1WKMA

The product bound form of the mn(ii)loaded methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
b'MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title EPR and X-ray crystallographic characterization of the product-bound form of the MnII-loaded methionyl aminopeptidase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wkmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wkmA01
2IJLA 5LHHA 4AIKA 3K1NA 2V3ZA 3FZVA 4CHUA 4U6CA 4RAYA 2BEOA 3QOPA 3TAVA 3WU1B 1FLIA 2G6PA 4B09A 1SMYF 4FLIA 1A16A 3GEZA 5HLHA 3MATA 5E20A 2CWEA 5A2QZ 2ACJA 1IN7A 4EMSA 1IXCA 3T8RA 4I7HA 4I01A 1HQCA 4UV8A 2VC0A 4S2RP 3F8FA 4LLNA 3E6MA 2QQ9A 3GO5A 2P6SA 1B9MA 1MD0A 2D1HA 1FBSA 1ZG5A 4WXDA 1YG2A 1L3LA 3PKEA 2VBWA 1IUYA 5LGTA 1IRFA 4RAZA 5L3EA 5DV5A 2DO7A 1XSDA 1FNNA 1UCRA 2RVCA 2BWXA 3DKWA 4FHTA 1FWZA 5FD5A 3D0SA 4YG2F 1FZPB 2VBYA 4LMYA 2GQQA 1BI1A 4RZYA 1ZYRF 3L7GA 3WE3A 1SFUA 1FSHA 1PP8F 2Q8KA 3JAMK 2ZKZA 3HUGA 4HV6A 1ZH5A 4RB3C 4Y15A 1XGSA 2HTJA 1FYMA 2LF7A 3K2ZA 3DEUA 3IWZA 3PKAA 2P5VA 2FMYA 3B73A 2DI3A 4JQFA 4IVNA 1W7PA 1EV7A 3G3ZA 3BZ6A 2WV0A 1AOYA 1IZ1A 3FXQA 2PMHA 1UFMA 3HRSA 2O8XA 1IF1A 1GXQA 5D4SA 2XGXA 1ZARA 3V8JA 5A2QK 4BXUA 4U69A 5F64A 2ISYA 2GG8A 1P92A 1RUNA 4A6EA 3FM3A 2UWMA 1KU2A 4HF2A 1P6RA 2GZWA 2OZ6A 3V7SA 2FSWA 5FFXA 5FD6A 2FF4A 5DCMB 2C6YA 1YQAA 2XKPA 3ZPLA 1LDKB 1J0RA 3CUQC 3P7NA 3ERED 1Q1HA 3WTYC 1PDNC 1ON2A 2EV5A 1FYKA 3DFGA 1USTA 1V4RA 2OZUA 4IHSA 4FX4A 4U6WA 1YIOA 1S7AA 5D5XB 5LRSA 3ZMDA 3RKXA 3E6CC 3WGGA 1D5VA 1U6GA 3SHFA 3LAJA 1U5TA 3TOAA 2MH9A 5BQTA 2GZ5A 4XSZF 4LD5A 4A12A 1WLRA 2GU4A 4NQWA 1JXSA 3DF8A 3C18A 1XGOA 2Z33A 3U1DA 3V8LA 2R7DA 3JW4A 3PKBA 2MLGA 3REOA 5D5VB 1CF7A 1JE8A 2ZJ2A 2DFIA 4YIIA 3ZMVA 3WU0A 3T5XA 4IKSA 2IA2A 4RZZA 4PDKA 1ZG3A 3P9CA 1U78A 1Y0UA 4XSXF 4MTEA 2HKOA 1XGNA 4ZZLA 3IHUA 2JPCA 2H09A 3IWFA 3KP3A 5D6EA 3LWFA 5DYMA 2CW0F 5LEJA 2QQBA 3CO6C 3ECOA 5LGUA 4CXFA 1LB2A 1IN5A 3Q5FA 2IA0A 4KIBA 1BC8C 4A0XA 4U71A 2R7FA 4ON0A 2JSCA 4EM1A 1C27A 5BMZA 4P9FA 1IW7F 1BBYA 2DPDA 4OOKA 4JK1X 1KU9A 1SD6A 3C3WA 1OYIA 2G9WA 2L01A 1HKQA 2PN6A 5LEKA 4LB6B 2W84A 4UXNA 2GG2A 2QZ8A 4TV7A 5EEHA 4EJTA 2RKHA 5HOOA 2GG3A 4WWCA 1Z91A 2QBYA 1J2XA 3FHZA 5JI6A 3F3XA 2BB7A 4BH9A 4HLYA 1MJAA 2NNNA 5IT9Z 3MR1A 5H6QA 2EWNA 3NRVA 3PFIA 4M72A 2F2EA 4A6WA 2ETHA 1U3EM 2UZKA 3O2PE 2ZNZA 4ZYEA 2PEXA 2IA1A 2O6GE 2O0YA 1FX7A 4QLCU 1FT9A 1ZRCA 2RN7A 4K2EA 5FGMA 3I54A 3C7JA 4A6DA 4IF7A 3K9TA 3EUHA 1O3SA 1KYZA 5E8IA 4G7ZF 2XRNA 5D4RA 2XAGA 1T38A 5J6XA 2HGCA 4FLLA 