1XGSA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Aminopeptidase
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
total genus 97
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgsA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgsA01
1BC8C 2JPBA 4KIFA 3RKXA 3SZPA 4HF1A 1S6LA 2A61A 2A6HF 3I71A 1MD0A 1GHCA 3QU3A 2ZBKA 3D5LA 3ISPA 2VC1A 1Z9CA 2RVCA 1P4WA 1JE8A 2Z9OA 2CO5A 4Q5SF 4KIBA 1YIOA 4G94A 1QBJA 2W84A 4FX0A 2WWYA 3TO7A 1J9IA 4HDVA 5D8KB 3WU0A 1TNSA 4IKTA 5D8LB 3IU8A 1D5VA 1YVMA 3F21A 3HTSB 3DKWA 1R5GA 1UB9A 1D8KA 3EYYA 5D6EA 4Z7MA 3K1MA 3WTXC 4WF2A 2R3SA 4MGRA 4HX7A 3LAPA 1KYWA 1J59A 1ZAOA 1HSJA 4MQ9F 1FPQA 1W7PD 3RYRA 4PGGA 2UXXA 1CF7A 2GIVA 1DP7P 2GG7A 4KN4X 2GU6A 2GWRA 1I5ZA 5LEKA 4GO1A 1XSVA 2E7XA 3HSFA 3FXRA 4RAZA 4IRGA 5ED4A 5HLHA 1FX7A 1R1VA 4YG2F 4CGZA 1XCBA 5JR3A 4LMYA 4KM3A 4L9TA 3FMSA 4CXFA 3FXQA 1KU3A 3WGGA 1TQPA 2HKXA 3ML6A 4ZH4F 5ICCA 4S2TP 2V1DA 1B4AA 2B3LA 2VT2A 4CDGA 1J7KA 2L54A 4WWCA 5F6FA 4A12A 3ZPLA 2HOEA 3ABUA 4FT8A 3TGNA 5L3GA 1PP7U 4A0YA 1QXZA 4MTEA 2WV0A 2QQAA 1MKMA 3NEUA 2GU4A 4A0XA 2EVMA 5FGMA 4U6JA 5E1WA 2BE5F 2O6GE 2EFPA 1IXRC 3PQKA 4M74A 3T5XA 2Z33A 3HSEA 3J7AO 2KIMA 4HZFA 2BWXA 2GAUA 5HS7A 5CDVA 1REPC 1ON1A 3HYIA 3HUGA 3BPXA 1XGNA 2OD5A 5CVJA 2ELHA 1XGOA 2NYXA 3GO5A 4CO8A 1O7FA 5CVRA 5LLQA 3T0YA 5D5WB 2OQGA 1FLIA 5DD8A 4U0VA 4IF4A 1WKMA 2QUFA 4CZZA 3JSOA 1IXSB 4PV4A 2RGVA 4ZYDA 3I0TA 3KP5A 1WLRA 1EV7A 2DLLA 5E8IA 5HVQC 4U6EA 2HQRA 2HDCA 4AIKA 2GG2A 1FYMA 3GFJA 1EH6A 3SXYA 3CLOA 3D0SA 1HW5A 3W6KB 1U5TA 1B1BA 3ZMVA 5JFRA 2V79A 1S29A 1Z6TA 1HSTA 1YTYA 1PV9A 5ERIA 3V4GA 2QZ8A 4HQEA 5ICFA 1J75A 2KKOA 5AIPA 3RPQA 5IT9Z 5BMZA 4WX9A 2BN7A 3SFZA 3ROUA 5H6RA 2RN7A 3MATA 1Z05A 2QQBA 5ICEA 2OU2A 5FLXZ 5DYMA 1TQMA 5DCMB 4K2EA 2EVCA 4G6DA 5K1YA 5TRDA 2X4HA 1OYYA 4HXXA 3HHGA 1XNZA 1LQ1A 3WTZA 1IRGA 2AS5F 1PDNC 1F5TA 2GG5A 2CW0F 5HDKA 2MD5A 2KIUA 1QNTA 5FLXK 1HKSA 1OYWA 1IUYA 4MEYF 1Z6RA 1USTA 1EH8A 4UHTA 1C22A 4CYDA 2E1NA 3E97A 2XGXA 5JI6A 1XMAA 5DD4A 4I02A 4L9VA 1U5TC 2Y0MA 3E5UA 1YS7A 2FMLA 4FUKA 3ELKA 3GLXA 1YLFA 3F8MA 3F8CA 4U6WA 1B6AA 4N0BA 4S04A 4FO8A 3RKYA 2GG9A 4L18B 1MDMA 3GXOA 3S2WA 2JRTA 3KZZA 1BIBA 2MLGA 2IW5A 1I27A 3DPTA 3V7RA 2V1UA 2BWVA 3DF8A 2Q96A 4IF7A 2VBZA 4YIIA 3Q6DA 4NQWA 2RNJA 2EA2A 1NHAA 4ENKA 2BWSA 4LG0B 1JGSA 2Q92A 1DPUA 3HSRA 3MX6A 1W7PA 2G7HA 2J5PA 2FMYA 5J8FA 4EQQA 2JSCA 3WTTC 3E6CC 4FLJA 2F5EA 2DPDA 4HYEA 1T0FA 2JZYA 1W2MA 2BHDA 4M9XA 2ZMEA 3FMRA 1P92A 2Y48A 2A07F 3RYPA 4L9JA 1IN6A 1S7AA 2LNBA 1V3FA 4LB6B 2NRAC 2EFNA 3WTVC 5E1ZB 4KA4A 2BWUA 4IRIA 3P9CA 1LEAA 1P4XA 1FP1D 1RIOH 2GGCA 5KK1A 2P5LC 2Q93A 2RDPA 4EM1A 1R22A 3CUOA 5HOOA 5D5VB 5D4RA 4RGRA 1G3SA 3HOSA 2GG8A 3N4MA 4XSZF 4YIFA 3TQNA 2K27A 2ZJ2A 3I4PA 5CIKA 3NRVA 4LJZF 3JTGA 2WTEA 4PCQA 2ZFWA 2QBYB 1MJ9A 2A6EF 1R5HA 5LBQA 4ZWOA 4ZZLA 5D4SA 3J81Z 3V8JA 1FBUA 1UFMA 3L00A 4EGYA 3PKCA 1ZG5A 1BJAA 5FB2A 4L0ZB 3TOBA 3DEUA 5CYVA 3OV8A 1FP2A 3M7GA 3WODF 5K5QA 4CHUA 3JAMK 3HHHA 4F7ZA 4M9ZA 1TLHB 3QOPA 4G7OF 3E5QA 3J81K 4S2RP 2H6BA 1ONVA 2EFQA 3QAHA 5CLSA 3M8FA 2Z5UA 3GUDA 3N97A 3WE3A 5FO5A 2BGCA 4YFNF 1MJBA 4FLLA 4XLPF 3EQLF 2HS5A 3GFIA 3V8KA 1ZRDA 2NNNA 2ZKZA 5DUIA 2M45A 2XV4S 3MCZA 3MZYA 2A3SA 5LRSA 3OOPA 2UXNA 3IRRA 1R1UA 5E1XA 3E6BA 3ZQ7A 5L3DA 3T1BA 4U6CA 3U9GA 4NHJA 3E6MA 5J8CA 2GXBA 4IXAA 2X0LA 4M73A 1K6OA 3K1PA 1AOYA 4A6WA 1QXYA 1P6RA 4U69A 1G3YA 2FE3A 3R61A 2HTJA 3KP6A 2O61A 1D3YA 3CJNA 2L4MA 2XKPA 3IWFA 5F1RA 4OINF 1FSHA 1TQIA 1R36A 2DK5A 4RAYA 1H9TA 4ESJA 3C1DA 1GXQA 1OPCA 1BI0A 1ZRCA 2D1HA 1KQ8A 4FLIA 1YG2A 2DBBA 2VN2A 5HS8A 3GVAA 3I5UA 2XUBA 4LD5A 1YW8A 3CO7C 3TKYA 2VBWA 2XHKA 4DQ2A 3L24A 4IVNA 5LGNA 1F1ZA 2BH3A 1LJ9A 1QGPA 3R0AA 3FXUA 4HDUA 2P7VB 3L09A 4A2UA 5E18F 2O8XA 4G8XA 2M30A 4HQMA 2P99A 2DAOA 1SD6A 2V9VA 3Q5FA 2ESNA 4ZYGA 3EUHA 2NQ6A 2DU9A 5DEQA 2HWVA 1TW3A 4IECA 2VT3A 1IN4A 4BHBA 1FBSA 2HTSA 3LA7A 3WTSC 3PFIA 4YFXF 1W4MA 1Y0UA 5FD6A 1KGSA 4RB3C 5J6XA 1HQCA 1WI9A 4UVAA 1XD7A 2RC4A 2GU5A 2OKNA 5LGUA 1E2XA 4U7DA 3BJOA 2BB7A 2K4JA 4EMSA 5LEJA 1QQIA 3D27A 4RZYA 2KJBA 5LHHA 2NAZA 3KEQA 1SMYF 4IU6A 4A0ZA 1PUEE 1EH7A 4OOKA 3PKEA 2HKOA 2IJLA 5H6QA 5LHIA 1O7LA 3KLOA 2FBIA 3H3UA 3ZP5A 1OYIA 3M1EA 1R23A 4N9IA 1BOAA 3I54A 4JQFA 2ISZA 2P5KA 1O3SA 2M8EA 4RS8A 5IT3A 4ZNGA 1JAWA 2F2EA 5CVIA 3QPHA 2ADUA 1BI2A 2FA5A 4B28A 3K9TA 3BP8A 1ZH5A 2FF4A 2R7FA 1ZHFA 4BNCA 4I01A 1C21A 2GA1A 4ON0A 1B59A 1J2XA 1T2KA 4Q4ZF 4HV5A 1ZN2A 2NNYA 2EFOA 5HLGA 2MLKA 2K02A 2MC3A 2Z99A 3ECOA 4I0AA 2Z3YA 2QVOA 3F6OA 3CUQB 1KP0A 4A5NA 1SFUA 3KP7A 1P4AA 4P96A 5DUKA 4Z2YA 2IP2A 2F5DA 4ENNA 2CFXA 3CO6C 2HQNA 2GG0A 5DCFA 2D45A 3KP2A 1ZYRF 5BPIA 4HX8A 3I64A 3P9KA 4WXCA 3EYIA 4EGEA 5FD5A 4HX4A 2H27A 3O2PE 3HOTA 4A6VA 4ZYEA 4EJWA 3JW4A 1SMTA 1YO5C 3JTHA 4MEXF 3HRUA 2DPUA 3GZ5A 3ZMSA 1RUNA 5L3FA 3G73A 1ZLJA 4B09A 4EJOA 4MNUA 5DCMA 2IA1A 3J80Z 1I6XA 4JK1X 4LGWA 2IW2A 2CYYA 3F6VA 1U78A 2QQ9A 1XSXA 4R60A 1Z7UA 4RB0A 1O0XA 1OKRA 3M9AA 1HW2A 3WGIA 2K4BA 2VXZA 3QP5A 4RGXA 2LSOA 4DNCA 2M87A 4RGZ1 2FXAA 4OU0A 4FHTA 3K69A 