJH 1A6QA 3VWBA 3WHCA 3W2AA 3KYDB 2DJIA 1U5TA 2DA4A 2QSFX 3BTIA 1HW1A 1LDJA 2E34A 1XDUA 1RI7A 2VBWA 2XB5A 1FP2A 5LRSA 2KP6A 1Z77A 2LK2A 2ZC2A 4M3DA 2B63J 5F04A 5LGTA 3OWTA 3P7NA 2HPMA 2MGQA 3CJTB 4DBQA 5J1YA 3V42A 5J3LA 2F2EA 1Y0UA 3CCVI 1C0WA 2VC1A 3ROUA 3FISA 1N77A 3QOPA 1YLFA 3E7LA 5LHGA 3IC7A 1WCMJ 4XLEA 4ZC3A 1IRZA 3IRQA 5DTDA 1Z0XA 4JP0A 3OYNA 2EFPA 3ABLH 1UB9A 2AS5F 3K1PA 4ASNA 1H88C 4HNTA 9ANTA 1I1SA 1DPRA 1FMWA 1Z05A 3I56I 2DMPA 3BZKA 3OMYA 3QAHA 3OSGA 4YFKF 2KRFA 3DXJF 4RMNA 3J7YJ 1P4WA 3LA2A 1OLTA 2VXZA 3CESA 3RPUD 5FKKA 1POGA 4PK4A 2D1HA 3A4CA 3QPHA 3ZPLA 3CF2A 3Q0WA 1ETVA 2Q96A 2OJED 3ZQCA 1JUPA 1HQCA 1RRJA 1R22A 4BH9A 1BA5A 1KQ8A 4MGRA 5ILSA 4P55A 4S00A 3PKAA 4EV0A 1D1AA 3H3ZA 3FMQA 4OIPF 4DIQA 4UVAA 3DEWA 4HEA2 2WC2A 2DMUA 1U9NA 1T33A 2E1MB 4DW6A 4F3QA 2QSGX 3GFJA 4EQQA 1IRFA 4PJLA 5BPIA 3CF5F 4IRGA 1U3EM 1BR2A 2XKOA 2YPRA 1V5FA 4WF2A 2DAOA 2XGCA 2LLKA 2BV6A 4ETSA 5M5XJ 3SZPA 2BWSA 2CW0F 4ZWOA 3ABTA 2BY3A 4U73A 2YS9A 4OAYA 3I4MJ 3TOBA 3LFKA 2X48A 1H0MA 4EM0B 1B9NA 2JPCA 3DKXA 1MSEC 4RLQA 3IH2A 3IAS2 2HTJA 3HOXJ 2LY9A 4FQGA 5LRRA 4EJWA 3BLYA 4IF7A 1XSVA 3JAMK 2K5CA 3P9KA 5D6EA 3D27A 2GBYA 2BHBA 3BIPA 4CXFA 3J7AY 1LDDA 5HNHA 1MH3A 1X3WB 1IN7A 2E1OA 1RPWA 4X0GA 4HQEA 3DFGA 3PKEA 3V8LA 3BROA 3GCMA 2GG2A 3E6BA 2PMHA 1MJBA 3F3XA 3IUOA 3NQOA 2FU4A 1LQ1A 1LE8B 2IT0A 2MC3A 5ICGA 3DBHB 3LAPA 2BWWA 2CMPA 3M4OJ 1YFHA 2RDPA 4BHBA 3PO2J 1J09A 2IGKA 3SJMA 1L0OC 2QCOA 1IDYA 1WI9A 3Q5FA 1OCZH 4IKRA 1R58A 1Y39A 2R7VA 4UUVA 3HKZA 1BC8C 4W1UA 1F4KA 1QBJA 2E60A 5GTIC 2M7AA 2R5ZB 3HXLA 2WAQA 2Y30A 3U1DA 3K70D 4HA8A 5FKNA 2FNAA 2ID3A 2JA2A 4KYWA 1NK3P 2KIMA 3CUQC 3IH3A 3R0JA 3QP5A 2R7SA 3TP3A 5KVRA 5FLMJ 1MMAA 4ZDOA 1JGGA 1PDNC 2BH3A 4FLKA 2XF6A 2RGVA 2BN7A 2OU2A 3C2GA 5IYBJ 1SVLA 3IV5A 2V4JC 1X3ZB 3W6JB 2R0QC 2BE5F 3K10A 5TGTA 5HOOA 3L1PA 2OZUA 1M35A 2FX0A 1BC7C 4BS9A 3OYBA 3RZOJ 1F9NA 2ZBKA 2VE9A 2GQQA 1VI0A 5DCMB 2ECBA 3FBIB 1HKQA 4RB0A 3CJNA 3GBGA 1KYZA 5E1XA 1QPMA 3LSJA 4XBFA 2PX9A 5AIQA 3WTSC 4BQOA 2PQ8A 1QA6A 1ZHFA 4Y4RA 2ZCWA 4HZFA 4IHYA 3GTKJ 2OZ6A 3RKXA 1MW7A 3WE2A 2DA3A 1S7OA 1SMTA 4M74A 1T95A 5E1ZB 2KKOA 1IJWC 1Z1DA 3SZGA 3BPXA 5EZHA 1Q1VA 1UG2A 3WHBA 2CUFA 2Q0OA 5IOZA 4CGZA 3CCRI 2DYSH 4IECA 2RNGA 4AUXA 1IO2A 3BR6A 1GXPA 5D5VB 1D8KA 2D1VA 4E7SA 4DNCA 4DGWB 3MATA 3MN2A 4JX5A 2JWTA 1ETWA 2P81A 3KX2A 1QRYA 3I53A 5E3OA 3O8HA 4NC8A 4KA4A 5GP9A 2ZMEB 4JUQA 1ETXA 2KJBA 2ZSHB 3WGHA 2XPUA 5K1YA 5HODA 1VQPI 1XPXA 1YS7A 2Z3YA 4CO8A 3GFLA 4CUGA 2K9NA 1G59A 3FXOA 5L3CA 2XAGA 2R7UA 1ZYRF 2LF8A 3K4LA 4L5EA 2MBFA 1D0YA 5LHHA 2E2IJ 4FLLA 3ZN0A 3BY6A 2O6GE 4IZZA 3LSKA 4ZYAA 3RYRA 1ZQ3P 1OMIA 1XG1A 1IRGA 1HA8A 2XIGA 4GYGA 4AVPA 2V6EA 3DTIA 3G1OA 3ESWB 4BUPA 2L7KA 4NC7A 2R93J 1ZREA 1VQ4I 4B47A 1E3OC 1IV6A 1YITI 3FBNB 2DT6A 2YU9J 2OPTA 2Y0MA 2VJ4A 1I5ZA 3PQJA 2XSDC 1AA7A 1XGMA 2VKVA 3NEUA 3MMYB 2FBIA 4OMYA 3HRMA 2PLYA 2E5NA 2HOAA 