3LA7A 4PGGA 1W5SA 3F8MA 4RS8A 5CDLA 1ZREA 4KICA 2VT3A 5HLGA 3WE2A 2A68F 5HDGA 1QPMA 4I09A 4EJWA 3WODF 5CVIA 2EA2A 2VOOA 3ZN1A 1B1BA 2IT0A 2Y0MA 1IXSB 2J5PA 1U2WA 2VE8A 2UXXA 2P5KA 5K5OA 3AAFA 1SFXA 1LQ1A 2CGPA 1BOAA 1I1SA 1PP7U 1J75A 3I4PA 2A6EF 1ON1A 1W7PB 5HVQC 3R0AA 2F5DA 1FSEA 3HTSB 2ZSGA 4H0EA 4UVCA 1QXYA 1ZAOA 3CDHA 4ZYHA 3M8FA 1FYLA 3TKYA 2CSOA 2OA4A 4HQMA 3ABTA 3K0LA 1QXZA 1XSXA 4EJVA 1WRJA 3NQOA 3MWMA 2FBIA 1KU7A 5DUIA 2EFOA 5LRRA 4Q47A 5F6FA 3COAC 1B4AA 2ZMEB 2VT2A 3E5UA 3ABUA 2MD5A 3D5LA 4GO1A 4N0BA 1LDJA 2ZBKA 2XKOA 2HQNA 4YFNF 1U5TB 1C24A 2P7CB 3BWGA 2FU4A 3WTUC 3IL2A 1GXPA 4M9XA 2GIVA 5ICGA 5E18F 3KP4A 4G6QA 3TB5A 3FXUA 3R61A 3H3UA 2JTVA 4F7ZA 4YFKF 4IHTA 5JHUA 4S04A 1CF7B 2IP2A 3KP6A 3T8TA 2BHCA 3BDDA 3ULQB 1TQMA 4FUKA 4U75A 1ZRDA 1O0XA 1DP7P 5KVRA 1ZLJA 4CDGA 5HS8A 2GU5A 2NQ6A 5AONA 4EJUA 4BAYA 1R23A 4MNUA 1FOKA 3MZYA 2EFQA 2ISZA 4IU6A 1XMKA 1T98A 3E6DA 3MCZA 4OMYA 2P99A 3HSRA 6PAXA 2EFWA 2DLLA 3DPLC 4NHJA 3WTWC 3BJAA 1IAWA 1RUOA 4JBAA 2NQ7A 2V79A 4LFUA 1FC3A 2M5WA 4RGXA 3BITA 4WK8F 3H3ZA 1QZZA 3IU9A 4A5MA 1XMAA 3CUOA 3TO9A 1P4WA 4WF2A 2OD5A 2QLZA 2EJRA 2ZO4A 4L18B 5L3DA 4UHTA 5CLSA 2Q0OA 1YLFA 3P9IA 2O03A 1LJ9A 4IKTA 1KQ8A 2L3DA 3GUDA 2Q95A 3RVAA 2CO5A 4KNYA 1REPC 1R36A 3HYIA 3CJNA 1KQ0A 2P6TA 2QQAA 3LQRA 1RIOH 5E8GA 4ZH4F 5FCFA 2WWYA 3FWEA 4I98B 3Q9SA 4ESJA 4HV5A 4ESFA 4G7OF 4L0YB 1G3YA 1NHAA 2QBYB 3IC7A 1UHWA 1VTNC 2OKNA 1BIBA 3R0JA 3MQ0A 3V4GA 5ED4A 2EA4A 1IN4A 2OQRA 5IT3A 3PQKA 3R6SA 4B8XA 3V8KA 3RPUA 4EJOA 2DK8A 1ULYA 4LLLA 2YU3A 1I1GA 2RGVA 1BI3A 1EH7A 5CVVA 2HZTA 5LGNA 5D8KB 4O5VA 5CE6A 1G3SA 3GF2A 2XROA 3WTZA 3GYHX 3Q6DA 2EFPA 1YJ3A 1TLHB 5K1YA 3BP8A 2VN2A 3O3KA 4U1BA 5FO5A 4WCGA 2HKXA 2FQ3A 2OU2A 1SD4A 4M73A 1JGSA 2CG4A 1YVMA 2D45A 4S00A 5BPIA 1N51A 3GWZA 3FF5A 4ZZDA 2A07F 1ZGAA 1Z9CA 2BWSA 2ZMEA 2V1XA 1R1VA 4IRGA 3HHHA 2LSOA 1IN8A 1RNLA 5E1XA 2JZYA 2ZNYA 4ETSA 3MZHA 4FKCA 1C21A 1K79A 4CYDA 2PG4A 3ZQ7A 3SXYA 1JAWA 2H27A 3B02A 2Z9OA 2ZCWA 4RGZ1 4MHGA 1ZRFA 3PKCA 2Q94A 1R5GA 4QWQA 1R7JA 3TDUC 2BHBA 2BBYA 5L3GA 2V3XA 1PV9A 2HYGD 2HQRA 4I0BA 3GX4X 1WL9A 2LF8A 5TJJA 1F1ZA 2JPBA 4OMZA 2K4JA 1QQIA 1F9NA 5F1RA 1WQ2A 1D3YA 3QPTA 2EVOA 2XAFA 4M74A 4MEYF 3KP5A 3QPHA 1T0FA 1WL6A 1MJBA 3GZ6A 4ENKA 4Q4ZF 4CICA 4RB0A 1QZYA 3L09A 2GWRA 1S29A 2EK5A 5E17F 1O3TA 1IN6A 2XV4S 2GG9A 3P9KA 3HOSA 3WG9A 5K5QA 4ESBA 2KIFA 1WSUA 2IW2A 5DD4A 2P5LC 4KA4A 1OPCA 1D8JA 2VBXA 3EYIA 5CVUA 2AS5F 1TW2A 3MFKA 3G73A 2STWA 5D6FA 1K7AA 4AWXB 2QWWA 1XNZA 3I5UA 1HXDA 4KMFA 