3J80K 4IPAA 1VTNC 4IHTA 4FKCA 2ZXJA 2DO7A 1RZ4A 1TNTA 3IRQA 1FY7A 3WTUC 3GF2A 2BHCA 2Q8KA 1XGMA 2YPRA 2M1BA 3V7SA 1UCRA 1U3EM 1C27A 5HDNA 3HRMA 4MTDA 4BH9A 1A16A 2GGBA 1W5SA 2DW4A 4OIOF 4HF0A 2XAHA 3QU6A 4BAYA 2V3YA 2G9WA 2QM3A 3COAC 1C23A 3Q9VA 1STZA 3G3ZA 1MDMB 1Q1HA 1L3LA 3PQJA 2LKPA 4U73A 3KP3A 2QYOA 2MH9A 3RVAA 4L0YB 4P9FA 3P9IA 1LDKB 2Y75A 1K78B 1T98A 2FEZA 3TO6A 2C6YA 1LB2A 4QR8A 4LG0A 3VEPA 4AD9A 3ZN0A 4KFCA 2F5FA 2BV6A 4G6QA 3SZTA 4QLCU 3PKAA 1H0MA 4U7BA 1USSA 2MH2A 4IKRA 2PLYA 2HR3A 1H9GA 3VOEA 5L3BA 3BJAA 4S00A 3GW2A 3KCCA 4N9HA 3RPUA 1ZG1A 2HFHA 2BBYA 1W7VA 5D5UB 4BXUA 5ILUA 1J0RA 2EVOA 2FNAA 3F22A 1RNLA 4EM2A 3LFKA 2ZMEB 1A04A 1WL9A 4G7HF 1ZRFA 1ZREA 1R00A 4ASNA 1FYLA 5E20A 2DK8A 2JPCA 4KMFA 1FBQA 2VBXA 2VE8A 3GX4X 2FU4A 4E70A 6PAXA 2TDXA 5FCFA 2HZTA 1KYZA 3ZMUA 3HTUA 2IRFG 1IZ1A 1C24A 3E3VA 3P7NA 5CNXA 3SHFA 1BM9A 4I0BA 1W5TA 2VOPA 1N51A 4S05A 3REOA 2QBYA 2GXGA 2EFWA 4U0YA 3JAMZ 2JT1A 3R6SA 1K7AA 2KJCA 2IA2A 4KDPA 4Q47A 2BWYA 4UNOA 3FX3A 2HEOA 2ESHA 3FF5A 4R8HA 5LGTA 2KIFA 2VODA 4KUMA 4MATA 2VOOA 1WY2A 3CB6A 2MATA 4HLYA 3F8BA 3CB5A 2GA2A 1WRJA 2P9AA 2A69F 1SFXA 1BC7C 3I59B 3RKWA 4Q48A 4GCVA 4I2OA 1FYKA 3WG9A 3RORA 1JHHA 1MJAA 4OMYA 2V1XA 4PZJA 4IJAA 3FM3A 3TDZC 3LA2A 2L02A 3ECHA 1HBXG 3C7JA 2IVMA 1BBYA 2E1CA 3TO9A 3F23A 2OZUA 1G6NA 3LA3A 1BI3A 4MHGA 3KP4A 2OAZA 3IL2A 2FQ3A 3F8NA 1S7OA 1Z91A 1LDJA 5ILSA 4P5OA 2H94A 4KNYA 2XAGA 2XROA 2L3DA 4U76A 3GWZA 4KT5C 2FOKA 4LFUA 4JBAA 1WN1A 4KIGA 4L9NA 1YW9A 4P9UA 5DDGA 4R1HA 4ESFA 4I09A 4HF2A 2EJRA 3TDUC 3EDPA 2XAFA 5E17F 4U0WA 5BQTA 4AIJA 2P4WA 4EJUA 2GTXA 2NS0A 2LDUA 2XKOA 3BY6A 2BWTA 2PI0A 4WXDA 4A6EA 2PBIA 1SD7A 1TW2A 4LK0F 4U71A 4O3MA 2DFIA 3ZMZA 4BHPA 1IN7A 5ICGA 3ZN1A 3GEZA 3U2RA 1R7JA 3QP6A 2GG3A 1ULYA 4EVIA 4U1BA 3MQ0A 1BI1A 2CWEA 2GQQA 2XRNA 1LDDA 2QWWA 1IN8A 3BWGA 4IKSA 2PMHA 3VODA 3GYHX 2VBYA 3ABTA 2PG4A 1XGSA 4M9SA 3K2ZA 1YW7A 3C18A 2EWNA 2HOWA 1G3WA 3I53A 3RDIA 3KEOA 3BITA 4IRHA 3WE2A 1HXDA 5KVRA 4HLXA 1QXWA 5EEGA 2W85A 1U8RA 2FRHA 1S3JA 4OOIA 1WWXA 1CHMA 1XB4A 4ZWUA 1T38A 1IN5A 4Y17A 4OIQF 2B3HA 3DFGA 2PQ8A 5DV5A 3ZMDA 3MEXA 3DV8A 1CF7B 3LQRA 3WTYC 2J5OA 3NQOA 4EJTA 3MAJA 3H92A 2UWMA 4P55A 3ULQB 3BDDA 3TB5A 4UV9A 2JTVA 3ERED 2RV8A 2ZNZA 1G4DA 1O3QA 2Q95A 3IC7A 4MQVA 3LSTA 2GU7A 1O3RA 1IXCA 2DQLA 2YU3A 3K0LA 3KZYA 5F64A 1RUOA 2UZKA 1X3UA 3AAFA 1F4KA 4XRFA 3IKTA 4LK1F 5E8GA 1ZGAA 2STTA 4BYYA 3KE2A 2R7DA 2CGPA 1B9MA 1TBXA 1YS6A 5H20A 3ZMTA 4L5IA 3E6DA 3R4KA 4HAMA 2B3KA 5FCHA 1KU2A 2EA4A 1YJ3A 4GGGA 5AIQA 2HYGD 4BHCA 1U6GA 5BS6A 3LWFA 3BJ6A 2DQRA 4EGZA 5K5RA 4U6ZA 1BIAA 1LVAA 4FLKA 3RJPA 1LEBA 1FSEA 2D1VA 3CTAA 3HIFA 3VFZA 2ZCWA 1O57A 3IU9A 1SAXA 4OMZA 3KETA 1WBQA 2P6TA 2IA0A 3F3XA 1FZPB 2HYFA 3GZ6A 3WGHA 5CDEA 5CVVA 2ETHA 4BQAA 1ODDA 2V6CA 1KU7A 1IF1A 2XASA 4WCGA 2H09A 2Q94A 1UHWA 1JHFA 1F9NA 2PN6A 3IKVA 4FX4A 2XAJA 5TJJA 1ZLKA 3K1NA 2ISYA 3CUQA 2W57A 1FOKA 1XCVA 4ESBA 4HBLA 4I98B 4ENMA 3I58A 3T8RA 5D5XB 1IW7F 4WK8F 1BN5A 4IKUA 4XBFA 4KMUX 3BZ6A 5E5BA 1FWZA 1FC3A 3F8FA 4EM0B 3S6BA 2MA3A 2EK5A 3E5XA 4UXNA 1GXPA 3QRFF 2D2WA 2O0YA 2GZ5A 1U5TB 4ENJA 3PKDA 3LAJA 2ZSGA 1MGTA 3FMQA 2CQKA 4IDYA 2ZNYA 4EV0A 1SFEA 4GYGA 4RZZA 3TOAA 2EV6A 5L3CA 2DT5A 4OIPF 3TAVA 4RGSA 1E17A 4O5VA 2PMUA 1XDUA 2P6SA 1IAWA 1HKTA 1KA8A 4A5MA 2P5VA 2W25A 1OMIA 1L0OC 1QPMA 4M72A 4M6YA 2ZO4A 3PKBA 1XMKA 5JHUA 3WU1B 2BWWA 2PEXA 1RI7A 3FZVA 4NB5A 4YFKF 1XDSA 2G6PA 1QO0D 2L4AA 3GFMA 4O6JA 3BOQA 3BIPA 4Y13A 2P7CB 2P98A 3L9FA 3CUQC 5K5OA 1DDNA 3HRSA 5IT9K 1D8JA 5FFXA 2FBKA 4HOBA 5HS9A 2FBHA 2PJPA 1YQAA 1ZARA 3L7GA 4G9YA 1U2WA 4LLLA 3IG4A 1B9NA 3MR1A 4JUQA 4S01A 1I1GA 4U88A 5AONA 2O03A 2V3ZA 2DI3A 5HLIA 2OBPA 2BHAA 4QWQA 2BYVE 5A2QZ 3DPLC 1Z1DA 1I1SA 2O3FA 1YYVA 4UUVA 4WXHA 4HV6A 1MZBA 1OR7A 4KICA 3DXJF 1AWCA 1MATA 3B73A 2M5WA 3BPVA 1M35A 3GFLA 1QZZA 2PFBA 3BROA 1CGPA 4U70A 1T39A 2EV0A 2V3XA 2YSRA 2KRFA 2YR2A 2RQPA 5A2QK 1K78A 3L7WA 1WSUA 4OIRF 4TV7A 4PNCA 4XLNF 3EETA 1SD5A 5CE6A 4L5JA 5HDGA 4UV8A 3F72A 3KFWX 1W7PB 3DQVC 2E7WA 3L2CA 2OZ6A 1ZGJA 1P2FA 5FFZA 2BHBA 4Y15A 4FO7A 2YX7A 1SD4A 4AWXB 4GYIA 1V4RA 3R0JA 2IT0A 1JXSA 4ZWPA 5BPDA 2A68F 3LQQA 2H6CA 2VONA 3RTRA 2COMA 4HA8A 2OQRA 1LNWA 1G3TA 2MBFA 2CG4A 4HW0A 1XN7A 2K86A 3FHZA 1TTYA 1R58A 1WL6A 1ON2A 4ZZDA 2HGCA 2GZWA 2P8TA 1IRFA 1KU9A 3WTWC 3O3KA 4G7ZF 1T6SA 2NQ7A 3W6JB 3M8EA 5JVTA 3FM5A 2QLZA 4CICA 5L3EA 2Q2EA 2Q0OA 3HRTA 3V8LA 1O3TA 5CVUA 4LLNA 4A6DA 5LRRA 2XIGA 4XSXF 5BOXA 5EEHA 3IU7A 4LB5A 2LF7A 4KYWA 5CJ9A 4PGHA 2BEOA 2OA4A 1ZG3A 1QZYA 2A5YB 3FWEA 2B0LA 4ZYHA 3IHUA 3I59A 3Q9SA 5CDLA 4ETSA 1Y1NA 3IWZA 2LF8A 1K79A 2WC2A 1C0WA 4D0PA 3C3WA 4M6XA 3CTZA 1HKQA 1YFHA 5LHGA 3MFKA 1FNNA 1KQ0A 4KN7X 1GVJA 3JSPA 4AVPA 3BIQA 1PP8F 2QENA 1WQ2A 3KLNA 5D6FA 2EB7A 1UHMA 4UVBA 3U1DA 1FT9A 3MWMA 2FSWA 2AXLA 3QPTA 2FNPA 4AIHA 3B02A 1R1TA 4GXOA 2EV5A 4PDKA 2W24A 2YX4A 1KQ9A 4M71A 2XAQA 3RI4A 3V7CA 4I7HA 2VC0A 1J5YA 4UVCA 1DPRA 3MZHA 1HW1A 2L01A 3SQNA 2K7LA 3T8TA 3R60A 2ACJA 2DTRA 2IPQX 3VB2A 3CDHA 4B8XA 4RGUA 5ILVA 2RKHA 4EJVA 4RB1A 2F5CA 1S8NA 1XSDA 3DP7A 4RB2C 4H0EA 3H3ZA 1DUXC 4IHSA 4R79A 2VE9A 4U75A 2XVCA 4LLGF 3O6BB 3RIRA 2CSOA 2G7UA 2STWA