3H0GJ 3L2RA 1APLC 2K9QA 2DFHA 1GDTA 3H9GA 2Y9YA 2ZB9A 4EMSA 1OCCH 2A5WA 3FX3A 2FF4A 3ZMUA 1U8RA 2GAUA 3PQKA 2X6YA 1XS9A 1FYKA 3ECOA 2A6EF 5A2QZ 1S3JA 1FYLA 4TV7A 1HW2A 3ERED 1ORKA 4UHTA 3H36A 3ABKH 2MLGA 4RB2C 2MFZA 4G7HF 1QXZA 3EUHC 2GG7A 1STZA 4L0YB 3HSRA 2H1LA 2PFBA 5ERIA 4BJTA 1G6NA 2NNNA 5L3GA 2UXNA 3MCZA 2NVUB 1IF1A 3DEEA 3QOEA 3R61A 5BQTA 3FXKA 2EFOA 3T0YA 4ZYDA 3KFWX 3KZYA 2K7LA 1MD0A 5L3EA 4M9ZA 3Q9SA 4HNVA 1MNEA 2H94A 3VOEA 1O7LA 4WXDA 2DPUA 2XV4S 1B8IB 2CQKA 1P2FA 3H5RA 1TLHB 2KRHA 3DTKA 4NQWA 2HWVA 2IS6A 2JRMA 3V7CA 1RESA 1B9MA 1WVRA 2HQAA 2YSRA 4X6AJ 3JSPA 3LSIA 2IJLA 1TWHJ 3HZJA 2ZXHA 1EH6A 1UHSA 3PUFA 1P6RA 2HKXA 4ZWPA 4ITVA 4HF1A 4Z7MA 1FZPB 3TBIA 1D5VA 2LTPA 2VBZA 1TNTA 1FBUA 2H6CA 1YO5C 1FJLA 1D0XA 2HFHA 1BI1A 2HNHA 1ON1A 3AL0C 3S93A 3SXYA 5CLSA 4XOTA 3K6GA 4MHGA 2OBPA 4A5MA 1HF0A 2DFIA 1IAWA 3OYEA 1RKWA 4D5FA 3LSMA 2JSCA 4Y52J 4LD5A 4B43A 4FISA 1XSXA 1MNDA 3A0HC 3TAVA 1S9HA 1QGPA 3BG9A 3QU6A 4QPQA 5LBQA 2DA6A 2STTA 2VJJA 1MZBA 1TT5B 4LK1F 3J7AO 2Z9OA 4HNUA 4PFPA 5CVIA 5DEQA 4DYQA 3RKQA 1IZ1A 3R60A 4CCNA 1ZRCA 1CHMA 4QR8A 2L54A 3IKTA 5LD2C 2A68F 3DLLF 2HOEA 1TNSA 1K4SA 1C23A 4KDPA 1TZLA 1XB4A 1H8AC 2P9AA 1NH3A 2V7FA 1O0XA 4HF0A 2MSYA 3O6BB 3OYKA 4PFOA 1FEXA 3I58A 1UFMA 3A1YA 1XN7A 3HOUJ 4BY1J 2XPWA 2JTVA 5BOXA 4G7OF 2BWUA 2DA7A 2MATA 4BXFA 4DYRA 1YYVA 2GOMA 3CJQB 4UVBA 4ESFA 2VOOA 4DOZA 2BWVA 3M8EA 3V4GA 3I5UA 4XRMA 1X58A 3L09A 2K4BA 3RSNA 4ZTJA 5EF6A 4MEYF 1V55H 4Z6YA 5IP6A 1IRXA 3CCMI 5FLXK 3LA7A 4FHTA 5M5YJ 3B6AA 1ZK8A 4RB1A 5AIPA 2LDUA 4EGYA 3VEPA 4HQMA 1K7AA 5D6FA 2LG4A 1Z7UA 5CJ9A 2LFBA 5K5QA 1VQ9I 1YX3A 3EYYA 5ILVA 3WTWC 1BBYA 2MH2A 2WA0A 2OUMA 4V2FA 4IKFA 1JE8A 3S16J 3I0TA 1LEAA 4FE7A 3ML6A 1NHAA 2TRTA 3G3ZA 4E7IA 3IWZA 2CQXA 2FOWA 2ZKZA 1U8BA 2OA4A 1T0FC 4F93B 2QQ9A 1EF4A 1EV7A 4EJOA 5L3DA 4MTEA 2JSPA 1DPUA 3H5AA 3HC7A 1IXRC 1GV5A 3I54A 5C4JJ 1K83J 4OWRB 2B3LA 1S6LA 1JKPC 4BBSJ 4BXUA 1PUFA 3GEZA 2EZHA 3HTUA 4XSZF 1A6IA 1X3UA 2UWMA 4BQQA 2VJIA 4R79A 2O0YA 3FF5A 1UJ8A 4PGHA 4M3EA 2G0EA 5C44J 3EUAA 1I6XA 3CCSI 2VIXA 3TDUC 1UELB 1Z6TA 2CJJA 3G4SI 3HYIA 4Q5SF 2Y9ZA 5E8IA 3GTJJ 2VODA 3DWLE 3CCLI 2VONA 4QIWN 1XD7A 4XLAA 1X1DA 2RC4A 2X4HA 2Y0SA 3M9AA 4I0AA 4XICA 2HOTA 1KGSA 1HC8A 5CE6A 5D5WB 1R00A 3HGGA 1E3HA 1G4DA 2BXZA 4RLFA 1BOBA 1B72A 4D0PA 4L9VA 5F0CA 3W2WA 3WTXC 2F5VA 3HB9A 1SFUA 2GWRA 4PJMA 3A01B 1YI2I 2M8EA 2LRDA 3GTMJ 2C6YA 5LHIA 2CO5A 3GFMA 3BOQA 1OFCX 2X6XA 3E5QA 3UR3C 5L3FA 1EH8A 1UMQA 5F1RA 2EH3A 2GA2A 1SFOJ 5CIKA 4XRFA 2VN2A 1SD7A 1KQ9A 4WWCA 3LSTA 3ZMZA 3RQ4A 1IDZA 1MMGA 2NYXA 5D4SA 5HS7A 4U6ZA 2CW7A 4XIDA 4P9UA 4O5VA 5M3MJ 4U6CA 3SFZA 5FKOA 3MZHA 2WV1A 2IPQX 3REOA 2OQRA 3S2DJ 3GTQJ 5F64A 3LSHA 1ZG5A 3BQZA 4OAZA 4DQ2A 3OYDA 3SZTA 2VQHA 2FQ3A 1OR7C 1RR7A 4N9HA 3CO6C 4R8HA 3GXOA 1JAWA 5H6RA 2FOKA 4F55A 4A5NA 4RS8A 2NVYJ 2M3AA 1K6OA 3RTRA 3SFIA 1K78A 1H9TA 1OQYA 2NS0A 1HOMA 4IDYA 2JA7J 