4EM0B 3QP5A 4MATA 5DDGA 2IRFG 2VOPA 4LK1F 1BN5A 1YW7A 3BJ6A 4HA8A 5E1ZB 3M8EA 1QNTA 5LLQA 2Z5UA 1R1TA 2K27A 1D8KA 5HDKA 4LB5A 3KEOA 3JTGA 1MDMA 2DAOA 3HTUA 2COMA 5JFRA 4IF4A 1IXRC 4WX9A 5DCFA 3WTXC 2OAZA 4Y17A 4EGZA 3RIRA 4OIPF 5DUKA 3QU3A 2Y75A 3JSPA 1WN1A 3WGHA 4M6XA 2ESHA 1OKRA 4IKUA 4XLPF 4DNCA 3C1DA 4ENNA 2IPQX 1V3FA 1YTYA 1XCVA 3IKTA 4WXCA 1J9IA 3ZMZA 3I59A 3JTHA 4OIOF 4U0YA 1S7OA 2W85A 4UVAA 4EVIA 4ENMA 5HDNA 1ZHFA 2Z3YA 4U6ZA 4M9ZA 4HAMA 5ICEA 5E1WA 5LHGA 2B3KA 4RGSA 2E7XA 2FEZA 2WC2A 4GCVA 1RZ4A 4A0ZA 5AIPA 4O6JA 4M6YA 1WBQA 4Q5SF 4M9SA 4PCQA 3L2CA 2MLKA 4KUMA 5CDEA 2ZFWA 3KETA 4IJAA 2QVOA 2OQGA 1PUEE 1L0OC 1WI9A 4E70A 1XGMA 2HTSA 3RPQA 1MGTA 4UVBA 4HW0A 1I27A 3ZP5A 2Q92A 3GLXA 1S6LA 2EFNA 3RORA 4RB2C 3KZZA 3L7WA 3ZN0A 1CHMA 1FBQA 4MTDA 3TO6A 2GGBA 1JHFA 1R1UA 3FMQA 2E7WA 1TQPA 2CYYA 3CUQA 3VOEA 4G8XA 4NB5A 1H9GA 2DBBA 4U0VA 4B28A 4A0YA 4M71A 1P2FA 2KIMA 1Z6TA 3DPTA 5CJ9A 1TQIA 4R8HA 2RNJA 3HRUA 2DQLA 3E6BA 1KGSA 3FX3A 2XAJA 1F5TA 3M9AA 2FXAA 2XASA 4GYIA 3QP6A 4G94A 2P7VB 3SQNA 2GG7A 3HOTA 1T39A 1HBXG 3BROA 1XN7A 4BYYA 5CVJA 2M1BA 2QUFA 2GAUA 1W7VA 4KYWA 4MEXF 5TRDA 4EQQA 3T0YA 2A69F 3HSFA 1X3UA 5FLXZ 2D1VA 2Z99A 1KU3A 4L9JA 4RGRA 1FBUA 4HQEA 2GU7A 2V1UA 3HIFA 1JHHA 4YIFA 2KKOA 1O7LA 4KDPA 3J80Z 2Y48A 2FBKA 4UUVA 4BNCA 1E17A 3WGIA 2KIUA 4MQ9F 1U5TC 4OINF 5CYVA 3IU8A 4L0ZB 3QAHA 2XAQA 4G9YA 3W6KB 4YFXF 1EH6A 2FE3A 5JVTA 1R5HA 4P5OA 1QBJA 3F72A 2BWVA 2VBZA 5FCHA 5DD8A 4EV0A 4HX4A 2DQRA 1I6XA 3S2WA 1HKTA 4U88A 2JRTA 1S3JA 4HOBA 4FO7A 3HSEA 1C22A 3GFLA 5L3CA 3TQNA 2V6CA 1GHCA 1P4XA 2WTEA 2B3HA 4AD9A 3I0TA 3M7GA 4O3MA 1ZGJA 1SD7A 4ZNGA 3EETA 1O3QA 2UXNA 4IPAA 2DW4A 2MA3A 4L9TA 2BE5F 5L3FA 3N4MA 3PQJA 5D5UB 3GFJA 5FLXK 3BY6A 2M30A 2XAHA 1XCBA 3KEQA 4GYGA 1HKSA 1MJ9A 4FT8A 2DPUA 3RI4A 2M8EA 4N9HA 3SZTA 2V1DA 2D2WA 4CZZA 2L4MA 3J80K 3JSOA 5D8LB 4HF0A 2MATA 3J81Z 2NAZA 4BHBA 1G6NA 2K7LA 2NYXA 4PGHA 1DPRA 4L5IA 3L00A 2L02A 2GGCA 1C0WA 4P96A 3U2RA 5CNXA 4IRHA 4U76A 3HHGA 4KIFA 3GXOA 5L3BA 2L54A 4AIHA 3WTSC 1MDMB 3MEXA 4WXHA 2BWWA 1P4AA 3F21A 4OIQF 1UB9A 2IVMA 3KZYA 2MBFA 4P9UA 2GTXA 3ELKA 4KM3A 1MATA 1K78A 5LHIA 3ZMSA 2KJCA 4I02A 2A6HF 4PV4A 3H92A 1SD5A 4HXXA 3HRTA 1OMIA 3FMRA 4LK0F 4L9NA 5AIQA 3IU7A 3I59B 5ILVA 2OBPA 2XIGA 5HS7A 4ZYGA 5ICFA 3E97A 2YX7A 1YO5C 3SZPA 5FFZA 3L24A 3F8BA 4P55A 1HSTA 1KA8A 2PJPA 1USSA 4BHCA 2H94A 1Y1NA 5KK1A 3VODA 2GA1A 4AIJA 4KFCA 2ADUA 1TBXA 2STTA 3CTAA 4GXOA 3KP7A 1C23A 3ISPA 1EH8A 1H0MA 3TO7A 2FOKA 4ZWPA 1YS6A 1TW3A 2PLYA 2XHKA 5D5WB 