chains in the Genus database with same CATH superfamily
3M1CA 1BC8C 2JPBA 2M9HA 3BT9A 4KIFA 3RKXA 3SZPA 2VLAA 4Y4RA 4PFPA 4E6KG 4HF1A 1S6LA 2A61A 2A6HF 3I71A 1MD0A 4X1EA 1GHCA 3QU3A 2ZBKA 2L7FP 3D5LA 1FIPA 3ISPA 3S16J 1J09A 2VC1A 1Z9CA 2RVCA 1RETA 1XMXA 3C2GA 2F4OB 3QPLA 3DEEA 1P4WA 2IS4A 3ABKH 1V55H 1JE8A 2Z16A 2Z9OA 2CO5A 2WY7Q 5TISC 4Q5SF 2DJNA 4KIBA 3M07A 1YIOA 3AL0B 4G94A 2VASA 1QBJA 2W84A 4FX0A 2WWYA 3G71I 4RLQA 2K3PA 3TO7A 1J9IA 4HDVA 1JI8A 5D8KB 3WU0A 4J00A 1VQ7I 3LSGA 4S0HB 1TNSA 4IKTA 5D8LB 3IU8A 3ZRGA 1ERDA 1D5VA 1YVMA 3F21A 3HTSB 3FKIJ 1SFKA 3DKWA 5LD2C 1R5GA 1UB9A 4JYKA 4XLEA 1D8KA 2R7ZJ 3ZOBA 3EYYA 2E1OA 5D6EA 4C30A 4FE7A 2W1OA 4Z7MA 3K1MA 3WTXC 2BHYA 4WF2A 2R3SA 4MGRA 5IP9J 5CQGA 4HX7A 3BG6A 3LAPA 3AFHA 3BTJA 1UG0A 2LBFA 5IYBJ 3Q0UA 4PUSA 1KYWA 1J59A 3CMYA 1VQLI 1ZAOA 2KLOA 1HSJA 4MQ9F 4C3HJ 1UMQA 3SJMA 3CQZJ 1FPQA 2ZJQF 2VKHA 3LSIA 1W7PD 1RR7A 3RYRA 4PGGA 3HZJA 2EINH 2UXXA 1MMAA 1CF7A 2GIVA 1T08B 1DP7P 4AU7A 2GG7A 4KN4X 2GU6A 3WG7H 2GWRA 5IYDJ 1I5ZA 4G12A 5LEKA 4GO1A 1XSVA 2E7XA 3HSFA 3FXRA 4RAZA 4IRGA 5ED4A 5HLHA 1FX7A 2WAEA 1R1VA 4YG2F 1AKHA 4CGZA 1XCBA 5JR3A 4LMYA 4KM3A 4L9TA 3BTLA 3FMSA 2K85A 4CXFA 3FXQA 3HPHA 3G1OA 4B1RA 1KU3A 1X4PA 3WGGA 1JKOC 2R5ZB 1TQPA 2HKXA 1A6IA 3ML6A 4ZH4F 5ICCA 4S2TP 2JA7J 3WHCA 2V1DA 1WJCA 1B4AA 2B3LA 1Y6IA 1A36A 2DFEA 2VT2A 4CDGA 1J7KA 4N4NB 2L54A 4WWCA 2ZXWH 5F6FA 1MNDA 1E3HA 1VQ5I 1WJFA 5GP9A 4A12A 3ZPLA 2HOEA 1LFUP 3ABUA 2VUMJ 3E0JB 2BZTA 3NWSA 4FT8A 1YI2I 3TGNA 1X1AA 5L3GA 3AG1H 4E7SA 1YIJI 3PUBA 2BW3B 1GV2A 3RSNA 1PP7U 4A0YA 2L5QA 4UB8C 1QXZA 3S17J 4MTEA 2WV0A 2QQAA 5EGOB 3MKWB 1MKMA 1LKXA 3NEUA 2GU4A 1LFPA 2R5YA 4A0XA 2K5CA 2MABA 2QKMB 3QQAA 4XRMA 2EVMA 5FGMA 3PSFA 4U6JA 5E1WA 2XGCA 2EZLA 5K7HA 1T95A 2KZVA 3OL4A 2BE5F 4BKXA 1D5YA 3TBIA 2XRLA 4XQFA 2O6GE 3DKYA 2OUMA 2EFPA 1IXRC 5EYRA 1ORKA 2RREA 1QRYA 1OJLA 5IPAA 3PQKA 4M74A 3T5XA 2Z33A 3HSEA 3J7AO 2XC7A 1MIJA 3S8PA 2KIMA 4LIUA 4HZFA 2BWXA 2GAUA 4W1UA 3HOUJ 5HS7A 4CCJA 3HKZA 5CDVA 1REPC 1ON1A 3HYIA 2IGMA 4UUSA 4G6TB 4XOPA 4IO9F 4DBRA 3HUGA 3BPXA 1PUFA 1QVUA 2E36A 2HDWA 4D5FA 1XGNA 2OD5A 4QIWN 5CVJA 2ELHA 2LMDA 4MLOA 1Z7LA 3HL2A 1XGOA 1RR8C 2D5VA 3H35A 3L2RA 4ZTFA 4X6AJ 2NYXA 3GO5A 4CO8A 1O7FA 5CVRA 2EIMH 5LLQA 5FLMJ 1FIAA 1AU7A 3T0YA 3QYBA 2Z1DA 2NOJB 5D5WB 1RC9A 4BQNA 4F3QA 2JQ7A 2OQGA 1FLIA 5DD8A 1FTTA 3MN2A 4ZDOA 4U0VA 3ZCOA 4IF4A 1WKMA 1LFBA 2E34A 2QUFA 3JRHA 4CZZA 1IO2A 1JUMA 3JSOA 1IXSB 4B44A 4AUXA 2HYJA 3KX2A 4PV4A 2RGVA 4ZYDA 4PJJA 3I0TA 3KP5A 1IV8A 3I4NJ 3FXMA 1WLRA 1EV7A 2DLLA 5E8IA 4CCKA 5HVQC 2ID6A 4U6EA 2HQRA 2HDCA 3ONQA 4AIKA 2GG2A 3ZQIA 1FYMA 4HRIA 1ETYA 1F36A 1GVDA 3GFJA 1EH6A 3SXYA 3CLOA 3D0SA 1HW5A 3U21A 3W6KB 1U5TA 1B1BA 4BDYA 3EPZA 3ZMVA 5JFRA 4C2UA 2V79A 2QEXI 3JRIA 1IG7A 2E5NA 5CKTA 3ZQLA 3BQYA 1S29A 1Z6TA 1HSTA 2HZDA 2WA0A 1YTYA 1PV9A 5ERIA 3SEZA 3V4GA 2QZ8A 3LSMA 4HQEA 5ICFA 3M3YJ 2HDDA 2HPIA 4ZDPA 2KKOA 1J75A 5H2FC 5AIPA 3RPQA 5IT9Z 2DT6A 4DBQA 5BMZA 3OYBA 2JA8J 2NS8A 5E3OA 4WX9A 1X4OA 3LL7A 2BN7A 3SFZA 1Q1VA 1POGA 4XNFA 2VI6A 2LREA 4ITVA 3ROUA 3PO2J 4QPOA 5H6RA 2RN7A 3A0HC 1ETWA 3MATA 1Z05A 3OIOA 2QQBA 5ICEA 1BA5A 2DDBA 2OU2A 5FLXZ 5DYMA 1TQMA 5DCMB 4K2EA 2EVCA 1S72I 1MMGA 4G6DA 2MSYA 4M3BA 5K1YA 5TRDA 2H1KA 1YRNA 2ELJA 2QSGX 3CC4I 3CCYA 2XSJC 2XGEA 2X4HA 1OYYA 2F48A 3HKZN 4HXXA 3HHGA 2F4IA 2KPMA 3H5AA 3MMYB 1CQTA 1NK3P 1XNZA 5M5WJ 1LQ1A 1ZTRA 4RM2A 3WTZA 2HVRA 3FXKA 5FKMA 5M5XJ 3S1QJ 1IRGA 2AS5F 1PDNC 1VQ8I 1I3AA 1F5TA 2GG5A 1HCRA 2CW0F 1PYVA 5HDKA 2MD5A 4CCOA 3A2KA 2KIUA 2OV7A 1QNTA 3RZDJ 3OMYA 1HKSA 5FLXK 5EEAA 3OYAA 4N4OB 1OYWA 1IUYA 2DTZA 4MEYF 1Z6RA 4U87A 1BW5A 1USTA 3G2BA 1Y1WJ 1EH8A 2AHQA 4UHTA 1C22A 4CYDA 2XPVA 2E1NA 4BE0A 1D0ZA 3E97A 1JKRC 2XGXA 5JI6A 3JRGA 3IV5A 2EBIA 1XMAA 2E1MB 3HGYA 4HEA2 2EIKH 4XORA 5DD4A 5HODA 4I02A 3OL3A 1MBGA 4XRSG 5IY5H 3I56I 4DOZA 4XIDA 4L9VA 1U5TC 2Y0MA 3E5UA 3A01A 1NK2P 1YS7A 4C3JJ 2Q1ZB 2L9VA 5J1YA 2K9NA 2FMLA 3S1NJ 2L9SA 4FUKA 4FTHA 3ELKA 3GLXA 2JA5J 1YLFA 3F8MA 3F8CA 2CQNA 4CYCA 1K61A 2DA2A 2VJJA 1YX3A 1AHDP 1TL8A 4U6WA 1B6AA 2H8WA 4N0BA 4S04A 4FO8A 3RKYA 2GG9A 5EG0B 4L18B 3IAS2 3IH4A 1MDMA 2R93J 2LRDA 3GXOA 3S2WA 2JRTA 1VQ4I 3KZZA 1BIBA 4CUGA 2MLGA 3CCJI 2IW5A 1I27A 3DPTA 3V7RA 5LFAA 2V1UA 2BWVA 2KRCA 3DF8A 4JX5A 2VBZA 3GTQJ 2Q96A 4IF7A 4YIIA 2IGKA 3I4MJ 3Q6DA 3QPSA 4NQWA 2RNJA 2EA2A 1NHAA 1WGXA 4ENKA 1OCTC 2BWSA 3CMMA 4OAYA 1Y8RB 1BW6A 4LG0B 1JGSA 2BY3A 3MKZA 2Q92A 2BOLA 1NTCA 4A3LJ 1DPUA 2TCTA 3HSRA 3MX6A 1W7PA 2LY2A 1N78A 2M7BA 2O5RA 3TW7A 2G7HA 2J5PA 2B63J 2L9NA 3PNVA 3UR3C 2DMTA 1B8IA 3G6EI 2FMYA 5J8FA 3SEQA 4EQQA 3G4SI 2JSCA 1JKQC 5J40A 5M3MJ 4GDFA 4RA2A 3WTTC 4XKVA 3E6CC 3JRAA 4HSTA 4FLJA 2F5EA 1P7JA 2DPDA 4HYEA 5M5YJ 1T0FA 2DODA 2JZYA 1W2MA 4A3IJ 2BHDA 2X6WA 4M6VA 4M9XA 2ZMEA 3FMRA 1P92A 2Y48A 2A07F 3RYPA 4L9JA 1IN6A 1S7AA 2LNBA 1V3FA 4PJNA 2O7OA 2R0QC 2R7UA 4LB6B 2LTPA 2NRAC 5B5EC 2EFNA 3WTVC 4A3DJ 4PJLA 