1X4OA 4IOCF 2I10A 4ZYHA 4AIHA 5DDGA 2WAEA 3BITA 4GCVA 3CMYA 5FKMA 3F6OA 4HDUA 2WB1A 2GU4A 1M1EB 3M1CA 3ZN1A 3F8NA 3CDLA 2E2JJ 4M3GA 2KIQA 1ZLKA 3U9GA 3JRDA 3IP4B 2GIVA 4XNFA 5EEAA 3HUGA 4G6QA 3MD2A 1LNWA 1ULYA 3KP7A 5JI6A 4KM3A 4A93J 3W6KB 4BE0A 3GTLJ 1D3YA 3OIOA 1QVUA 2EVOA 2EA4A 4OIRF 3BR5A 5GTHC 2EFWA 3FXMA 3DKWA 1GT0C 2QBYB 4CICA 4U88A 2H27A 3PIOF 1WQ2A 1ON2A 1L3LA 2VPLA 2I8DA 1YJ3A 2W48A 1X4PA 3JRCA 2KISA 1HBXG 1FTTA 1ZG3A 1UG0A 4E7KA 2GG5A 4IXAA 1W36D 2XB0X 1ZELA 4IHWA 2EFQA 3T8RA 4NUBA 5FB2A 2HI3A 4KICA 4XLHA 3BJOA 4CCOA 4I01A 3FXQA 3H5NA 5K7HA 4WX9A 1XMXA 1RKTA 3HRUA 1NG7A 3ISPA 4GGGA 4LITA 4E4HA 4XN0A 1ZR4A 5HDNA 2M4KA 2W57A 3FKJA 3SEZA 3V8KA 2EINH 1W7PA 2ME6A 4WCGA 4YG2F 3EUHA 3L9FA 3A03A 3RIRA 5ILUA 4ZYGA 3BP8A 5CDEA 3F22A 3SDBA 3KPHA 3CLOA 2Q94A 2QQAA 5DUIA 3TB5A 1TWCJ 1HLVA 3FIWA 1FMVA 4BACA 4RGXA 4IPAA 2W7NA 3H35A 1WJCA 3GW2A 3LSPA 1IXSB 3S8PA 3M7GA 4UNOA 2E19A 5LGNA 4A3DJ 3ZQQA 3HOVJ 1WPKA 1AHDP 2RAEA 1W36C 2M0CA 2QWWA 3ULQB 3KYCB 4EM1A 2OD5A 2CH0A 2XGXA 2XUBA 2HU9A 4LGWA 5HVQC 3HIFA 4ON0A 5ED4A 2DO7A 4LJZF 2HTSA 3OIQA 4L9NA 3LSRA 2LD5A 2L7FP 5J1UA 2MYSA 3KZZA 3P9CA 1TW3A 3E1SA 4XL9A 2IA0A 4KIFA 3ZQIA 2M4GA 3GVAA 4DYCA 1WJFA 5CQEA 1R6RA 1MBFA 2CRGA 3OY9A 4UY8I 5FLVA 2M2EA 4BJ6C 3DKYA 2XAJA 2L4MA 2YUSA 1B1BA 3SEQA 2XRNA 3FM3A 4BHCA 1WJDA 4U7DA 3HSFA 5EG0B 3OS0A 2F4OB 3FHZA 3DF8A 3F8BA 1RIOH 2HR3A 1R49A 2D2WA 5EEGA 1O4XA 2DFEA 4M71A 4ENJA 1Y6IA 3L7WA 3VYUB 2LH9A 3GLXA 2Q1ZB 3PM1A 3UKGA 5IYCJ 1D5YA 4EGZA 3AG4H 2Q2EB 1I6HJ 2QQ8A 2XAHA 3ZMSA 3U2RA 1W7VA 2O5RA 1WRJA 1IN6A 1GLNA 4HXXA 3LSGA 3E0JB 3S3MA 1FIPA 1PVEA 4BQNA 4Y33A 4OIQF 1KYWA 1OISA 2B9SA 2E1MC 1ZTRA 3T1BA 4CZZA 3ZOBA 2HYJA 5FFXA 1E17A 2CS3A 2DI3A 2IGNA 2R5YB 1TQIA 2F4MB 4S05A 1AWCA 1RUNA 5J8CA 5TISC 1H89C 2DMTA 3TW6A 3TDZC 4LIUA 2LBFB 2K02A 3NWSA 4BQAA 5EGOA 5D5UB 1I3QJ 3CDHA 2PJRB 2K3FA 2WAFA 1KU9A 2KFDA 2W25A 2BXYA 2P5VA 2RQPA 3TO9A 2V1UA 1D8JA 4M6YA 4IF4A 3LQQA 4PJNA 5JVTA 5J8FA 4QTRA 1W4MA 2VT2A 4FO7A 2NOGA 2BWTA 4XRSA 3WODF 4HBLA 1B4AA 3IAM2 4BBRJ 3L7GA 1BW6A 5BPDA 2FEZA 1ZGAA 4ZDLA 4A0YA 2KJCA 3AG2H 3B73A 4AIDA 1GXQA 4F52A 3C18A 4IHVA 4J00A 2MA3A 2EWNA 4B4CA 3PKDA 3K2AA 4AYBA 4J19A 2K9LA 5E3LA 2WBMA 5BMZA 2RQQA 4A6EA 4XM3A 4LLGF 3WTUC 1MBHA 5EDNA 2BVLA 3JAMZ 1UHMA 3OOPA 1NK2P 5FD5A 4L9JA 4HX4A 4A3FJ 3DP7A 1QVTA 2WV0A 5IP7J 2VOPA 5IT9K 5KCMA 3LNQA 1AOYA 3MZ8A 3I3LA 2ELHA 2W1OA 3QPLA 2E2HJ 3E6CC 1A35A 2QQBA 3GZ5A 3WGIA 2CFOA 3KZIC 1B6AA 2J5OA 1T0FA 1YIOA 5HNFA 1Z67A 1IV8A 4UVCA 2X1EA 4DZPA 1WY2A 4LG0A 3MKYB 2JA8J 1ODDA 3OYJA 1U2WA 4BDZA 2KHMA 3PJRA 2OV7A 4WXHA 5D4RA 1TTYA 4M6VA 3KYLA 1VQ8I 2XGDA 3GLLA 3DU5A 3ZXSA 3BJ6A 4CYCA 1YIJI 1R4MB 2GGCA 4F91B 2UXXA 4LK0F 3KCCA 4KUMA 1CF7B 3I55I 4RM2A 2P5LC 3D0SA 5CDVA 3K4NA 4B3XA 5LFAA 1CGPA 1BI3A 4ESJA 2BY0A 4NBQA 1R23A 5IOYA 1FSEA 4G8XA 5GAEJ 3M8FA 5DM6F 3K69A 3K7AJ 4E70A 3S1NJ 2ME0A 1WH5A 3G73A 1MBJA 