1YW9A 2A61A 2Q93A 2AXLA 3ECHA 4Z2YA 3DP7A 2LKPA 3J81K 2P4WA 4LG0A 3HRMA 4S2TP 4ASNA 1TNSA 2FNAA 1IRGA 1XB4A 4HDUA 4R1HA 1AWCA 3R4KA 5CIKA 5BPDA 3RTRA 2BH3A 1B6AA 3EYYA 1LEBA 5J8FA 3KLNA 3BIPA 2BHDA 3GFIA 3IRRA 1LDDA 3CUQB 3I58A 3GVAA 2P98A 3VB2A 3MX6A 2NNYA 4KT5C 3BIQA 1G3TA 1QGPA 4QR8A 3I71A 2GXBA 4U7BA 1KYWA 3LAPA 5CDVA 4Z7MA 2KJBA 2A3SA 3E5QA 4Y13A 2R3SA 2E1CA 3TDZC 3DXJF 3F6OA 2F5EA 2HS5A 3BPXA 2GG0A 1DUXC 1R00A 2XVCA 3E5XA 4ENJA 4ZWUA 4U70A 3WTVC 4U73A 3LA2A 2DK5A 2F5CA 1J59A 2RDPA 4L9VA 2B3LA 3KP2A 5BOXA 2TDXA 2YPRA 2RC4A 4U6JA 1ODDA 2H6BA 3LQQA 1LVAA 3FMSA 2X0LA 1ZG1A 1BJAA 1A04A 2W25A 4BHPA 1TTYA 3MAJA 3FXRA 4A5NA 2B0LA 3WTTC 2BN7A 3LA3A 5ERIA 3K1PA 5FB2A 2JT1A 1T6SA 1J5YA 3IG4A 2PMUA 3LSTA 3QU6A 3V7CA 1YW8A 3BOQA 4IXAA 1R22A 3GZ5A 2F5FA 2MH2A 3VFZA 2HFHA 1Z05A 5ICCA 2NS0A 3CTZA 3K1MA 1F4KA 4IECA 2PQ8A 2EV0A 2HWVA 4UNOA 1O57A 2VONA 3T1BA 1YFHA 1BI2A 3EDPA 4I0AA 4AVPA 5ILSA 2BWUA 2FMLA 4U7DA 2EVMA 2L4AA 2QENA 3GW2A 3K69A 2HEOA 1BI0A 3RYPA 3RKYA 4BQAA 1G3WA 2CQKA 3F6VA 1WKMA 2CFXA 2FRHA 1KP0A 4ZYDA 2P9AA 4CGZA 1B9NA 4XBFA 2Q2EA 2M45A 5E5BA 4D0PA 1U8RA 5H6RA 4MGRA 1SMTA 3Q9VA 4HX7A 1G4DA 1QXWA 3CO7C 3I64A 2BHAA 2A5YB 1MKMA 4XRFA 3J7AO 1ZLKA 3DQVC 1WWXA 3DV8A 1R58A 4EM2A 3TOBA 4IKRA 3OV8A 1BC7C 2K4BA 2MC3A 4RGUA 2YX4A 5HLIA 1Z7UA 4G6DA 1XDSA 2ESNA 2P8TA 2V9VA 4I2OA 5DEQA 2VODA 4S05A 2LDUA 4ZWOA 2YSRA 4HZFA 3KCCA 1W2MA 5J8CA 2HOWA 4CO8A 2ELHA 2PBIA 2E1NA 3IRQA 1FP1D 1LEAA 3E3VA 1KQ9A 3ROUA 1GVJA 4A6VA 3GFMA 4S01A 4EGEA 2PFBA 3EQLF 4EGYA 2FNPA 5HS9A 1K78B 3LFKA 2QYOA 3ML6A 4LJZF 3U9GA 5EEGA 2RV8A 1W5TA 2O3FA 4KN7X 2EVCA 2ZXJA 1HW1A 4IRIA 2G7UA 5DCMA 2J5OA 2FBHA 1FY7A 2EB7A 1YS7A 4HX8A 3RKWA 3VEPA 4U6EA 3F22A 3RYRA 5ILUA 4FLKA 2YR2A 4GGGA 2GU6A 2EV6A 2IW5A 3IKVA 2M87A 2NRAC 4U0WA 2BGCA 2VE9A 2GXGA 4PNCA 3D27A 5BS6A 2GG5A 1S8NA 1HW2A 1WY2A 3CB5A 2DT5A 1CGPA 2LNBA 1M35A 1OYWA 2QM3A 4XLNF 5LBQA 1W4MA 5IT9K 2RQPA 2HYFA 2HR3A 4MQVA 1FPQA 2GA2A 3PKDA 1ONVA 1BM9A 1DPUA 2Q96A 4DQ2A 5JR3A 4LG0B 1Z1DA 1OYYA 4FLJA 1E2XA 4N9IA 1O3RA 4FX0A 2KRFA 3FM5A 5H20A 3I53A 3L9FA 3BPVA 5K5RA 3KE2A 3SFZA 3RJPA 1HSJA 1DDNA 4Q48A 4IDYA 4UV9A 2FA5A 4HYEA 1SFEA 4G7HF 1UHMA 4HF1A 2DTRA 2K02A 1OR7A 3S6BA 1TNTA 1O7FA 3F8NA 2HDCA 1BIAA 2V3YA 1K6OA 3N97A 4KN4X 1LNWA 2W24A 2HOEA 2H6CA 1MZBA 4JUQA 2VXZA 2BWTA 2K86A 4HDVA 3R60A 1RI7A 2PI0A 4LLGF 4A2UA 4R79A 3QRFF 3M1EA 2O61A 4KMUX 3O6BB 1I5ZA 5CVRA 4HLXA 4R60A 2BWYA 1W7PD 1H9TA 2W57A 4LGWA 2VC1A 3W6JB 1SAXA 2DU9A 3KLOA 3F23A 2XUBA 3CB6A 4RB1A 1Z6RA 3RDIA 1T2KA 3F8CA 4PZJA 1QO0D 3BJOA 2G7HA 3ZMUA 1B59A 1ZN2A 3CLOA 4FO8A 3KFWX 4HBLA 1FP2A 4OIRF 4OOIA 1XD7A 3TGNA 2BV6A 4OU0A 4L5JA 3V7RA 1HW5A 3JAMZ 1YYVA 1XSVA 1STZA 2X4HA 3OOPA 4KIGA 1J7KA 3NEUA 1XDUA 2BYVE 3ZMTA