1TZLA 5E1ZB 3VDXA 4KA4A 2BWUA 4IRIA 3P9CA 5EJCA 1LEAA 5F04A 1EF4A 1D0YA 1P4XA 4CSWA 1FP1D 1RIOH 2GGCA 2VKDA 5KK1A 2P5LC 2Q93A 2RDPA 3DU5A 4A3CJ 1HC8A 2COBA 3CD6I 4EM1A 4PSWA 1R22A 3CUOA 5HOOA 2N8GA 3BTIA 1UZCA 2MFZA 5D5VB 5D4RA 2BVLA 4RGRA 3LMMA 1G3SA 3HOSA 2GG8A 3N4MA 3LSRA 1DQUA 2X9DA 2VQLA 4XSZF 4YIFA 1JT0A 5J3LA 3TQNA 5F27A 2K27A 3MD2A 3OYGA 2ZJ2A 2EZIA 2UUZA 1O4XA 3I4PA 2L7MP 3H9JA 1PVEA 4OWRB 3CCQI 5CIKA 3NRVA 3IH2A 4LJZF 4RAGA 3GZNB 1VQ6I 1TT0A 3JTGA 4A3EJ 1VZ0A 2F5VA 2WTEA 1QHGA 1WHUA 2ZFWA 4PCQA 2QBYB 4KJZA 1MJ9A 3AKZA 2VPRA 2A6EF 2L7KA 3FK7A 2KISA 3BCAA 1R5HA 1YITI 3VWBA 4ANJA 3UKGA 5LBQA 2VKVA 4ZWOA 1Z21A 2PJRB 4ZZLA 1B72B 1PJRA 5D4SA 3J81Z 3V8JA 2KT0A 1FBUA 1UFMA 3L00A 4EGYA 3BTCA 1T0FC 2O8KA 3PM1A 3PKCA 1ZG5A 2CRGA 4E4HA 2FOWA 2ZMEC 1BJAA 4BY7J 1Y56A 5FB2A 4L0ZB 3TOBA 2HOTA 2GLOA 3DEUA 1ETKA 5CYVA 3OV8A 1IDYA 2VKEA 1FP2A 4OAZA 2F4MB 3M7GA 3WODF 1D1CA 5K5QA 4CHUA 3JAMK 4XICA 3NWTA 3HHHA 4A3GJ 4F7ZA 4M9ZA 4IOCF 2ZB9A 1MNEA 3B6AA 3K7AJ 1HLVA 1TLHB 3QOPA 4XL9A 1OLTA 1A5JA 4G7OF 3E5QA 3AG3H 3J81K 4S2RP 2H6BA 1ONVA 2EFQA 2AQEA 3QAHA 1VNDA 5CLSA 3M8FA 3Q0VA 4X0GA 2Z5UA 3S2DJ 3GUDA 3N97A 3IAM2 3WE3A 1GUUA 2XB5A 2V9KA 3S93A 1JUPA 2BGCA 3ASNH 2EILH 5FO5A 4YFNF 3LNQA 1MJBA 1R9TJ 4FLLA 1NG7A 4XLPF 3EQLF 2HS5A 3GFIA 1Z3YA 2WADA 4IL6C 3BR0A 5KAFC 3JRBA 2HQ5A 3V8KA 3OYDA 1ZRDA 2NNNA 3O8GA 2ZKZA 3HOXJ 5DUIA 2M45A 2A05A 2XV4S 2E60A 3CESA 3MCZA 2DN0A 3MZYA 2LK2A 3PNYA 2A3SA 2O9LA 2QGUA 4QPQA 2ECCA 4ZC3A 5LRSA 3OOPA 3CJTB 1SVOA 2UXNA 3IRRA 3DPUA 1BL0A 3OR2C 3OS0A 3VYRB 1R1UA 1QVTA 1I50J 4EEFG 5E1XA 3E6BA 1RESA 3ZQ7A 3ZQGA 3VYUB 5TGTA 5L3DA 5E3LA 1ENHA 3T1BA 4U6CA 2JRMA 3EUAA 3U9GA 3ZQCA 4NHJA 3E6MA 5J8CA 2GXBA 2OCCH 2LKXA 3S14J 4IXAA 2X0LA 4M73A 4NBQA 1K6OA 2DMUA 3K1PA 1AOYA 4A3MJ 4A6WA 4UUTA 5C44J 1HF0A 1X2MA 2AO9A 1QXYA 1P6RA 4U69A 1G3YA 4I6ZA 2FE3A 3R61A 2HTJA 3KP6A 2O61A 2E71A 4HNUA 1D3YA 5BNGA 3CJNA 4F55A 1APLC 2L4MA 3BLYA 2XKPA 5B3SH 3IWFA 5J4YA 5F1RA 5FRMA 3QYEA 2X1EA 4OINF 1FSHA 4FISA 1TQIA 3RZOJ 5B66C 2JUGA 1R36A 2DK5A 2R7RA 4RAYA 4YELA 1MMDA 5GPCA 2JSPA 1H9TA 2I10A 2ID3A 2M7AA 4ESJA 3ZGKA 3C1DA 2WBMA 4DIQA 1GXQA 4DGWB 3TW6A 1OPCA 1BI0A 1ZRCA 2D1HA 2YUSA 3S3MA 2NVTJ 2KZGA 1KQ8A 4FLIA 1S7EA 1YG2A 2DBBA 2VN2A 1WJAA 5HS8A 3GVAA 4V2FA 3I5UA 2XUBA 3BG9A 3NARA 4LD5A 1YW8A 3CO7C 2CJJA 3TKYA 2VBWA 4Y3OA 2XHKA 4DQ2A 3L24A 4XLCA 4IVNA 4A69C 4CCMA 2K9QA 3CCLI 1MH3A 4NC7A 5LGNA 1F1ZA 2BH3A 1ZELA 1LJ9A 1SVMA 1QGPA 1VQ9I 2VPLA 3R0AA 3FXUA 2X48A 4HDUA 2BY1A 3A4CA 2P7VB 3L09A 4A2UA 5E18F 4J19A 2DJIA 1Y8QB 3VPRA 3K70D 2O8XA 4XRSA 4G8XA 2F6CA 2M30A 4HQMA 3IUOA 1ZR4A 2DAOA 3HXLA 1SFOJ 2P99A 1KONA 1SD6A 2V9VA 2XSDC 5FKKA 3Q5FA 4UB6C 3CCRI 2ESNA 4ZYGA 5E79C 3EUHA 5GAGJ 2NQ6A 1NH3A 2DU9A 5DEQA 1TWGJ 2CS3A 2HWVA 1TW3A 2LLKA 4IECA 1U0JA 2VT3A 1IN4A 4BHBA 1FBSA 2HTSA 4HNVA 3LA7A 3WTSC 3PFIA 1GLNA 4YFXF 1W4MA 1Y0UA 1ZGWA 4RM3A 5FD6A 3RPUD 1E3PA 1WJ5A 4D5CA 3KPHA 1KGSA 1DU0A 3ASOH 4RB3C 4BS9A 4PFOA 2LR8A 5J6XA 1HQCA 1WI9A 4UVAA 1XD7A 2UV1A 4A93J 2RC4A 2XPUA 1RKWA 1K4SA 2GU5A 3LSPA 3BR3A 2OKNA 5LGUA 1E2XA 4U7DA 3BJOA 5KHDA 1R5ID 2BB7A 1XX5A 2K4JA 3PUFA 4EMSA 2GOXB 3SDBA 5LEJA 4Y7NJ 1QQIA 3AL0C 1JTYA 3D27A 2V26A 3A1YA 2NS7A 4V2GA 4RZYA 2KJBA 5LHHA 2NAZA 2CU7A 2M3AA 3KEQA 1W36C 3DKXA 1SMYF 4IU6A 4A0ZA 1PUEE 1EH7A 4OOKA 1VQKI 4B47A 2HKOA 2IJLA 5H6QA 3PKEA 1BR2A 4B3XA 3O8HA 5LHIA 1O7LA 2OTJI 3KLOA 1GT0C 2FBIA 3H3UA 3ZP5A 2BW3A 1OYIA 4CA0A 3M1EA 3OIQA 1R23A 1TWCJ 2JK3A 4N9IA 1BOAA 1MW7A 4RLFA 3I54A 4BEHB 4JQFA 4FETA 2ELKA 2ISZA 3DBRB 2R7VA 3HDDA 2P5KA 3HOWJ 1O3SA 2M8EA 4RS8A 4BGDA 2JA6J 5IT3A 4ZNGA 2DT7B 2CMPA 1JAWA 2F2EA 4ZYAA 3A0BC 5CVIA 1D1BA 2XAUA 3EUHC 4LIVA 3QPHA 2ADUA 1HDDC 1BI2A 2FA5A 4B28A 2Y69H 2VQCA 3K9TA 3PFYA 3B6CA 3BP8A 1ZH5A 1VQMI 2FF4A 1WJBA 2R7FA 3IP4B 2CQQA 1IUFA 3FXLA 1Y39A 1N77A 1ZHFA 2IXSA 4BNCA 4I01A 1XS9A 1NG6A 2GA1A 1C21A 4ON0A 4DJAA 1B59A 1J2XA 1T2KA 4A3FJ 1V5GA 4Q4ZF 4HV5A 1ZN2A 1K4TA 3K4CA 3HUGB 4LOCA 3K2AA 2NNYA 1WJDA 4XOTA 4ZJZA 2EFOA 2XGDA 2X1CA 2FD5A 2EPFA 5HLGA 3PSIA 2MLKA 3H0GJ 2K02A 4UY8I 2DMPA 2MC3A 3BZKA 2FQ4A 2Z99A 4FE4A 3ECOA 4I0AA 2Z3YA 3D5RC 2QVOA 3F6OA 3DU6A 4B43A 3JCUC 4E7IA 3CUQB 1KP0A 4NUBA 4A5NA 3ESWB 4NNJA 1S5LC 3BG5A 1SFUA 4LG3A 3CMEI 2A6TA 2ICWG 3KP7A 2X51A 1P4AA 2HNHA 4P96A 3TP3A 5GADJ 5DUKA 4Z2YA 5B1BH 1SVLA 2IP2A 5EF6A 2F5DA 4ENNA 2XPWA 2CFXA 2E2HJ 1U9NA 3OYLA 4M3GA 1SC7A 3CO6C 1X1DA 2HQNA 2GG0A 5DCFA 1AA7A 2LH9A 3FISA 4RAFA 2D45A 1T56A 1TWFJ 2R92J 1OCRH 2KHMA 3JREA 3DTKA 4MFDA 3KP2A 1ZYRF 2WAQA 3K4NA 5BPIA 1W0TA 4HX8A 2R7QA 3I64A 3P9KA 3AG2H 4WXCA 5E3NA 4FCYA 2QSFX 3EYIA 4EGEA 4PJMA 5F0CA 5FD5A 4HX4A 1G2HA 3FKJA 3WU2C 3O2PE 2H27A 2V6EA 2PMZA 2R7XA 4BJ6C 3HOTA 4A6VA 2JA2A 3GLLA 5IP7J 2GXAA 4JOMA 4ZYEA 4EJWA 1LVKA 3JW4A 2V9PA 4BY1J 1SMTA 2KFDA 3CLQA 3JTHA 1YO5C 2HXOA 4V19K 4MEXF 2L9RA 5JVGF 2IBDA 3HRUA 4BBRJ 2L7ZA 2DPUA 3L2VA 1G8XA 1IRXA 2VJ5A 3GZ5A 3ZMSA 1RUNA 5GTIC 5L3FA 1OCCH 4BXXJ 3G73A 1V54H 2Y2ZA 5GTHC 1WI3A 2K40A 1ZLJA 2FJ1A 4B09A 4EJOA 3L2QA 4MNUA 2QSHX 2BY2A 3H5RA 5DCMA 