2IAIA 3BG5A 4BEHA 2XF7A 2KLOA 3I59A 3K70C 2DQLA 2KZVA 1W5TA 4GDFA 5B66C 1WN1A 2Q8KA 3CMAI 1PP7U 2WADA 5EJCA 4S04A 1S72I 1Y1NA 2VQCA 2BHZA 3BTJA 2NVTJ 5HDGA 2HZTA 1TQPA 3BWGA 2DODA 5B1AH 1BR1A 4KFCA 2GG9A 4P9FA 4RZZA 2BHDA 1EA3A 2F6CA 3I64A 1O3TA 3H92A 3MKWB 2QGUA 4C2UA 3ZQLA 1GUUA 4I0BA 5E79C 4OOKA 2EVCA 2Y69H 1OR7A 3BG7A 1QO0D 3FK6A 3RI4A 2LY1A 1YRNB 2HVRA 3PFYA 4XORA 2QZ8A 2QENA 5K5RA 2F48A 3PL8A 1QHHD 3EPZA 1HSJA 3IL2A 2HXOA 2ZMEC 2E5ZA 4FX4A 2ZFWA 4RA2A 2EZLA 2O7OA 2IS4A 3M8JA 4YRVA 2JQ7A 1Z6RA 2G6PA 2M45A 5BNGA 4S2TP 2ZXWH 3TGNA 2Q93A 1MDMA 4LB6B 4CSWA 2HZDA 4Q48A 1J9IA 2IGMA 2M5WA 2EBIA 1YJNI 3JREA 5KHDA 1OJLA 1EH7A 3MEXA 1IGNA 5F08A 4BJ5C 2ZJQF 2JA6J 2B7EA 3QWLA 3BTLA 2PMZA 1DU6A 2L0KA 2L9NA 1KONA 3HOSA 4PSWA 2NRAC 1LVKA 1WJAA 2LVSA 5JVGF 4GO1A 3GX4X 2M34A 4C30A 3IG4A 5TRDA 1VQLI 2XC7A 2CQ7A 4BY7J 4AIKA 2GA1A 2DLLA 2R92J 3K2ZA 2JMWA 2EA2A 2KPMA 3FZVA 3GF2A 4M3FA 2XAFA 4E7ZA 2P0WA 2BW3B 2F5CA 3GZ6A 5DV5A 4ENMA 5DD8A 2M87A 2G7UA 1V3FA 3HKZN 4PNCA 3PO3J 1JTXA 2YX7A 1BIBA 1R1TA 2V1XA 2WAQN 4BXXJ 4UUSA 3KP2A 3OR1C 2R7ZJ 2GU5A 1FC3A 3JTGA 1K79A 5CVVA 3KP3A 4H0EA 4YFXF 4EVIA 1YW8A 5FO5A 3DCFA 2EIKH 5GAGJ 3OYLA 3GWZA 2OAZA 5FGMA 3PKBA 3HOTA 2GOXB 3VB2A 4CCMA 3CMMA 4E7HA 2VKEA 1SAUA 4L18B 2VXDA 1Z7LA 4DZJA 3HM5A 3LAJA 3JRBA 1FPQA 1LKXA 1FOYA 1A36A 2YX4A 2MABA 1BR4A 3ONQA 3CZ6A 1XMKA 4HV6A 4HYEA 4Q47A 1FWZA 4AVZA 2V3XA 3DU6A 3CTZA 4IJAA 1C27A 3K4KA 3BCBA 5E3NA 3OYGA 3J7ZI 1FT9A 4L5JA 4A3MJ 4EGEA 3C1DA 1BN5A 3V8JA 3DLAA 2QF7A 2FJ1A 4M9XA 2IA1A 2O3FA 2H8RA 4PUSA 1SVOA 1USSA 2X1DA 1WZ2A 1W0TA 2BB7A 1U5TB 1D0ZA 1U5TC 2HPIA 2TCTA 3H0DA 4E6KG 1YW9A 4NC6A 4EJUA 3D1NI 2BHAA 4LLLA 1F43A 2DYRH 3G1MA 3NWTA 4GFBA 3D5LA 3DEUA 4Y15A 3JRGA 3J81K 4A3LJ 4EJTA 1FY7A 5LLQA 4B09A 1O57A 2NVXJ 2ICWG 2VASA 4A6DA 2ESHA 4U76A 2VB6A 3OIPA 3BPVA 2ESNA 1JHHA 2I5UA 1ETOA 3BC8A 4CDGA 5HLGA 1J59A 4CHUA 3FM5A 3K4BA 3CC7I 3K0LA 4HRIA 2WTEA 1KQ0A 3CTAA 4GXOA 1Z21A 2KIFA 1ZGJA 3K1MA 4M9SA 2EFNA 3PNYA 2COMA 4ZYEA 2HVQA 3O8GA 1QZZA 6PAXA 3W2VA 1Z9CA 3ZP5A 4JOMA 3L2CA 1RC9A 3WGGA 1BM9A 2JVGA 3F8MA 1IUYA 1W1WE 1G8XA 3RKYA 2HDDA 3Q6DA 3HG9A 3OS1A 1WH7A 1MIJA 2VI6A 5HS9A 3FXUA 3AFHA 5HLIA 2ZSGA 2H8WA 4M72A 2DXIA 3E5UA 1Y8RB 2L2OA 3MQ0A 4MQVA 3ZMTA 4C2MJ 3QPSA 3RCOA 2J5PA 3EUKL 4XOPA 3TW7A 5C3EJ 1MGTA 1TL8A 2DDBA 2CYYA 4CCLA 2Z99A 2IGOA 1YOVB 3CP2A 1KU3A 1PV9A 2BYVE 2DA1A 2ZJRF 3F23A 2FXAA 3I4NJ 1BIAA 3CMEI 2PEXA 5E5BA 3RPUA 2JUCA 3KE2A 1I1GA 2M8GX 1R4NB 1BI0A 5EGOB 3H9JA 3IU7A 3E6DA 4K2EA 3MFKA 4O6JA 2A07F 2CUZA 2R7OA 3GTPJ 2GU7A 2V6CA 4FLIA 2HQRA 4BGDA 1SVMA 3MVPA 3BQYA 4XK4A 1YHQI 1T56A 4HX7A 2RNJA 2EJRA 2EVMA 1LE8A 4IHSA 1SD6A 1R5HA 1E2XA 2GXBA 1J5YA 2FQ4A 2ZNYA 5FLXZ 2BGCA 2GIZA 2X6OA 1SAXA 2QM3A 4ZTFA 1P92A 4RAFA 1XCVA 2BY2A 3NRVA 2FMLA 1VQKI 3L00A 2W82A 3JCUC 3RDIA 3CD6I 4IL6C 1VFCA 5J40A 2G9WA 2R5ZA 4I2OA 4D7MA 1JTYA 4N0BA 2KMUA 3HEFA 4MLOA 2LNBA 4WXCA 