chains in the Genus database with same CATH superfamily
2IJLA 3S32A 5LHHA 4AIKA 2ECBA 3K1NA 2V3ZA 3S1RJ 3FZVA 4CHUA 4U6CA 4RAYA 1IJWC 2F4MB 2HDDA 2BEOA 2DJNA 3QOPA 2QSGX 5FJ8J 3TAVA 3WU1B 1FLIA 2G6PA 2CUFA 5EZHA 4B09A 1SMYF 5EG0A 1VQLI 3K6GA 1IRXA 3LL7A 4Y7NJ 3BG5A 1XS9A 3CCSI 4FLIA 1W5CC 1SAUA 5LD2C 3ZGKA 1A16A 3GEZA 5HLHA 5HNFA 3MATA 5E20A 1XTAA 3OWTA 1YX3A 2CWEA 5A2QZ 2Y30A 2ACJA 1IN7A 4EMSA 2LK2A 4NC6A 2NVQJ 1IXCA 1Y6IA 1IV8A 2WBMA 3QOEA 4I7HA 3T8RA 3JRDA 5TISC 1K4TA 1JI8A 1FOWA 1XC5A 3LSPA 3AG4H 4I01A 1QVTA 2W48A 1HQCA 4UV8A 3DCFA 2K9QA 4XKBA 2VC0A 1S72I 4S2RP 1MMAA 3F8FA 4LLNA 1ZGWA 1G2HA 3E6MA 4HG2A 2QQ9A 3GO5A 1UZCA 2QSFX 1W0UA 2P6SA 4FE4A 2NOJB 1B9MA 1MD0A 2D1HA 1FBSA 3FXLA 3CMYA 1ZG5A 4WXDA 1YG2A 1L3LA 1RETA 2DA5A 1OISA 2ID6A 4QIWN 4RAFA 4BEHA 1Z67A 1OJLA 3ZQIA 1QU3A 4BUPA 1VQ5I 2DFHA 2KZGA 3PKEA 2VBWA 2V7FA 2ZJPF 1IUYA 5LGTA 1IRFA 3PIOF 2Q1ZB 4RAZA 2YUSA 5L3EA 5DV5A 2DO7A 1XSDA 1FNNA 1UCRA 2RVCA 2BWXA 3DKWA 4FHTA 1FWZA 5FD5A 3D0SA 2CV2A 1QPIA 5FKNA 4YG2F 2XPUA 2FJ1A 2M0CA 4CZCA 1FZPB 2VBYA 4LMYA 5GAEJ 2GQQA 1BI1A 3MMYB 4RZYA 1ZKGA 1ZYRF 3L7GA 3WE3A 1SFUA 1B8IB 1X1PA 2B63J 3ZQFA 1PP8F 2Q8KA 1FSHA 5GTHC 3OYHA 4CSWA 3JAMK 2BY0A 3ZXSA 2M4KA 2FUG2 2ZKZA 3HUGA 4HV6A 2Y0SA 1ZH5A 1Z3YA 4RB3C 2R7OA 4Y15A 1XGSA 2HTJA 3S1MJ 1FYMA 4XKWA 2LF7A 3K2ZA 3DEUA 3IWZA 3HPHA 2P5VA 5E79C 3PKAA 2FMYA 1P7JA 2GBYA 3B73A 2DI3A 3CCJI 4JQFA 1VQKI 4IVNA 1W7PA 1EV7A 5M3FJ 3K4NA 3G3ZA 3BZ6A 2WV0A 1AOYA 1IZ1A 1V5FA 3FXQA 2PMHA 5KAFC 2V6EA 1UFMA 4IKFA 3HRSA 2O8XA 3FXOA 3K2AA 1IF1A 1GXQA 5D4SA 2XGXA 3IH2A 1ZARA 3V8JA 2TRTA 1D5YA 5A2QK 4BXUA 1FEXA 1OCRH 2KRHA 4U69A 5F64A 2ISYA 3SDGA 1MBKA 3BR3A 2GG8A 1P92A 2DOFA 4A6EA 3FM3A 1RUNA 2UWMA 1D0XA 1KU2A 1WJFA 4HF2A 1P6RA 2GZWA 2OZ6A 5J1UA 2HVSA 3H9JA 2JVGA 3V7SA 3DLLF 1TWAJ 4GFBA 4ZDLA 2FSWA 1UMQA 5FFXA 4ANJA 5FD6A 2FF4A 2JA8J 3FXMA 5DCMB 2C6YA 1YQAA 2XKPA 3ZPLA 1LDKB 1J0RA 3CUQC 1SVLA 5KNLA 3P7NA 2JQ7A 5K7FA 3ERED 1Q1HA 3B6AA 2RQQA 3WTYC 5F0HA 4IOAF 1MMNA 2L9SA 2P0WA 1PDNC 1ON2A 2EV5A 1FYKA 3DFGA 1USTA 1V4RA 2DJIA 2OZUA 3S3OA 4IHSA 4FX4A 4U6WA 1YIOA 4BY7J 1S7AA 5D5XB 5LRSA 3ZMDA 3RKXA 3E6CC 4RAGA 2IS1A 3AG1H 3VYRB 2E34A 3WGGA 2R7SA 3IV5A 1D5VA 1U6GA 3SHFA 1FJLA 2I5UA 3N05A 3LAJA 1U5TA 1WH5A 3TOAA 2MH9A 2LH9A 5BQTA 3PSIA 