3OYNA 2IA1A 2VJ4A 1I6XA 4JK1X 3J80Z 4XKCA 4LGWA 2IW2A 2ZSHB 2CYYA 2W7NA 3F6VA 2R7TA 4BE2A 2VB6A 2KDZA 1U78A 4B3AA 2QQ9A 1XSXA 4Y33A 4R60A 1Z67A 4ZDLA 3PIOF 1Z7UA 4RB0A 2CUZA 1TP4A 1O0XA 1OKRA 3M9AA 1QHHD 3V42A 1HW2A 3GTLJ 3WGIA 2K4BA 2VXZA 3QP5A 4RGXA 2LSOA 4DNCA 2XF6A 2M87A 3DTIA 3OY9A 4RGZ1 1WH7A 2FXAA 4OU0A 4FHTA 1N25A 3K69A 3J80K 4IPAA 1VTNC 4IHTA 1N75A 3ERMA 2NVXJ 4MO7A 3PO3J 3ZXSA 4AM3A 4FKCA 2ZXJA 3GMEA 2DO7A 1RZ4A 1TNTA 4QSHA 4DW6A 3IRQA 1E0EA 1FJLA 4JP0A 1IV6A 1FY7A 3WTUC 4F92B 3P5JA 5IOYA 3GF2A 2BHCA 2Q8KA 1XGMA 2YPRA 3CCMI 2M1BA 2I8DA 3V7SA 3KEYA 1UCRA 2KDOA 3FXJA 1U3EM 3S3OA 2A5WA 1R49A 1C27A 5HDNA 1G59A 3ABLH 3HRMA 4BH9A 4MTDA 1A16A 2GGBA 1W5SA 1BJZA 2DW4A 4OIOF 3K4JA 4HF0A 1GV5A 5EG0A 5E3MA 2XAHA 3QU6A 4BAYA 4CYCB 2V3YA 3E7LA 2G9WA 2QM3A 4XN0A 4BL0B 3COAC 1H8AC 1C23A 1SANA 3Q9VA 1RKTA 1STZA 3G3ZA 4DZPA 2WAQN 1MDMB 2X1DA 1Q1HA 1ZR2A 3PQJA 1L3LA 2LKPA 3AG4H 1UAAA 2IGOA 4U73A 1WCMJ 3KP3A 3LFUA 2G0EA 2QYOA 2JVGA 2MH9A 3HBLA 4B4CA 1QA6A 3RVAA 1TWAJ 4L0YB 4P9FA 2PMZN 3NAUA 3P9IA 1LDKB 2Y75A 1K78B 1T98A 2FEZA 2DMQA 3TO6A 2C6YA 1LB2A 4LITA 2V4JC 4QR8A 4LG0A 3VEPA 4AD9A 3ZN0A 4NQWB 4KFCA 3EUKL 1MBKA 2F5FA 2BV6A 1MBEA 4G6QA 3SZTA 4QLCU 3PKAA 1H0MA 2DCEA 4U7BA 1USSA 1WH5A 2MH2A 4XLAA 4IKRA 4L5EA 3W2WA 3J7AY 2PLYA 2HR3A 1H9GA 1V5FA 3VOEA 5L3BA 1YJNI 3BJAA 4S00A 5GPAA 3GW2A 2X6YA 1UJ8A 3BG3A 3KCCA 3OS1A 4N9HA 3SDGA 3RPUA 3RQIA 1ZG1A 2HFHA 3M4OJ 2BBYA 2FUG2 5D5UB 1W7VA 2CV1A 2HPMA 1B8IB 3I9V2 4KISA 4BXUA 5FKOA 5ILUA 5F0HA 1J0RA 3GCMA 2EVOA 1MBFA 2FNAA 3F22A 1RNLA 4EM2A 3LFKA 1MMNA 2ZMEB 1A04A 5B1AH 5DTDA 3A02A 1WL9A 4G7HF 1ZRFA 1U8BA 1ZREA 1D0XA 1R00A 2H1LA 4ASNA 1YJ9I 1FYLA 3S3NA 5E20A 2DK8A 2JPCA 2HVSA 4KMFA 1FBQA 1FOWA 2KP6A 5IP6A 4D9JA 3CP8A 2VBXA 1ETOA 2E2IJ 3J7ZI 1P9QC 5HNHA 2VE8A 3C2HA 3HJEA 4P1WA 3GX4X 2FU4A 4E70A 1FMWA 2BXZA 2QF7A 3CP2A 1UELB 6PAXA 2XDVA 3FBIB 2TDXA 2JVHA 5FCFA 5EZHA 2HZTA 2X6OA 2M34A 2E2JJ 1KYZA 3ZMUA 5DM6F 2RQQA 3BCBA 3LSHA 4B48A 3HTUA 4NDLA 3K70C 4CCLA 2IRFG 4XM3A 1IZ1A 3CF2A 2K3FA 1C24A 3E3VA 3P7NA 1JTXA 5CNXA 1X3ZB 3SHFA 3CC7I 1BM9A 4I0BA 2DA5A 1W5TA 2VOPA 1N51A 4S05A 3REOA 2M0MA 2QBYA 2GXGA 2ZJRF 2EFWA 4U0YA 3JAMZ 2JT1A 1ITYA 2JUCA 2M0CA 3R6SA 3OYEA 3L2WA 1K7AA 2KJCA 2Q2EB 2HVQA 2IA2A 2MW8A 4BACA 1ETVA 4KDPA 2PJRA 4Q47A 2BWYA 4UNOA 4FASD 3FX3A 1B72A 2HEOA 2EIJH 2ESHA 1YX5A 3FF5A 1GDTA 4R8HA 5LGTA 4Y52J 3H3VK 2KIFA 2VODA 3DBHB 4KUMA 3J7YJ 4MATA 4EATA 1W0UA 3HM5A 2VOOA 1WY2A 3CB6A 2MATA 4HLYA 2CV0A 3F8BA 3W2AA 3CB5A 2GA2A 1WRJA 2CUJA 1OCPA 3ZQFA 2P9AA 2A69F 1SFXA 1BC7C 3LSKA 3I59B 3RKWA 4IKFA 4DYRA 4Q48A 3PJRA 4IHWA 4GCVA 4I2OA 1VQNI 5GAEJ 1FYKA 3WG9A 3RORA 1X2NA 4HNTA 1JHHA 1MJAA 2LKSA 5JLXA 4OMYA 1ZKGA 3M8JA 2V1XA 4PZJA 5F1JA 1JUSA 2MD0A 4IJAA 3FM3A 2HOSA 3TDZC 1DGRM 3LA2A 2M4GA 5C3EJ 3FIWA 3SFIA 2L02A 3MZ8A 3ECHA 1HBXG 4PSXA 3C7JA 2JJ7A 4A3JJ 4RMNA 2IVMA 2WV1A 1BBYA 2E1CA 2WAFA 1JJ6C 2V1NA 3TO9A 2B7EA 3F23A 3DWLE 5DS9A 2OZUA 3L1PA 1G6NA 3LA3A 1BI3A 4MHGA 2VQHA 3KP4A 2VQGA 4BE1A 2P0WA 1OFCX 1T33A 2OAZA 1FOXA 3ZR8X 3IL2A 2FQ3A 3F8NA 1S7OA 1Z91A 1LDJA 1I39A 5ILSA 2IEKA 4P5OA 5KCMA 2H94A 3CCSI 1YJWI 1LE8A 5F0FA 4XMYA 4KNYA 2XAGA 2NOGA 2XROA 2L3DA 4U76A 2HI3A 3GWZA 4KT5C 1XPXA 2FOKA 1SEUA 1JT6A 4LFUA 1JJ8C 4JBAA 3BR2A 4C2TA 4BBSJ 1WN1A 2MC4A 4KIGA 4L9NA 1YW9A 1RRJA 4P9UA 5DDGA 2DA3A 3W6VA 4R1HA 4ESFA 4D1QA 4I09A 3UNGC 4HF2A 1EA3A 2LP0A 2EJRA 4AVZA 3HPGA 3TDUC 3EDPA 1I3QJ 2XAFA 3S32A 5E17F 4U0WA 2LC2A 2ZC2A 5BQTA 4AIJA 2P4WA 4BQOA 4E7HA 4EJUA 3HG9A 3CF5F 2GTXA 2NS0A 3GTMJ 1OCZH 4FQGA 2LDUA 2XKOA 3X2QH 3BY6A 3OYKA 2BWTA 2MYSA 1BOBA 2PI0A 2DYRH 4WXDA 2PBIA 1SD7A 4A6EA 3OSGA 4J01A 1XG1A 1TW2A 4LK0F 4U71A 4O3MA 3HGGA 2DFIA 3ZMZA 3FHNA 4MFEA 2M4KA 4BHPA 1IN7A 5ICGA 3ZN1A 3GEZA 3U2RA 1R7JA 2NVYJ 3JRDA 3QP6A 2GG3A 5EDNA 1ULYA 4EVIA 1D1AA 1MMSA 4U1BA 4XKBA 3BG7A 4C2MJ 1BR1A 3MQ0A 1BI1A 2CWEA 2ME0A 2GQQA 3H1CA 5J4VA 2Y9ZA 2XRNA 1R4NB 1LDDA 4NC8A 2QWWA 2V7FA 1H89C 1IN8A 2M8GX 1DGWY 3A03A 3BWGA 4IKSA 2PMHA 3HOYJ 1TC3C 3VODA 3GYHX 3FBNB 2VBYA 3ABTA 2PG4A 4PK4A 1XGSA 3GTGJ 4W97A 4M9SA 2ZSIB 3F0CA 3K2ZA 2W82A 1YW7A 3C18A 2BHZA 2EWNA 2L2OA 1MSEC 2HOWA 2FX0A 2JN6A 1G3WA 3HOVJ 3I53A 1HDPA 3RDIA 1K6YA 2QCOA 3KEOA 3BITA 2DA7A 4IRHA 3WE2A 1HXDA 5KVRA 4HLXA 1QXWA 5EEGA 2W85A 1U8RA 2FRHA 1DU6A 1JGGA 3CZ6A 1LUJB 1S3JA 2LBFB 1SAUA 3OYIA 4OOIA 1WWXA 1CHMA 1XB4A 4ZWUA 1T38A 3G1MA 1VFCA 2Z2SB 1IN5A 4Y17A 4RBOA 4OIQF 2B3HA 3DFGA 1UHSA 2PQ8A 5DV5A 3ZMDA 3MEXA 3DV8A 1YHQI 3LQRA 1CF7B 2E5ZA 3WTYC 2J5OA 3NQOA 4F93B 1Y1VJ 2EH3A 4EJTA 3MAJA 3H92A 2UWMA 4P55A 3ULQB 3BDDA 1HOMA 3TB5A 4UV9A 2HU9A 2DA4A 2JTVA 3ERED 2RV8A 2ZNZA 1G4DA 4IHVA 1IC8A 1O3QA 5FRNA 2Q95A 3IC7A 1AKHB 2OTLI 4MQVA 3LSTA 4CCNA 2R5ZA 2GU7A 1X3WB 1IXCA 1O3RA 2NVUB 2DQLA 3W2VA 1TT5B 2YU3A 3K0LA 3KZYA 5F64A 5FKLA 2UZKA 1X3UA 3AAFA 1RUOA 1F4KA 4XRFA 3IKTA 3PIPF 4LK1F 4ABZA 5E8GA 3MVPA 4GRIA 3K4LA 1ZGAA 2H8RA 2STTA 4BYYA 2DA1A 3OOUA 2CFOA 3KE2A 2R7DA 2CGPA 1B9MA 3BR6A 1TBXA 1YS6A 5H20A 3ZMTA 3ZQHA 4L5IA 2ZXIA 4F52A 3E6DA 1VQPI 3R4KA 5FLVA 