3G6EI 2GG8A 2DA2A 3JW4A 1P9QC 3BJAA 4U0YA 4Y13A 3VSKA 3CUQA 1R7JA 4RDUA 2IW5A 3ASNH 4NDLA 2LKXA 2KT0A 1TT0A 1R5ID 3CLQA 4IEJA 3WU2C 3ZMVA 2XHKA 4A2UA 1O7FA 1WJ5A 2OTJI 4MTDA 4M3BA 3CCYA 3VYSB 3I9V2 2PN6A 2F5FA 1JKRC 3OV8A 2HS5A 3RZDJ 2LKSA 3HHHA 1Y56A 4DJAA 2QUFA 3JSOA 1LFPA 2NOJB 2NS7A 1J75A 3QP6A 1IG7A 5EYRA 2AXTC 2A5YB 1KA8A 2LOOA 2P6SA 1YTYA 3SHFA 2HVSA 4FASD 4L0ZB 2W85A 4BL0B 3E6MA 1XSDA 4IO9F 4U6JA 5JFRA 3U1KA 3CC2I 3E97A 3L2UA 3MZYA 5CPRB 4EATA 4CA0A 4A0ZA 2QVOA 1ZG1A 1UAAA 4FUKA 3OYIA 1YX5A 4KN4X 2CQQA 3GMEA 2OCCH 4JYKA 3HL2A 3GYHX 4I6ZA 3VDXA 1RZ4A 4IQJA 1YVMA 3PNVA 3J80Z 2IEKA 4D1QA 2VQLA 2VC0A 2RREA 5CVUA 3GUDA 3C3WA 3ABMH 4KJZA 4BEHB 4DBRA 1DUXC 2XRLA 3L24A 4N9IA 5C4XJ 2VL8A 3IKVA 2VLAA 3TOAA 3CQZJ 3N05A 2K9MA 2K9SA 4S01A 1QQIA 4XKCA 3SQNA 2TDXA 3TMOA 1TW2A 3K1NA 2E36A 3FWEA 2ZMEA 5LEJA 4IOAF 5D5XB 4ZNGA 3EQLF 1VZ0A 1ZLJA 3BCAA 5KAFC 3HJEA 3ZQGA 5F6FA 1IW7F 4AIJA 1LDKB 2X51A 4B3AA 5FROA 2EILH 1PP8F 2QKMB 5DCFA 1B59A 4OIOF 3VFZA 2CGPA 2DCEA 1RR8C 5FCHA 3PUBA 4XLFA 2BWYA 5TJJA 1T08B 2R7QA 2W00A 3S15J 4MNUA 1VQOI 1O3RA 1UHWA 1WGXA 1CQTA 3BZ6A 4A12A 1U6GA 4FO8A 1QXWA 3VYRB 2ID6A 1JJ8C 2K4JA 2LC2A 1HW5A 2A6HF 4A3CJ 3TO7A 3HBLA 3ZRGA 4I02A 1X1PA 2LSOA 4UB8C 4L5IA 4J01A 2BZTA 2GGBA 1ZH5A 1ETQA 1K4TA 2GXGA 1BJAA 3K4JA 4KN7X 1VTNC 4HX8A 1IUFA 2KDOA 2ZXJA 5FJ8J 4U7BA 3L2QA 1AKHA 1R1UA 3K9TA 3HRSA 1WKMA 2HYFA 1OPCA 3DQVC 5JLXA 3ZQFA 3S3OA 3O3KA 4G9YA 4A3KJ 2DN0A 1KZHA 4IRHA 2PJPA 1T6SA 3F9KA 5KAIC 4EEFG 3A0BC 5DS9A 3C2BA 1FOKA 2OCEA 1W5CC 4BE2A 2COBA 2VUMJ 1GVDA 3AKZA 3JRFA 2L02A 4GRIA 2JRTA 2BHYA 3CDIA 5FFZA 1Y0NA 2JJ7A 5J6XA 4MATA 4XN3A 5F1JA 4PCQA 3IHUA 2OKNA 2Y0SN 4MO7A
chains in the Genus database with same CATH topology
1JXSA 5CDLA 2FA5A 4BYYA 2RN7A 2D45A 1XNZA 1XGOA 1WL9A 1XCBA 1S29A 3F8FA 3COAC 2ZJ2A 1T39A 3GO5A 5DUKA 1KU7A 4U71A 1WLRA 1N51A 1SMYF 4YIIA 3S2WA 2VBXA 1ZARA 2LF7A 2MLKA 4FT8A 4O3MA 2A3SA 4KT5C 1G3TA 3TO6A 1F1ZA 4FLJA 3M1EA 1RNLA 1JGSA 2V9VA 1O3SA 3BIQA 4OINF 3IRRA 4EM2A 3WE3A 1FX7A 4HF2A 4KMFA 2JPBA 2DU9A 5FCFA 2YU3A 3E3VA 3WTZA 3EYIA 2XAQA 5E1WA 3KETA 4IHTA 4LFUA 4UV8A 2P98A 5LEKA 3DPLC 4IKUA 1DP7P 3WTYC 3T8TA 4IRIA 1WWXA 4P5OA 4OU0A 1FLIA 4G7ZF 2ETHA 4U6WA 1P4AA 3FXRA 2NQ7A 1H9GA 3F72A 5HS8A 2R7FA 2F5DA 2FSWA 2V3YA 1ZN2A 4AWXB 4RGZ1 1G3WA 1HXDA 1Z91A 1C21A 5ICFA 2CWEA 2XASA 2M1BA 4RGRA 1WBQA 4GYIA 2P7CB 2E1NA 3KEOA 1IN5A 1Q1HA 2NAZA 2BBYA 2FE3A 5HDKA 1KU2A 3F6VA 3T5XA 4I98B 4PGGA 4KMUX 3MWMA 1OYWA 1YQAA 3MX6A 2GU6A 4Z2YA 2HGCA 4G94A 4HW0A 2P99A 5BS6A 5IT9Z 1FBSA 3LWFA 1PUEE 2Q92A 1O3QA 1C24A 2PG4A 5DYMA 4NHJA 1SFXA 2P6TA 4IKSA 2Z33A 3FMRA 2GTXA 3CUQB 2JT1A 3KP5A 1XDSA 1P4XA 1IN8A 3TKYA 3R6SA 1LJ9A 3AAFA 4U0VA 3I4PA 4R1HA 4LLNA 1KP0A 4IVNA 5FD6A 2VBYA 4RB3C 4IKTA 1MJAA 3QU3A 4RAZA 3WG9A 4U75A 2CFXA 4ENNA 4CYDA 1F5TA 2ZO4A 5E18F 2P7VB 1BI2A 3LA3A 3MAJA 2BWXA 4WK8F 2V1DA 1LB2A 1GVJA 2IW2A 1ONVA 