1YIJI 5B1BH 2GZ5A 4XSZF 4LD5A 2KQRA 1D1BA 2X6XA 2VB6A 1ACIA 4A12A 1WLRA 5C4XJ 2GU4A 4A93J 4NQWA 1JXSA 3DF8A 3C18A 1XGOA 3ASNH 5HLTA 3L2VA 2Z33A 2M34A 5B1AH 2DTZA 4UUSA 1LVKA 4A3JJ 2ZSHB 4FTHA 1H8AC 3U1DA 1FTZA 2M4GA 3V8LA 2L7FP 1PUFB 2R7DA 3JW4A 3PKBA 1TWHJ 2MLGA 2DODA 3REOA 5D5VB 4DBQA 1CF7A 2HVRA 3CCRI 5GAHJ 1JE8A 2LP0A 2M7BA 2Y9ZA 2ZJ2A 4V2FA 3BQYA 3MKYB 4IHYA 2DFIA 3ABMH 4YIIA 3ZMVA 3WU0A 2I8DA 2LMDA 1JJ6C 3T5XA 4IKSA 1BOBA 4D5CA 2IA2A 4BQOA 4RZZA 1JTYA 3BR6A 1UJ8A 4B44A 3K7AJ 4PDKA 3HM5A 1ZG3A 3M4OJ 3FK7A 3P9CA 4L5EA 4DYQA 1U78A 3H5RA 2JRMA 1S7EA 4IQJA 3K4LA 1Y0UA 4XSXF 4CCMA 4MTEA 2HKOA 2CW7A 1XGNA 1ETQA 4ZZLA 2OPTA 3IHUA 2JPCA 2H09A 5FLMJ 3H35A 3IWFA 4AYBA 3KP3A 3HXLA 5D6EA 3ZQCA 1D1AA 3LWFA 4S0HB 5DYMA 2CW0F 3RSNA 1UELB 4ZDPA 2ZXIA 1Z7LA 5J4YA 2HOTA 2EIJH 2QQBA 5LEJA 3CO6C 2Z2SB 3ECOA 2VKHA 5LGUA 3A0HC 4CXFA 1V5GA 3HPGA 1LB2A 1VFCA 1IN5A 3Q5FA 3Q0UA 3ZR8X 2IA0A 4KIBA 1BC8C 4A0XA 4U71A 3MKWB 1POGA 1N75A 2JSCA 2R7FA 4ON0A 4EM1A 2R7UA 5FKMA 1C27A 2LR8A 4BQNA 3KYDB 3CESA 4A3FJ 4XQFA 5BMZA 4P9FA 2ZXWH 1IW7F 1BBYA 4LG3A 2DPDA 4OOKA 2L5QA 4DYRA 4JK1X 1KU9A 2JK3A 1SD6A 5F0FA 4B4CA 4E7SA 1JKOC 2LOOA 5FLVA 1BW5A 3C3WA 1OYIA 1FOYA 3G4SI 2IGNA 2G9WA 2L01A 3G2BA 4GDFA 2E60A 1HKQA 4ITVA 2Z1DA 2PN6A 5LEKA 2L7ZA 4LOCA 1BR1A 4LB6B 2W84A 1MBJA 4UXNA 2GG2A 2QZ8A 4TV7A 3L2WA 3DKYA 5EEHA 3QODA 4BDZA 1F36A 4EJTA 1TT0A 3OSGA 3SJMA 2L7MP 2RKHA 4RMNA 2JSPA 3X2QH 1MMDA 1ETVA 2MFZA 2K9MA 4UB8C 5HOOA 2GG3A 4BE2A 4WWCA 2QSHX 2HPIA 1Z91A 3O8HA 2QBYA 1J2XA 3FHZA 5EEAA 4KITB 2Y9YA 5DM7F 5JI6A 3JRBA 3F3XA 2BB7A 4BH9A 4HLYA 5IY5H 1MJAA 2M0MA 2NNNA 3L2RA 3S2HJ 4IL6C 5IT9Z 3MR1A 5H6QA 2EWNA 1YX5A 4XKVA 1A5JA 3NRVA 3PFIA 4M72A 4DYCA 2F2EA 2VJIA 4QPQA 3GTJJ 3GTGJ 5EG0B 4Y3OA 2KRCA 4A6WA 2DFEA 2ETHA 1U3EM 3KIOA 4NC8A 2UZKA 2BVLA 3O2PE 3ZCOA 3OYDA 2ZNZA 4ZYEA 1A6IA 3DPUA 2LY9A 3S14J 1K61A 2PEXA 2IA1A 2JVHA 3HB9A 5M5XJ 2O6GE 4A3CJ 5C4JJ 2HPMA 2XB5A 3U21A 2HQAA 2O0YA 2OV7A 3ABLH 1FX7A 2E5ZA 4C30A 4QLCU 1FT9A 1ZRCA 2RN7A 3SYTA 3ESWB 4K2EA 5FGMA 3I54A 4DW6A 4A3EJ 3C7JA 2NOGA 1I3QJ 4A6DA 3CLQA 3J7ZI 1K6YA 2AXTC 3K9TA 2DA4A 2ZXHA 4IF7A 2KDZA 2HOSA 1MBEA 1SVMA 3EUHA 1O3SA 2V1NA 1FIPA 1KYZA 2IEKA 4PSXA 2HU9A 4XK4A 5F0CA 1IDZA 1WJCA 5E8IA 3VYTB 1OCOH 4CYCA 3BR2A 4G7ZF 1EKEA 2XRNA 3CF2A 5D4RA 4JP0A 2XAGA 5LFAA 1VNDA 3FKIJ 2PX9A 2R93J 1T38A 4PJMA 3HKZA 3JRCA 4BQQA 2HGCA 5J6XA 4FLLA 1G8XA 3QYFA 4E7IA 3MKZA 4JX5A 3LA7A 4FCYA 4F92B 1KONA 4PGGA 1W5SA 4XOTA 2E71A 3ZQQA 3HOVJ 1K4SA 3F8MA 4RS8A 2ELJA 3L2QA 