4HAMA 3S1RJ 2B3KA 5FCHA 1KU2A 2EA4A 1R6RA 2ECBA 4Z6YA 2Y0SA 1YJ3A 2DOEA 4GGGA 3K4KA 1X58A 5AIQA 2R7SA 1S9HA 2HQAA 3CCVI 2HYGD 5J1UA 4BHCA 5EGOA 1VQOI 2LY1A 2OC6A 3K6GA 1U6GA 5BS6A 3LWFA 3DTEA 3BJ6A 2DQRA 2X6XA 3OS2A 4EGZA 4A3KJ 4F91B 1F43A 4BEHA 3GBGA 2R5YB 3GTOJ 5K5RA 4U6ZA 1BIAA 1LVAA 3IH3A 5HLTA 4FLKA 3RJPA 3DLLF 1LEBA 2Y31A 1Y0NA 1FSEA 2D1VA 2WB1A 3CTAA 2EZHA 2OCEA 3HIFA 3VFZA 2JMWA 2ZCWA 1O57A 3IU9A 1SAXA 4OMZA 3KETA 4BDZA 2GBYA 1WBQA 2P6TA 1W5CC 2VXDA 3ZQQA 1EKEA 2IA0A 4E7ZA 3F3XA 4UUSB 1FZPB 2HYFA 2Y9YA 3GZ6A 5FROA 1BR4A 3WGHA 5CDEA 1PUFB 5CVVA 3KYCB 2LFBA 2ETHA 4BQAA 4JX4A 2B9SA 2JWTA 3S1MJ 1ODDA 2V6CA 3DCFA 1KU7A 1IF1A 2XASA 4WCGA 2H09A 2Q94A 1UHWA 4M3FA 5EZGA 4JX6A 1JHFA 1F9NA 4AC0A 2E19A 2PN6A 3IKVA 4FX4A 2XAJA 5TJJA 1ZLKA 3K1NA 2ISYA 3JR9A 4KT6A 3CUQA 1A6QA 2W57A 3L2UA 2CQXA 2NVQJ 1FTZA 1FOKA 1XCVA 1Z3XA 2BY0A 4BXFA 3ABMH 1VI0A 4ESBA 4HBLA 4I98B 4ENMA 1MH4A 3I58A 3T8RA 1FMVA 5D5XB 1IW7F 2VJIA 4AIDA 3G1LA 1MBJA 4WK8F 1BN5A 4IKUA 4XBFA 3K10A 4KMUX 3BZ6A 5E5BA 1FWZA 3PNTA 1WVRA 1FC3A 3F8FA 1V5EA 4EM0B 3S6BA 2MA3A 2EK5A 2W4SA 3CCEI 2GIZA 4YRVA 2ZFUA 3VSLA 3E5XA 4UXNA 1GXPA 3QRFF 2D2WA 2O0YA 2W48A 2GZ5A 1U5TB 2IGNA 4ENJA 1UG2A 3PKDA 4E7KA 3LAJA 1OCOH 2ZSGA 1MGTA 3FMQA 2K9LA 4A3BJ 2CQKA 2OF7A 4IDYA 3GTKJ 1H88C 2ZNYA 4EV0A 3QOEA 3CCUI 2Y0SN 1SFEA 2W00A 3HC7A 4GYGA 4RZZA 3TOAA 2EV6A 3H36A 3CDLA 2DT5A 5L3CA 4OIPF 2K9MA 3TAVA 2QKLB 4RGSA 1QZEA 2R4GA 3RCOA 1E17A 4O5VA 2PMUA 1IJWC 1XDUA 2CUFA 2P6SA 1IAWA 1HKTA 1KA8A 3SYTA 4A5MA 2P5VA 2EZKA 4IX7A 1IDZA 3GTJJ 2W25A 2CQ7A 4BJ5C 1OMIA 1L0OC 1QPMA 4M72A 4M6YA 3VSKA 4CH7A 3LOCA 2ZO4A 4BJTA 3PKBA 2WB1N 1XMKA 2CUEA 4BQQA 4C9YA 5JHUA 3WU1B 2R7OA 2BWWA 3KIOA 3QYFA 2X85A 1ETXA 2PEXA 1ETQA 1RI7A 4XR6A 3W3CA 3FZVA 4NB5A 4HPQA 2LOOA 4YFKF 3TMOA 2VL8A 1YRNB 1XDSA 2G6PA 1QO0D 2L4AA 1U9OA 2HOAA 2KL4A 1YE9A 3GFMA 2DFHA 2CV2A 4O6JA 3BOQA 4IOAF 4CZCA 3BIPA 4Y13A 5K7FA 2P7CB 1DP3A 2P98A 2DXIA 2YS9A 3L9FA 3CUQC 5K5OA 1DDNA 2MGQA 3HRSA 5J47A 3CDIA 5IT9K 1D8JA 5FFXA 4IHYA 2FBKA 1OISA 4HOBA 5HS9A 5GAHJ 2ZJPF 5C4XJ 1RPWA 4M3EA 3MKYB 1QU3A 4YEJA 4QTRA 5IOZA 2FBHA 2PJPA 1YQAA 1TWHJ 2CH0A 2R7WA 1ZARA 4XLFA 2LYCA 3L7GA 4G9YA 1U2WA 4II2A 4LLLA 4E7JA 3IG4A 2GM4A 1A35A 3TP0A 1B9NA 3MR1A 4JUQA 4S01A 4D7MA 1I1GA 4XLHA 4U88A 3H9QA 3LSJA 5AONA 2YU9J 2O03A 2V3ZA 2DI3A 5HLIA 3A01B 2OBPA 2BHAA 5C4JJ 1X1CA 5KAIC 1W36D 4QWQA 2BYVE 5A2QZ 3DPLC 3HB9A 1Z1DA 3SZGA 5FJ8J 4AYBA 2O3FA 1YYVA 2CW7A 3JRFA 1I1SA 4UUVA 3H9GA 4WXHA 4HV6A 3OYCA 1Z77A 1MZBA 1IGNA 1OR7A 4KICA 3DXJF 1AWCA 1MATA 3B73A 2ZXHA 3BZCA 2M5WA 2LY9A 4D7NA 2E35A 3BPVA 2QA4I 2KMUA 3DBLB 1M35A 3GFLA 2DOFA 1QZZA 2PFBA 3BROA 1CGPA 4U70A 2TRTA 1T39A 2IAIA 2EV0A 3C2BA 3VYTB 1MSFC 2V3XA 2LG4A 1JKPC 3Q0WA 2YSRA 2KRFA 3KYDB 1XTAA 2YR2A 2RQPA 3D1NI 5A2QK 1OQYA 1WFXA 3MKLA 1K78A 3L7WA 1WSUA 1QPIA 3FXOA 2DOAA 4OIRF 3I55I 4IQJA 4TV7A 2PX9A 3S2HJ 4PNCA 2AQFA 4XLNF 3EETA 5JHFA 1SD5A 3QODA 5CE6A 3JRCA 4L5JA 5HDGA 4E7LA 5IYCJ 3K4MA 3OWTA 4UV8A 3F72A 3KFWX 1W7PB 5CPRB 3DQVC 2E7WA 3L2CA 2BVMA 1HA8A 2IS6A 3HEFA 2OZ6A 1ZGJA 3S15J 2CW8A 3E1SA 1P2FA 4YIRX 2IS2A 5FFZA 2BHBA 2DDAA 4Y15A 4FO7A 1ZK8A 2YX7A 1SD4A 4IQ4A 4AWXB 4GYIA 1V4RA 3OIPA 1ACIA 2KIQA 5JLWA 1I6HJ 3RQ4A 3R0JA 1Z0XA 2E1MC 2IT0A 1JXSA 4ZWPA 5BPDA 2A68F 4H4KC 1T8IA 3LQQA 4MIMA 2EQRA 2KQRA 2H6CA 2VONA 3RTRA 5FKNA 2COMA 4HA8A 2OQRA 5HNFA 3Q3SA 4HG2A 1LNWA 1M1EB 1G3TA 1VF9A 3BC8A 4XKWA 2MBFA 4IZZA 2CG4A 4HW0A 1XN7A 2KRHA 5DM7F 3U1KA 2XF7A 2K86A 3FHZA 2DMNA 1TTYA 1E3OC 3H5NA 1OR7C 1R58A 1WL6A 5CQEA 3CJQB 2RAEA 1ON2A 4ZZDA 2HGCA 1WZ2A 3FK6A 2DYSH 4II3A 4PJ0C 2GZWA 2P8TA 4KITB 2LVSA 4IEJA 5J1RA 1IRFA 1KU9A 3WTWC 3O3KA 4HSRA 2NXNB 3FDYA 4AYBN 4G7ZF 3RKQA 2GOMA 1T6SA 2NQ7A 3W6JB 1WJEA 3M8EA 3DLAA 3BQZA 1FEXA 5JVTA 4M3DA 3FM5A 1MBHA 2QLZA 4CICA 2P81A 5L3EA 2Q2EA 5KNLA 2Q0OA 3HRTA 3KZIC 1LPQA 3V8LA 1EJ9A 1O3TA 5CVUA 1X1BA 1X19A 2MG4A 4LLNA 4A6DA 5LRRA 2XIGA 4XSXF 4DZJA 5EEHA 5BOXA 1W1WE 3IU7A 4LB5A 2LF7A 4GFBA 2VIXA 4KYWA 1A31A 5CJ9A 4PGHA 3CMAI 2BEOA 2OA4A 1ZG3A 3OR1C 2OPTA 1QZYA 2AXTC 2A5YB 2HXIA 3FWEA 2B0LA 3BR5A 4ZYHA 2M2EA 3IHUA 3I59A 3Q9SA 2IS1A 5CDLA 4ETSA 1Y1NA 3IWZA 2LF8A 1KZHA 2WC2A 2DFFA 1K79A 4D0PA 1C0WA 3C3WA 3K4BA 4M6XA 3CTZA 1HKQA 1YFHA 2DA6A 5M3FJ 5LHGA 3N05A 3H0DA 3MFKA 1FNNA 1KQ0A 2BXYA 4KN7X 1R4MB 3OYJA 1GVJA 5F08A 3JSPA 1WPKA 4AVPA 3BR1A 1FOYA 1XC5A 3BIQA 4BU2A 1PP8F 2QENA 1WQ2A 3KLNA 5D6FA 3OYMA 2EB7A 3OYHA 1UHMA 3WHBA 3PL8A 4UVBA 2Y30A 3HOZJ 1K83J 3TL4X 3U1DA 1FT9A 3MWMA 3GTPJ 2FSWA 2AXLA 3QPTA 3KYLA 2FNPA 4AIHA 3B02A 1R1TA 2I5UA 2XF5A 4GXOA 2EV5A 4IHXA 2LD5A 4PDKA 2W24A 2YX4A 1KQ9A 1P7IA 4M71A 2XAQA 4RDUA 3RI4A 2XB0X 3CJRB 3V7CA 4NC6A 4C3IJ 3F9KA 3OYFA 4I7HA 2VC0A 1J5YA 4UVCA 1DPRA 3MZHA 1MNMC 1HW1A 4XONA 2L01A 1IRZA 3SQNA 3TEDA 2K7LA 3DEWA 3T8TA 2OJED 4DYQA 1LE8B 2RNGA 1ZQ3P 2ME6A 1YOVB 3R60A 3OSFA 2ACJA 2DTRA 3D5SC 2IPQX 4DYCA 3VB2A 3CDHA 4B8XA 3VYSB 4RGUA 9ANTA 5ILVA 2RKHA 4EJVA 4XN3A 4RB1A 2F5CA 4ZTJA 4XK4A 1S8NA 1X1PA 4I76A 1XSDA 3DP7A 4RB2C 4H0EA 3H3ZA 1DUXC 4IHSA 2K9SA 2L0KA 5K7ZA 4R79A 4I99C 3QWLA 2XVCA 4LLGF 4BUPA 2VE9A 4U75A 3O6BB 3CC2I 3RIRA 2CSOA 3I3LA 1R71A 2G7UA 2STWA 2QQ8A 2WY8Q