3HRTA 4M6XA 4QWQA 5D8LB 3LQRA 5L3BA 1J2XA 3V7RA 2QLZA 3F21A 2Y48A 1REPC 1SD5A 4RGUA 4BHPA 1K78B 4EJVA 2DT5A 2UZKA 4M73A 4HAMA 4ZZDA 3GFIA 2L3DA 4FKCA 2HYGD 4UV9A 2QBYA 2BHCA 1W7PD 4RZYA 1XMAA 5ICCA 3ZQ7A 2Y75A 1RUOA 4HLYA 3DV8A 2Q95A 3QPTA 2XKPA 2GG0A 5H20A 5A2QK 1HKTA 2QYOA 2DW4A 2LKPA 1W5SA 2X0LA 1LVAA 4QLCU 3RVAA 1FP1D 5IT3A 4HV5A 2DBBA 1MKMA 2EV5A 4Y17A 2GG3A 1YS6A 2AXLA 3EETA 1OKRA 2HDCA 3RKWA 1A04A 2RV8A 4R60A 4A0XA 1W7PB 2O8XA 3N4MA 4U70A 1FSHA 2L4AA 4OOIA 5CNXA 3V7SA 3HTSB 2RKHA 4I7HA 4NB5A 3WU0A 2ZNZA 4RAYA 1I27A 2E7XA 1ZAOA 2DPDA 4U0WA 5JR3A 4I09A 4YFNF 3KLOA 2KIUA 3ELKA 4JK1X 2B0LA 2FMYA 4MEXF 2DK8A 2YR2A 2FBKA 1ZRFA 1OYYA 1QXYA 1XGNA 4MQ9F 2OQGA 3WTVC 4L9TA 2IVMA 3PKCA 2Q2EA 3J81Z 2WWYA 4HDVA 1W2MA 4A6WA 2VE8A 1T38A 2XVCA 3R4KA 4ESBA 3FMSA 2CSOA 2F5EA 1IN4A 1G3YA 2HEOA 4AD9A 3TQNA 3CB5A 2V79A 2E7WA 2BEOA 2HQNA 2JZYA 1TQMA 1T98A 2HKOA 3HHGA 3KLNA 1C22A 2H09A 1OYIA 1SD4A 2O61A 5E8GA 1R1VA 2NQ6A 2EK5A 1ZRDA 3C7JA 4ENKA 1J7KA 4JBAA 3VODA 2NNYA 4KIGA 2K27A 4PDKA 1G3SA 3KEQA 2P5KA 4F7ZA 1MATA 4YIFA 2EV6A 4IU6A 4JQFA 3RJPA 1WSUA 4BNCA 4HLXA 3ECHA 2W84A 3B02A 3N97A 1DDNA 2FBHA 1R5GA 2DTRA 1IXCA 2L01A 3IU9A 4U69A 2V3ZA 3F8CA 1WL6A 2A61A 3CB6A 5H6QA 2O03A 3CO7C 4LG0B 1CF7A 2GZWA 4ZH4F 2DK5A 4S2RP 2R7DA 1YG2A 3BDDA 2PI0A 3KP6A 3R0AA 5DCMA 2DQRA 1HSTA 4LB5A 1FNNA 2E1CA 1V4RA 2GZ5A 1JHFA 5CVRA 3J80K 3RORA 2K86A 1FYMA 3WTTC 1A16A 4BAYA 5CVJA 3I59B 2PMUA 3EDPA 1S8NA 2A69F 4KNYA 2ISZA 5DD4A 4XLPF 1QNTA 3WU1B 3H3UA 2W24A 2IP2A 4OMZA 1GHCA 2RVCA 1UCRA 1R36A 1S7AA 3ZMDA 2B3KA 2H6BA 4B8XA 5D8KB 2R3SA 5JHUA 3MR1A 3PFIA 2M30A 5HLHA 3I71A 2VT3A 4XSXF 1LEBA 1U78A 3RYPA 2IA2A 1TBXA 1SFEA 2MH9A 4PV4A 5E20A 2G7HA 4U6EA 1YW7A 3O2PE 5EEHA 2IRFG 1MDMB 4PZJA 1USTA 4KIBA 4B28A 5CYVA 4ZWUA 4P96A 4Q4ZF 4HOBA 4G6DA 2EV0A 2P4WA 3IWFA 3JTHA 1BOAA 2Z5UA 5ICEA 2FNPA 5E17F 1HKSA 4FX0A 4RGSA 1T2KA 1MJ9A 2B3HA 3CUOA 2P8TA 3KP4A 3E5XA 2XROA 3Q9VA 3P9IA 4XLNF 1QZYA 3QRFF 2FRHA 2PBIA 4UXNA 2CG4A 3DPTA 4U1BA 2STWA 4ZZLA 3S6BA 2ISYA 5KK1A 3IU8A 1J0RA 4A6VA 2ADUA 3HSEA 5LGUA 3ABUA 5K5OA 2ACJA 2MD5A 2HOWA 5AONA 4LMYA 3RPQA 1XGSA 2EB7A 1FBQA 1U5TA 1HW1A 1LDJA 2VBWA 1XDUA 1RI7A 1FP2A 5LRSA 5LGTA 3P7NA 2F2EA 1Y0UA 1C0WA 2VC1A 3ROUA 3QOPA 1YLFA 5LHGA 3IC7A 3IRQA 2EFPA 1UB9A 2AS5F 3K1PA 4ASNA 1I1SA 1DPRA 1Z05A 3QAHA 4YFKF 2KRFA 3DXJF 1P4WA 3LA2A 2VXZA 3ZPLA 2D1HA 3QPHA 2Q96A 1HQCA 1R22A 4BH9A 1KQ8A 4MGRA 5ILSA 4P55A 4S00A 3PKAA 4EV0A 3H3ZA 3FMQA 4OIPF 4UVAA 2WC2A 3GFJA 4EQQA 1IRFA 5BPIA 4IRGA 1U3EM 4WF2A 2XKOA 2YPRA 2DAOA 2BV6A 4ETSA 2BWSA 3SZPA 2CW0F 4ZWOA 3ABTA 4U73A 3TOBA 3LFKA 1H0MA 4EM0B 1B9NA 2JPCA 2HTJA 5LRRA 4EJWA 4IF7A 1XSVA 3JAMK 3P9KA 5D6EA 3D27A 2BHBA 3BIPA 4CXFA 1LDDA 1IN7A 4HQEA 3DFGA 3PKEA 3V8LA 3BROA 2GG2A 3E6BA 2PMHA 1MJBA 3F3XA 3NQOA 1LQ1A 2FU4A 2IT0A 2MC3A 5ICGA 2BWWA 3LAPA 1YFHA 2RDPA 4BHBA 1L0OC 1WI9A 3Q5FA 4IKRA 1R58A 4UUVA 1BC8C 