5CDLA 1ZREA 3S3MA 4KICA 2VT3A 3OIOA 3JREA 5HLGA 3WE2A 3UR3C 2A68F 5HDGA 1JTXA 2HZDA 1QPMA 4I09A 4EJWA 3WODF 1JUSA 5CVIA 2QCOA 2EA2A 2DA1A 2VOOA 3ZN1A 1B1BA 1HDPA 2M7AA 2IT0A 5M3MJ 2VQCA 2Y0MA 5KAIC 2CQNA 3HUGB 3PNYA 1R9TJ 1IXSB 1FOXA 2DYRH 2GIZA 2J5PA 1U2WA 2VE8A 2UXXA 2DMQA 4NNJA 3QPSA 2P5KA 5K5OA 3AAFA 1AKHA 1SFXA 3EUKL 2E1MB 1LQ1A 2CGPA 1BOAA 2CV0A 1I1SA 3QPLA 1PP7U 2MD0A 3I4PA 1J75A 2A6EF 3W2WA 1ON1A 5E3MA 3AL0C 1W7PB 1I50J 1WPKA 2K85A 1PUFA 5HVQC 2LD5A 3R0AA 4HPQA 2F5DA 1FSEA 3HTSB 2ZSGA 4E4HA 4H0EA 4YELA 4UVCA 1OCPA 3CCYA 1QXYA 2MGQA 1ZAOA 3BZCA 3CDHA 4ZYHA 3M8FA 4XRSA 1FYLA 1TWCJ 2VJJA 3TKYA 2CSOA 3NWSA 1N25A 2OA4A 1TP4A 2UV1A 4HQMA 2EH3A 3SEQA 3ABTA 3K0LA 1QXZA 3LMMA 1XSXA 4EJVA 1R4NB 1WRJA 3NQOA 3MWMA 3H0DA 4H4KC 4OAZA 2FBIA 2HI3A 1KU7A 1QHHD 5DUIA 2EFOA 2X1CA 5LRRA 4F55A 1E0EA 1RKTA 4Q47A 5F6FA 3COAC 5J40A 4M6VA 4BXFA 1B4AA 2ZMEB 1Y8RB 2VT2A 3E5UA 5FRNA 3ABUA 2MD5A 3D5LA 4GO1A 4N0BA 1LDJA 2EZKA 3FDYA 3KEYA 2IGKA 4NC7A 3SFIA 4Y52J 2L2OA 2EBIA 2ZBKA 2CV1A 2XKOA 2HQNA 4YFNF 2XSDC 3RPUD 3H9QA 1U5TB 1C24A 2P7CB 3BWGA 2NVYJ 3HEFA 1WJEA 3K4BA 2DMNA 3H36A 2FU4A 3WTUC 3IL2A 4BGDA 1GXPA 4M9XA 2GIVA 1RPWA 4NQWB 5ICGA 2DOEA 4E7ZA 2ZSIB 5E18F 4YEJA 4UUSB 2OTLI 3KP4A 4G6QA 3TB5A 3FXUA 3R61A 1R49A 5E3OA 3H3UA 2JTVA 3S8PA 4F7ZA 4EEFG 3A03A 2LG4A 4YFKF 1SC7A 4A3LJ 5DM6F 5GPCA 2NVXJ 4IHTA 3DBHB 1X1DA 2CRGA 5JHUA 2LREA 4S04A 1VQPI 1CF7B 3B6CA 3SEZA 2IP2A 4FISA 4F3QA 1LE8B 3KP6A 3Q3SA 4BY1J 3T8TA 2BHCA 3BDDA 2VJ4A 3ULQB 1TQMA 4YRVA 3HOXJ 4FUKA 4U75A 1ZRDA 1JUMA 1WI3A 3GMEA 1O0XA 4D1QA 1Z0XA 1DP7P 5KVRA 1ZLJA 3WHCA 4CDGA 5HS8A 2GU5A 2NQ6A 3PNTA 5AONA 4EJUA 3OSFA 4BAYA 1R23A 4MNUA 1FOKA 1SANA 3MZYA 2F4OB 2EFQA 2ISZA 4IU6A 1XMKA 1T98A 3E6DA 2GLOA 3MCZA 2W7NA 3JRHA 4OMYA 3RZOJ 3E1SA 2P99A 3HSRA 6PAXA 2EFWA 3VWBA 1LKXA 4X1EA 2DLLA 3DPLC 1HDDC 2N8GA 4NHJA 2OC6A 3WTWC 2E5NA 4IOCF 3BJAA 5C3EJ 3CJTB 2VQLA 1IAWA 3BG3A 1W36C 2PJRA 4XM3A 1RUOA 4JBAA 2NQ7A 2V79A 4LFUA 1FC3A 5JLXA 1VQMI 2M5WA 4UY8I 4RGXA 3BITA 3DU5A 4WK8F 3H3ZA 1GLNA 1QZZA 2VKEA 4A5MA 3IU9A 1XMAA 2XF6A 3CUOA 3TO9A 1PYVA 4DZPA 3I55I 4KT6A 2AQFA 3HL2A 1R5ID 1P4WA 2BY1A 2HDWA 4WF2A 2OD5A 2FX0A 2QLZA 2EJRA 1MSFC 2ZO4A 5F1JA 4L18B 5L3DA 4UHTA 5CLSA 3CC2I 3I3LA 2Q0OA 5IP9J 1YLFA 3P9IA 3I4NJ 2O03A 1LJ9A 4IKTA 2B9SA 1KQ8A 4A69C 2L3DA 2EPFA 3HOUJ 3GUDA 1UG0A 2GOXB 2CO5A 4KNYA 1REPC 2Q95A 3RVAA 1JGGA 1R36A 4OAYA 3HYIA 2VKVA 3CJNA 3P5JA 2MABA 1KQ0A 3OYCA 2P6TA 2QQAA 3LQRA 4A3MJ 1RIOH 3HDDA 3OS0A 5E8GA 3JCUC 4ZH4F 3M1CA 5FCFA 2WWYA 