chains in the Genus database with same CATH topology
1BC8C 2JPBA 4KIFA 3RKXA 3SZPA 4HF1A 1S6LA 2A61A 2A6HF 3I71A 1MD0A 1GHCA 3QU3A 2ZBKA 3D5LA 3ISPA 2VC1A 1Z9CA 2RVCA 1P4WA 1JE8A 2Z9OA 2CO5A 4Q5SF 4KIBA 1YIOA 4G94A 1QBJA 2W84A 4FX0A 2WWYA 3TO7A 1J9IA 4HDVA 5D8KB 3WU0A 1TNSA 4IKTA 5D8LB 3IU8A 1D5VA 1YVMA 3F21A 3HTSB 3DKWA 1R5GA 1UB9A 1D8KA 3EYYA 5D6EA 4Z7MA 3K1MA 3WTXC 4WF2A 2R3SA 4MGRA 4HX7A 3LAPA 1KYWA 1J59A 1ZAOA 1HSJA 4MQ9F 1FPQA 1W7PD 3RYRA 4PGGA 2UXXA 1CF7A 2GIVA 1DP7P 2GG7A 4KN4X 2GU6A 2GWRA 1I5ZA 5LEKA 4GO1A 1XSVA 2E7XA 3HSFA 3FXRA 4RAZA 4IRGA 5ED4A 5HLHA 1FX7A 1R1VA 4YG2F 4CGZA 1XCBA 5JR3A 4LMYA 4KM3A 4L9TA 3FMSA 4CXFA 3FXQA 1KU3A 3WGGA 1TQPA 2HKXA 3ML6A 4ZH4F 5ICCA 4S2TP 2V1DA 1B4AA 2B3LA 2VT2A 4CDGA 1J7KA 2L54A 4WWCA 5F6FA 4A12A 3ZPLA 2HOEA 3ABUA 4FT8A 3TGNA 5L3GA 1PP7U 4A0YA 1QXZA 4MTEA 2WV0A 2QQAA 1MKMA 3NEUA 2GU4A 4A0XA 2EVMA 5FGMA 4U6JA 5E1WA 2BE5F 2O6GE 2EFPA 1IXRC 3PQKA 4M74A 3T5XA 2Z33A 3HSEA 3J7AO 2KIMA 4HZFA 2BWXA 2GAUA 5HS7A 5CDVA 1REPC 1ON1A 3HYIA 3HUGA 3BPXA 1XGNA 2OD5A 5CVJA 2ELHA 1XGOA 2NYXA 3GO5A 4CO8A 1O7FA 5CVRA 5LLQA 3T0YA 5D5WB 2OQGA 1FLIA 5DD8A 4U0VA 4IF4A 1WKMA 2QUFA 4CZZA 3JSOA 1IXSB 4PV4A 2RGVA 4ZYDA 3I0TA 3KP5A 1WLRA 1EV7A 2DLLA 5E8IA 5HVQC 4U6EA 2HQRA 2HDCA 4AIKA 2GG2A 1FYMA 3GFJA 1EH6A 3SXYA 3CLOA 3D0SA 1HW5A 3W6KB 1U5TA 1B1BA 3ZMVA 5JFRA 2V79A 1S29A 1Z6TA 1HSTA 1YTYA 1PV9A 5ERIA 3V4GA 2QZ8A 4HQEA 5ICFA 1J75A 2KKOA 5AIPA 3RPQA 5IT9Z 5BMZA 4WX9A 2BN7A 3SFZA 3ROUA 5H6RA 2RN7A 3MATA 1Z05A 2QQBA 5ICEA 2OU2A 5FLXZ 5DYMA 1TQMA 5DCMB 4K2EA 2EVCA 4G6DA 5K1YA 5TRDA 2X4HA 1OYYA 4HXXA 3HHGA 1XNZA 1LQ1A 3WTZA 1IRGA 2AS5F 1PDNC 1F5TA 2GG5A 2CW0F 5HDKA 2MD5A 2KIUA 1QNTA 5FLXK 1HKSA 1OYWA 1IUYA 4MEYF 1Z6RA 1USTA 1EH8A 4UHTA 1C22A 4CYDA 2E1NA 3E97A 2XGXA 5JI6A 1XMAA 5DD4A 4I02A 4L9VA 1U5TC 2Y0MA 3E5UA 1YS7A 2FMLA 4FUKA 3ELKA 3GLXA 1YLFA 3F8MA 3F8CA 4U6WA 1B6AA 4N0BA 4S04A 4FO8A 3RKYA 2GG9A 4L18B 1MDMA 3GXOA 3S2WA 2JRTA 3KZZA 1BIBA 2MLGA 2IW5A 1I27A 3DPTA 3V7RA 2V1UA 2BWVA 3DF8A 2Q96A 4IF7A 2VBZA 4YIIA 3Q6DA 4NQWA 2RNJA 2EA2A 1NHAA 4ENKA 2BWSA 4LG0B 1JGSA 2Q92A 1DPUA 3HSRA 3MX6A 1W7PA 2G7HA 2J5PA 2FMYA 5J8FA 4EQQA 2JSCA 3WTTC 3E6CC 4FLJA 2F5EA 2DPDA 4HYEA 1T0FA 2JZYA 1W2MA 2BHDA 4M9XA 2ZMEA 3FMRA 1P92A 2Y48A 2A07F 3RYPA 4L9JA 1IN6A 1S7AA 2LNBA 1V3FA 4LB6B 2NRAC 2EFNA 3WTVC 5E1ZB 4KA4A 2BWUA 4IRIA 3P9CA 1LEAA 1P4XA 1FP1D 1RIOH 2GGCA 5KK1A 2P5LC 2Q93A 2RDPA 4EM1A 1R22A 3CUOA 5HOOA 5D5VB 5D4RA 4RGRA 1G3SA 3HOSA 2GG8A 3N4MA 4XSZF 4YIFA 3TQNA 2K27A 2ZJ2A 3I4PA 5CIKA 3NRVA 4LJZF 3JTGA 2WTEA 4PCQA 2ZFWA 2QBYB 1MJ9A 2A6EF 1R5HA 5LBQA 4ZWOA 4ZZLA 5D4SA 3J81Z 3V8JA 1FBUA 1UFMA 3L00A 4EGYA 3PKCA 1ZG5A 1BJAA 5FB2A 4L0ZB 3TOBA 3DEUA 5CYVA 3OV8A 1FP2A 3M7GA 3WODF 5K5QA 4CHUA 3JAMK 3HHHA 4F7ZA 4M9ZA 1TLHB 3QOPA 4G7OF 3E5QA 3J81K 4S2RP 2H6BA 1ONVA 2EFQA 3QAHA 5CLSA 3M8FA 2Z5UA 3GUDA 3N97A 3WE3A 5FO5A 2BGCA 4YFNF 1MJBA 4FLLA 4XLPF 3EQLF 2HS5A 3GFIA 3V8KA 1ZRDA 2NNNA 2ZKZA 5DUIA 2M45A 2XV4S 3MCZA 3MZYA 2A3SA 5LRSA 3OOPA 2UXNA 3IRRA 1R1UA 5E1XA 3E6BA 3ZQ7A 5L3DA 3T1BA 4U6CA 3U9GA 4NHJA 3E6MA 5J8CA 2GXBA 4IXAA 2X0LA 4M73A 1K6OA 3K1PA 1AOYA 4A6WA 1QXYA 1P6RA 4U69A 1G3YA 2FE3A 3R61A 2HTJA 3KP6A 2O61A 1D3YA 3CJNA 2L4MA 2XKPA 3IWFA 5F1RA 4OINF 1FSHA 1TQIA 1R36A 2DK5A 4RAYA 1H9TA 4ESJA 3C1DA 1GXQA 1OPCA 1BI0A 1ZRCA 2D1HA 1KQ8A 4FLIA 1YG2A 2DBBA 2VN2A 5HS8A 3GVAA 3I5UA 2XUBA 4LD5A 1YW8A 3CO7C 3TKYA 2VBWA 2XHKA 4DQ2A 3L24A 4IVNA 5LGNA 1F1ZA 2BH3A 1LJ9A 1QGPA 3R0AA 3FXUA 4HDUA 2P7VB 3L09A 4A2UA 5E18F 2O8XA 4G8XA 2M30A 4HQMA 2P99A 2DAOA 1SD6A 2V9VA 3Q5FA 2ESNA 4ZYGA 3EUHA 2NQ6A 2DU9A 5DEQA 2HWVA 1TW3A 4IECA 2VT3A 1IN4A 4BHBA 1FBSA 2HTSA 3LA7A 3WTSC 3PFIA 4YFXF 1W4MA 1Y0UA 5FD6A 1KGSA 4RB3C 5J6XA 1HQCA 1WI9A 4UVAA 1XD7A 2RC4A 2GU5A 2OKNA 5LGUA 1E2XA 4U7DA 3BJOA 2BB7A 2K4JA 4EMSA 5LEJA 1QQIA 3D27A 4RZYA 2KJBA 5LHHA 2NAZA 3KEQA 1SMYF 4IU6A 4A0ZA 1PUEE 1EH7A 4OOKA 3PKEA 2HKOA 2IJLA 5H6QA 5LHIA 1O7LA 3KLOA 2FBIA 3H3UA 3ZP5A 1OYIA 3M1EA 1R23A 4N9IA 1BOAA 3I54A 4JQFA 2ISZA 2P5KA 1O3SA 2M8EA 4RS8A 5IT3A 4ZNGA 1JAWA 2F2EA 5CVIA 3QPHA 2ADUA 1BI2A 2FA5A 4B28A 3K9TA 3BP8A 1ZH5A 2FF4A 2R7FA 1ZHFA 4BNCA 4I01A 1C21A 2GA1A 4ON0A 1B59A 1J2XA 1T2KA 4Q4ZF 4HV5A 1ZN2A 2NNYA 2EFOA 5HLGA 2MLKA 2K02A 2MC3A 2Z99A 3ECOA 4I0AA 2Z3YA 2QVOA 3F6OA 3CUQB 1KP0A 4A5NA 1SFUA 3KP7A 1P4AA 4P96A 5DUKA 4Z2YA 2IP2A 2F5DA 4ENNA 2CFXA 3CO6C 2HQNA 2GG0A 5DCFA 2D45A 3KP2A 1ZYRF 5BPIA 4HX8A 3I64A 3P9KA 4WXCA 3EYIA 4EGEA 5FD5A 4HX4A 2H27A 3O2PE 3HOTA 4A6VA 4ZYEA 4EJWA 3JW4A 1SMTA 1YO5C 3JTHA 4MEXF 3HRUA 2DPUA 3GZ5A 3ZMSA 1RUNA 5L3FA 3G73A 1ZLJA 4B09A 4EJOA 4MNUA 5DCMA 2IA1A 3J80Z 1I6XA 4JK1X 4LGWA 2IW2A 2CYYA 3F6VA 1U78A 2QQ9A 1XSXA 4R60A 1Z7UA 4RB0A 1O0XA 1OKRA 3M9AA 1HW2A 3WGIA 2K4BA 2VXZA 3QP5A 4RGXA 2LSOA 4DNCA 2M87A 4RGZ1 2FXAA 4OU0A 4FHTA 3K69A 3J80K 4IPAA 1VTNC 4IHTA 4FKCA 2ZXJA 2DO7A 1RZ4A 1TNTA 3IRQA 1FY7A 3WTUC 3GF2A 2BHCA 