1F4KA 1QBJA 3U1DA 4HA8A 2FNAA 4KYWA 2KIMA 3CUQC 3R0JA 3QP5A 5KVRA 1PDNC 2BH3A 4FLKA 2RGVA 2BN7A 2OU2A 3W6JB 2BE5F 5HOOA 2OZUA 1M35A 1BC7C 1F9NA 2ZBKA 2VE9A 2GQQA 5DCMB 1HKQA 4RB0A 3CJNA 1KYZA 5E1XA 1QPMA 4XBFA 5AIQA 3WTSC 2PQ8A 1ZHFA 2ZCWA 4HZFA 2OZ6A 3RKXA 3WE2A 1S7OA 1SMTA 4M74A 5E1ZB 2KKOA 1Z1DA 3BPXA 2Q0OA 4CGZA 4IECA 1GXPA 5D5VB 1D8KA 2D1VA 4DNCA 3MATA 3I53A 4KA4A 2ZMEB 4JUQA 2KJBA 3WGHA 5K1YA 1YS7A 2Z3YA 4CO8A 3GFLA 5L3CA 2XAGA 1ZYRF 2LF8A 2MBFA 5LHHA 4FLLA 3ZN0A 3BY6A 2O6GE 3RYRA 1OMIA 1IRGA 2XIGA 4GYGA 4AVPA 1ZREA 2Y0MA 1I5ZA 3PQJA 3NEUA 1XGMA 2FBIA 4OMYA 3HRMA 2PLYA 4EMSA 3FX3A 2FF4A 3ZMUA 1U8RA 2GAUA 3PQKA 1FYKA 3ECOA 2A6EF 5A2QZ 1S3JA 1FYLA 4TV7A 1HW2A 3ERED 4UHTA 2MLGA 4RB2C 4G7HF 1QXZA 2GG7A 1STZA 4L0YB 3HSRA 2PFBA 5ERIA 1G6NA 2NNNA 5L3GA 2UXNA 3MCZA 1IF1A 3R61A 5BQTA 2EFOA 3T0YA 4ZYDA 3KFWX 3KZYA 2K7LA 1MD0A 5L3EA 4M9ZA 3Q9SA 3VOEA 2H94A 1O7LA 4WXDA 2DPUA 2XV4S 2CQKA 1P2FA 1TLHB 4NQWA 2HWVA 3V7CA 1B9MA 2YSRA 3JSPA 2IJLA 1EH6A 1P6RA 2HKXA 4ZWPA 4HF1A 1FZPB 1D5VA 2VBZA 1TNTA 1FBUA 2H6CA 1YO5C 2HFHA 1BI1A 1ON1A 3SXYA 5CLSA 4MHGA 2OBPA 4A5MA 2DFIA 1IAWA 2JSCA 4LD5A 1XSXA 3TAVA 3QU6A 1QGPA 5LBQA 2STTA 1MZBA 4LK1F 3J7AO 2Z9OA 1ZRCA 5CVIA 5DEQA 1IZ1A 3R60A 1CHMA 4QR8A 2L54A 3IKTA 2A68F 2HOEA 1TNSA 1C23A 4KDPA 1XB4A 2P9AA 1O0XA 4HF0A 3O6BB 3I58A 1UFMA 1XN7A 2BWUA 2JTVA 5BOXA 4G7OF 2MATA 1YYVA 4UVBA 4ESFA 2VOOA 2BWVA 3M8EA 3V4GA 3I5UA 3L09A 2K4BA 4MEYF 5FLXK 3LA7A 4FHTA 4RB1A 5AIPA 2LDUA 4EGYA 3VEPA 4HQMA 1K7AA 5D6FA 1Z7UA 5CJ9A 5K5QA 3EYYA 5ILVA 3WTWC 1BBYA 2MH2A 1JE8A 3I0TA 1LEAA 3ML6A 1NHAA 3G3ZA 3IWZA 2ZKZA 2OA4A 2QQ9A 1EV7A 4EJOA 5L3DA 4MTEA 1DPUA 3I54A 1IXRC 2B3LA 1S6LA 4BXUA 3GEZA 3HTUA 4XSZF 1X3UA 2UWMA 4R79A 2O0YA 3FF5A 4PGHA 1I6XA 3TDUC 1Z6TA 3HYIA 4Q5SF 5E8IA 2VODA 2VONA 1XD7A 2X4HA 2RC4A 3M9AA 4I0AA 1KGSA 5CE6A 5D5WB 1R00A 1G4DA 4D0PA 4L9VA 3WTXC 1SFUA 2GWRA 2M8EA 2C6YA 5LHIA 2CO5A 3GFMA 3BOQA 3E5QA 5L3FA 1EH8A 5F1RA 5CIKA 2GA2A 4XRFA 2VN2A 1SD7A 1KQ9A 4WWCA 3LSTA 3ZMZA 2NYXA 5D4SA 5HS7A 4U6ZA 4P9UA 4O5VA 4U6CA 3SFZA 3MZHA 2IPQX 3REOA 2OQRA 5F64A 1ZG5A 4DQ2A 3SZTA 2FQ3A 3CO6C 4N9HA 4R8HA 3GXOA 1JAWA 5H6RA 2FOKA 4A5NA 4RS8A 1K6OA 3RTRA 1K78A 1H9TA 4IDYA 2NS0A 4ZYHA 4AIHA 5DDGA 3BITA 4GCVA 4HDUA 3F6OA 2GU4A 3ZN1A 3F8NA 1ZLKA 3U9GA 2GIVA 3HUGA 4G6QA 1LNWA 1ULYA 3KP7A 5JI6A 4KM3A 3W6KB 1D3YA 2EVOA 2EA4A 4OIRF 2EFWA 3DKWA 2QBYB 4CICA 4U88A 2H27A 1WQ2A 1ON2A 1L3LA 1YJ3A 1HBXG 1ZG3A 2GG5A 4IXAA 2EFQA 3T8RA 5FB2A 4KICA 3BJOA 4I01A 3FXQA 4WX9A 3HRUA 3ISPA 4GGGA 5HDNA 2W57A 3V8KA 1W7PA 4WCGA 4YG2F 3EUHA 3L9FA 3RIRA 5ILUA 4ZYGA 3BP8A 5CDEA 3F22A 3CLOA 2Q94A 2QQAA 5DUIA 3TB5A 4RGXA 4IPAA 3GW2A 1IXSB 3M7GA 4UNOA 5LGNA 2QWWA 3ULQB 4EM1A 2OD5A 2XGXA 2XUBA 4LGWA 5HVQC 3HIFA 4ON0A 5ED4A 2DO7A 4LJZF 2HTSA 4L9NA 3P9CA 3KZZA 1TW3A 2IA0A 4KIFA 3GVAA 2XAJA 2L4MA 1B1BA 2XRNA 3FM3A 4BHCA 4U7DA 3HSFA 3FHZA 3DF8A 3F8BA 1RIOH 