2Q8KA 1XGMA 2YPRA 2M1BA 3V7SA 1UCRA 1U3EM 1C27A 5HDNA 3HRMA 4MTDA 4BH9A 1A16A 2GGBA 1W5SA 2DW4A 4OIOF 4HF0A 2XAHA 3QU6A 4BAYA 2V3YA 2G9WA 2QM3A 3COAC 1C23A 3Q9VA 1STZA 3G3ZA 1MDMB 1Q1HA 1L3LA 3PQJA 2LKPA 4U73A 3KP3A 2QYOA 2MH9A 3RVAA 4L0YB 4P9FA 3P9IA 1LDKB 2Y75A 1K78B 1T98A 2FEZA 3TO6A 2C6YA 1LB2A 4QR8A 4LG0A 3VEPA 4AD9A 3ZN0A 4KFCA 2F5FA 2BV6A 4G6QA 3SZTA 4QLCU 3PKAA 1H0MA 4U7BA 1USSA 2MH2A 4IKRA 2PLYA 2HR3A 1H9GA 3VOEA 5L3BA 3BJAA 4S00A 3GW2A 3KCCA 4N9HA 3RPUA 1ZG1A 2HFHA 2BBYA 1W7VA 5D5UB 4BXUA 5ILUA 1J0RA 2EVOA 2FNAA 3F22A 1RNLA 4EM2A 3LFKA 2ZMEB 1A04A 1WL9A 4G7HF 1ZRFA 1ZREA 1R00A 4ASNA 1FYLA 5E20A 2DK8A 2JPCA 4KMFA 1FBQA 2VBXA 2VE8A 3GX4X 2FU4A 4E70A 6PAXA 2TDXA 5FCFA 2HZTA 1KYZA 3ZMUA 3HTUA 2IRFG 1IZ1A 1C24A 3E3VA 3P7NA 5CNXA 3SHFA 1BM9A 4I0BA 1W5TA 2VOPA 1N51A 4S05A 3REOA 2QBYA 2GXGA 2EFWA 4U0YA 3JAMZ 2JT1A 3R6SA 1K7AA 2KJCA 2IA2A 4KDPA 4Q47A 2BWYA 4UNOA 3FX3A 2HEOA 2ESHA 3FF5A 4R8HA 5LGTA 2KIFA 2VODA 4KUMA 4MATA 2VOOA 1WY2A 3CB6A 2MATA 4HLYA 3F8BA 3CB5A 2GA2A 1WRJA 2P9AA 2A69F 1SFXA 1BC7C 3I59B 3RKWA 4Q48A 4GCVA 4I2OA 1FYKA 3WG9A 3RORA 1JHHA 1MJAA 4OMYA 2V1XA 4PZJA 4IJAA 3FM3A 3TDZC 3LA2A 2L02A 3ECHA 1HBXG 3C7JA 2IVMA 1BBYA 2E1CA 3TO9A 3F23A 2OZUA 1G6NA 3LA3A 1BI3A 4MHGA 3KP4A 2OAZA 3IL2A 2FQ3A 3F8NA 1S7OA 1Z91A 1LDJA 5ILSA 4P5OA 2H94A 4KNYA 2XAGA 2XROA 2L3DA 4U76A 3GWZA 4KT5C 2FOKA 4LFUA 4JBAA 1WN1A 4KIGA 4L9NA 1YW9A 4P9UA 5DDGA 4R1HA 4ESFA 4I09A 4HF2A 2EJRA 3TDUC 3EDPA 2XAFA 5E17F 4U0WA 5BQTA 4AIJA 2P4WA 4EJUA 2GTXA 2NS0A 2LDUA 2XKOA 3BY6A 2BWTA 2PI0A 4WXDA 4A6EA 2PBIA 1SD7A 1TW2A 4LK0F 4U71A 4O3MA 2DFIA 3ZMZA 4BHPA 1IN7A 5ICGA 3ZN1A 3GEZA 3U2RA 1R7JA 3QP6A 2GG3A 1ULYA 4EVIA 4U1BA 3MQ0A 1BI1A 2CWEA 2GQQA 2XRNA 1LDDA 2QWWA 1IN8A 3BWGA 4IKSA 2PMHA 3VODA 3GYHX 2VBYA 3ABTA 2PG4A 1XGSA 4M9SA 3K2ZA 1YW7A 3C18A 2EWNA 2HOWA 1G3WA 3I53A 3RDIA 3KEOA 3BITA 4IRHA 3WE2A 1HXDA 5KVRA 4HLXA 1QXWA 5EEGA 2W85A 1U8RA 2FRHA 1S3JA 4OOIA 1WWXA 1CHMA 1XB4A 4ZWUA 1T38A 1IN5A 4Y17A 4OIQF 2B3HA 3DFGA 2PQ8A 5DV5A 3ZMDA 3MEXA 3DV8A 1CF7B 3LQRA 3WTYC 2J5OA 3NQOA 4EJTA 3MAJA 3H92A 2UWMA 4P55A 3ULQB 3BDDA 3TB5A 4UV9A 2JTVA 3ERED 2RV8A 2ZNZA 1G4DA 1O3QA 2Q95A 3IC7A 4MQVA 3LSTA 2GU7A 1O3RA 1IXCA 2DQLA 2YU3A 3K0LA 3KZYA 5F64A 1RUOA 2UZKA 1X3UA 3AAFA 1F4KA 4XRFA 3IKTA 4LK1F 5E8GA 1ZGAA 2STTA 4BYYA 3KE2A 2R7DA 2CGPA 1B9MA 1TBXA 1YS6A 5H20A 3ZMTA 4L5IA 3E6DA 3R4KA 4HAMA 2B3KA 5FCHA 1KU2A 2EA4A 1YJ3A 4GGGA 5AIQA 2HYGD 4BHCA 1U6GA 5BS6A 3LWFA 3BJ6A 2DQRA 4EGZA 5K5RA 4U6ZA 1BIAA 1LVAA 4FLKA 3RJPA 1LEBA 1FSEA 2D1VA 3CTAA 3HIFA 3VFZA 2ZCWA 1O57A 3IU9A 1SAXA 4OMZA 3KETA 1WBQA 2P6TA 2IA0A 3F3XA 1FZPB 2HYFA 3GZ6A 3WGHA 5CDEA 5CVVA 2ETHA 4BQAA 1ODDA 2V6CA 1KU7A 1IF1A 2XASA 4WCGA 2H09A 2Q94A 1UHWA 1JHFA 1F9NA 2PN6A 3IKVA 4FX4A 2XAJA 5TJJA 1ZLKA 3K1NA 2ISYA 3CUQA 2W57A 1FOKA 1XCVA 4ESBA 4HBLA 4I98B 4ENMA 3I58A 3T8RA 5D5XB 1IW7F 4WK8F 1BN5A 4IKUA 4XBFA 4KMUX 3BZ6A 5E5BA 1FWZA 1FC3A 3F8FA 4EM0B 3S6BA 2MA3A 2EK5A 3E5XA 4UXNA 1GXPA 3QRFF 2D2WA 2O0YA 2GZ5A 1U5TB 4ENJA 3PKDA 3LAJA 2ZSGA 1MGTA 3FMQA 2CQKA 4IDYA 2ZNYA 4EV0A 1SFEA 4GYGA 4RZZA 3TOAA 2EV6A 5L3CA 2DT5A 4OIPF 3TAVA 4RGSA 1E17A 4O5VA 2PMUA 1XDUA 2P6SA 1IAWA 1HKTA 1KA8A 4A5MA 2P5VA 2W25A 1OMIA 1L0OC 1QPMA 4M72A 4M6YA 2ZO4A 3PKBA 1XMKA 5JHUA 3WU1B 2BWWA 2PEXA 1RI7A 3FZVA 4NB5A 4YFKF 1XDSA 2G6PA 1QO0D 2L4AA 3GFMA 4O6JA 3BOQA 3BIPA 4Y13A 2P7CB 2P98A 3L9FA 3CUQC 5K5OA 1DDNA 3HRSA 5IT9K 1D8JA 5FFXA 2FBKA 4HOBA 5HS9A 2FBHA 2PJPA 1YQAA 1ZARA 3L7GA 4G9YA 1U2WA 4LLLA 3IG4A 1B9NA 3MR1A 4JUQA 4S01A 1I1GA 4U88A 5AONA 2O03A 2V3ZA 2DI3A 5HLIA 2OBPA 2BHAA 4QWQA 2BYVE 5A2QZ 3DPLC 1Z1DA 1I1SA 2O3FA 1YYVA 4UUVA 4WXHA 4HV6A 1MZBA 1OR7A 4KICA 3DXJF 1AWCA 1MATA 3B73A 2M5WA 3BPVA 1M35A 3GFLA 1QZZA 2PFBA 3BROA 1CGPA 4U70A 1T39A 2EV0A 2V3XA 2YSRA 2KRFA 2YR2A 2RQPA 5A2QK 1K78A 3L7WA 1WSUA 4OIRF 4TV7A 4PNCA 4XLNF 3EETA 1SD5A 5CE6A 4L5JA 5HDGA 4UV8A 3F72A 3KFWX 1W7PB 3DQVC 2E7WA 3L2CA 2OZ6A 1ZGJA 1P2FA 5FFZA 2BHBA 4Y15A 4FO7A 2YX7A 1SD4A 4AWXB 4GYIA 1V4RA 3R0JA 2IT0A 1JXSA 4ZWPA 5BPDA 2A68F 3LQQA 2H6CA 2VONA 3RTRA 2COMA 4HA8A 2OQRA 1LNWA 1G3TA 2MBFA 2CG4A 4HW0A 1XN7A 2K86A 3FHZA 1TTYA 1R58A 1WL6A 1ON2A 4ZZDA 2HGCA 2GZWA 2P8TA 1IRFA 1KU9A 3WTWC 3O3KA 4G7ZF 1T6SA 2NQ7A 3W6JB 3M8EA 5JVTA 3FM5A 2QLZA 4CICA 5L3EA 2Q2EA 2Q0OA 3HRTA 3V8LA 1O3TA 5CVUA 4LLNA 4A6DA 5LRRA 2XIGA 4XSXF 5BOXA 5EEHA 3IU7A 4LB5A 2LF7A 4KYWA 5CJ9A 4PGHA 2BEOA 2OA4A 1ZG3A 1QZYA 2A5YB 3FWEA 2B0LA 4ZYHA 3IHUA 3I59A 3Q9SA 5CDLA 4ETSA 1Y1NA 3IWZA 2LF8A 1K79A 2WC2A 1C0WA 4D0PA 3C3WA 4M6XA 3CTZA 1HKQA 1YFHA 5LHGA 3MFKA 1FNNA 1KQ0A 4KN7X 1GVJA 3JSPA 4AVPA 3BIQA 1PP8F 2QENA 1WQ2A 3KLNA 5D6FA 2EB7A 1UHMA 4UVBA 3U1DA 1FT9A 3MWMA 2FSWA 2AXLA 3QPTA 2FNPA 4AIHA 3B02A 1R1TA 4GXOA 2EV5A 4PDKA 2W24A 2YX4A 1KQ9A 4M71A 2XAQA 3RI4A 3V7CA 4I7HA 2VC0A 1J5YA 4UVCA 1DPRA 3MZHA 1HW1A 2L01A 3SQNA 2K7LA 3T8TA 3R60A 2ACJA 2DTRA 2IPQX 3VB2A 3CDHA 4B8XA 4RGUA 5ILVA 2RKHA 4EJVA 4RB1A 2F5CA 1S8NA 1XSDA 3DP7A 4RB2C 4H0EA 3H3ZA 1DUXC 4IHSA 4R79A 2VE9A 4U75A 2XVCA 4LLGF 3O6BB