2HR3A 2D2WA 5EEGA 4M71A 4ENJA 3L7WA 3GLXA 4EGZA 2XAHA 3ZMSA 3U2RA 1W7VA 1WRJA 1IN6A 4HXXA 4OIQF 1KYWA 4CZZA 3T1BA 5FFXA 1E17A 2DI3A 1TQIA 4S05A 1AWCA 1RUNA 5J8CA 3TDZC 2K02A 4BQAA 5D5UB 3CDHA 1KU9A 2W25A 2P5VA 2RQPA 3TO9A 2V1UA 1D8JA 4M6YA 4IF4A 3LQQA 5JVTA 5J8FA 1W4MA 2VT2A 4FO7A 2BWTA 3WODF 4HBLA 1B4AA 3L7GA 5BPDA 2FEZA 1ZGAA 4A0YA 2KJCA 3B73A 1GXQA 3C18A 2MA3A 2EWNA 3PKDA 5BMZA 4A6EA 4LLGF 3WTUC 3JAMZ 1UHMA 3OOPA 5FD5A 4L9JA 4HX4A 3DP7A 2WV0A 2VOPA 5IT9K 1AOYA 2ELHA 3E6CC 2QQBA 3GZ5A 3WGIA 1B6AA 2J5OA 1T0FA 1YIOA 4UVCA 1WY2A 4LG0A 1ODDA 1U2WA 4WXHA 5D4RA 1TTYA 3BJ6A 2GGCA 2UXXA 4LK0F 3KCCA 4KUMA 1CF7B 2P5LC 3D0SA 5CDVA 1CGPA 1BI3A 4ESJA 1R23A 1FSEA 4G8XA 3M8FA 3K69A 4E70A 3G73A 3I59A 2DQLA 1W5TA 1WN1A 2Q8KA 1PP7U 4S04A 1Y1NA 5HDGA 2HZTA 1TQPA 3BWGA 4KFCA 2GG9A 4RZZA 4P9FA 2BHDA 1O3TA 3I64A 3H92A 4I0BA 4OOKA 2EVCA 1OR7A 1QO0D 3RI4A 2QZ8A 2QENA 5K5RA 1HSJA 3IL2A 4FX4A 2ZFWA 1Z6RA 2G6PA 2M45A 4S2TP 3TGNA 2Q93A 1MDMA 4LB6B 4Q48A 1J9IA 2M5WA 1EH7A 3MEXA 3HOSA 2NRAC 4GO1A 3GX4X 3IG4A 5TRDA 4AIKA 2GA1A 2DLLA 3K2ZA 2EA2A 3FZVA 3GF2A 2XAFA 2F5CA 3GZ6A 5DV5A 4ENMA 5DD8A 2M87A 2G7UA 1V3FA 4PNCA 2YX7A 1BIBA 1R1TA 2V1XA 3KP2A 2GU5A 1FC3A 3JTGA 1K79A 5CVVA 3KP3A 4H0EA 4YFXF 4EVIA 1YW8A 5FO5A 3GWZA 2OAZA 5FGMA 3PKBA 3HOTA 3VB2A 4L18B 3LAJA 1FPQA 2YX4A 4HYEA 1XMKA 4HV6A 4Q47A 3CTZA 1FWZA 2V3XA 4IJAA 1C27A 1FT9A 4L5JA 4EGEA 3C1DA 1BN5A 3V8JA 4M9XA 2IA1A 2O3FA 1USSA 2BB7A 1U5TB 1U5TC 1YW9A 4EJUA 2BHAA 4LLLA 3D5LA 3DEUA 4Y15A 3J81K 4EJTA 1FY7A 5LLQA 4B09A 1O57A 4A6DA 2ESHA 4U76A 3BPVA 2ESNA 1JHHA 4CDGA 1J59A 5HLGA 4CHUA 3FM5A 3K0LA 2WTEA 1KQ0A 3CTAA 4GXOA 2KIFA 1ZGJA 3K1MA 4M9SA 2EFNA 2COMA 4ZYEA 1QZZA 6PAXA 1Z9CA 3ZP5A 3L2CA 3WGGA 1BM9A 3F8MA 1IUYA 3RKYA 3Q6DA 5HS9A 3FXUA 5HLIA 2ZSGA 4M72A 3E5UA 3MQ0A 4MQVA 3ZMTA 2J5PA 4Z7MA 1MGTA 2CYYA 2Z99A 1KU3A 1PV9A 2BYVE 3F23A 2FXAA 1BIAA 2PEXA 5E5BA 3RPUA 3KE2A 1I1GA 1BI0A 3IU7A 3E6DA 4K2EA 3MFKA 4O6JA 2A07F 2GU7A 2V6CA 4FLIA 2HQRA 4HX7A 2RNJA 2EJRA 2EVMA 4IHSA 1SD6A 1R5HA 1E2XA 2GXBA 1J5YA 2ZNYA 5FLXZ 2BGCA 1SAXA 2QM3A 1P92A 1XCVA 3NRVA 2FMLA 3L00A 3RDIA 2G9WA 4I2OA 4N0BA 2GG8A 4WXCA 2LNBA 3JW4A 3BJAA 4U0YA 4Y13A 3CUQA 1R7JA 2IW5A 3ZMVA 2XHKA 4A2UA 1O7FA 4MTDA 2PN6A 2F5FA 3OV8A 2HS5A 3HHHA 2QUFA 3JSOA 1J75A 3QP6A 2A5YB 1KA8A 2P6SA 1YTYA 3SHFA 4L0ZB 2W85A 3E6MA 1XSDA 4U6JA 5JFRA 3E97A 3MZYA 4A0ZA 2QVOA 1ZG1A 4FUKA 4KN4X 3GYHX 1RZ4A 1YVMA 3J80Z 2VC0A 5CVUA 3GUDA 3C3WA 1DUXC 3L24A 4N9IA 3IKVA 3TOAA 4S01A 1QQIA 3SQNA 2TDXA 1TW2A 3K1NA 3FWEA 2ZMEA 5LEJA 5D5XB 4ZNGA 3EQLF 1ZLJA 5F6FA 1IW7F 4AIJA 1LDKB 1PP8F 5DCFA 1B59A 4OIOF 3VFZA 2CGPA 5FCHA 2BWYA 5TJJA 4MNUA 1O3RA 1UHWA 3BZ6A 4A12A 1U6GA 4FO8A 1QXWA 2K4JA 1HW5A 2A6HF 3TO7A 2GGBA 4I02A 2LSOA 4L5IA 1ZH5A 2GXGA 1BJAA 4KN7X 1VTNC 4HX8A 2ZXJA 4U7BA 1R1UA 3K9TA 3HRSA 1WKMA 2HYFA 1OPCA 3DQVC 3O3KA 4G9YA 4IRHA 2PJPA 1T6SA 1FOKA 2L02A 2JRTA 5FFZA 5J6XA