3FWEA 3GTQJ 4I98B 3Q9SA 4ESJA 4I99C 4HV5A 3WHBA 4ESFA 4G7OF 4L0YB 1G3YA 1NHAA 3LFUA 2QBYB 3IC7A 3H3VK 1ZQ3P 1UHWA 1VTNC 1JT0A 2OKNA 1BIBA 3R0JA 3MQ0A 3MZ8A 4X6AJ 2L9RA 4XLHA 3V4GA 2EZIA 2EA4A 3IAM2 5ED4A 3BT9A 1IN4A 2OQRA 3HBLA 5IT3A 2KISA 3PQKA 3R6SA 4B8XA 1OLTA 1WGXA 3V8KA 1PVEA 3RPUA 4EJOA 2DK8A 2QF7A 1ULYA 2F48A 3CC7I 1X19A 2WAFA 4LLLA 2YU3A 2JMWA 3G1OA 2BW3A 2VXDA 1I1GA 2XGCA 4QTRA 3OS1A 2RGVA 4B3AA 1BI3A 1EH7A 4XN0A 4PJNA 5CVVA 2HZTA 4CCKA 2E2HJ 5LGNA 3SDBA 5D8KB 1YJ9I 2L0KA 4O5VA 5IYCJ 5B3SH 4HSTA 4BACA 2VPLA 5CE6A 1G3SA 3GF2A 2XROA 3WTZA 3GYHX 1QA6A 5F27A 3Q6DA 1BR2A 2EFPA 3OYLA 1YJ3A 2HXOA 3H9GA 4MFEA 1TLHB 5K1YA 4CH7A 1DP3A 3BP8A 2WADA 1YHQI 2VN2A 3O3KA 4U1BA 1WH7A 3J7AY 2X6YA 3K10A 2JUGA 3S1NJ 5FO5A 4WCGA 2HKXA 3EUAA 3K4JA 3WU2C 2FQ3A 2E2JJ 2OU2A 2QKLB 4CYCB 1SD4A 4M73A 1JGSA 1UAAA 3OIPA 2CG4A 3M07A 1YVMA 2D45A 4S00A 3OYEA 5IOZA 5BPIA 1JKRC 4XLEA 1N51A 3K4MA 3VSKA 3GWZA 3FF5A 3C2GA 4Y33A 4ZZDA 2VI6A 2A07F 1ZGAA 3I4MJ 1Z9CA 2LC2A 2BWSA 1EA3A 2ZMEA 1O4XA 2V1XA 4KJZA 3OY9A 1R1VA 2Y2ZA 4IRGA 2IXSA 2KL4A 2LSOA 3HHHA 1IN8A 1RNLA 1A31A 5E1XA 2IAIA 2JZYA 4II3A 2ZNYA 4ETSA 3MZHA 4FKCA 3DTIA 3RQIA 1VQ6I 1C21A 1K79A 4CYDA 3G6EI 2PG4A 3ZQ7A 3SXYA 4AUXA 5HNHA 4J19A 2CH0A 2H27A 3B02A 1NTCA 2Z9OA 5J47A 1JAWA 3PUBA 1IRZA 2ZCWA 4RGZ1 4MHGA 1ZRFA 3PKCA 2Q94A 4RA2A 1R5GA 4QWQA 2R7RA 1R7JA 2DA6A 3TDUC 1WZ2A 2X6OA 2E1OA 2BHBA 2BBYA 1WJAA 1AKHB 2HOAA 1ETYA 5L3GA 2V3XA 3CMAI 1PV9A 2HYGD 1AA7A 4ZTFA 5CQGA 2HQRA 4I0BA 3GX4X 3BG6A 1WL9A 2LF8A 2VPRA 5TJJA 1F1ZA 2MC4A 2LKSA 2ZFUA 4MIMA 2JPBA 2XF5A 2K4JA 4OMZA 5J1RA 4P1WA 1QQIA 1F9NA 2KLOA 5F1RA 1WQ2A 1D3YA 3QPTA 2EVOA 1T33A 1LE8A 2XAFA 2KZVA 4M74A 4UB6C 2JA6J 4MEYF 3FIWA 2JJ7A 3KP5A 3QPHA 3AKZA 3PIPF 3CMEI 4A3KJ 2FOWA 4XLFA 1T0FA 2WB1N 1WL6A 3FISA 1S5LC 1MJBA 1FMVA 3A01A 2VQHA 1ETKA 3GZ6A 2HQ5A 4ENKA 4Q4ZF 1D0ZA 2DA3A 2Z16A 3TP0A 4CICA 1HOMA 4XICA 1OQYA 4RB0A 1T56A 5EYRA 4CCJA 1ETWA 1QZYA 4JOMA 1NG6A 1OR7C 2BY2A 3L09A 3HGYA 2GWRA 2IS6A 1S29A 1A35A 2EK5A 3FKJA 1O3TA 3W6VA 5E17F 1IN6A 2XV4S 2GG9A 3P9KA 3HOSA 3MD2A 1BR4A 3WG9A 5K5QA 4ESBA 3BLYA 1DGWY 2TCTA 1EF4A 5GADJ 2KIFA 3IAS2 5H2FC 3GZNB 1WSUA 2JA7J 2IW2A 3LSMA 5DD4A 3DBLB 2P5LC 4AVZA 4KA4A 2V9PA 1TT5B 1OPCA 1D8JA 2VBXA 3EYIA 2W1OA 5CVUA 2AS5F 2EQRA 3PO3J 3F0CA 1TW2A 3MFKA 3G73A 2EILH 1MNEA 5FROA 2STWA 2XGEA 3M3YJ 4M3FA 5D6FA 3LSJA 1K7AA 4AWXB 3QYEA 1ZR2A 2QWWA 1XNZA 2DA2A 3I5UA 3GTOJ 3BG7A 1HXDA 1X1BA 5FKLA 4KMFA 4EM0B 3QP5A 1NH3A 4MATA 2X48A 2HVQA 4JX6A 1ZTRA 2BOLA 2K40A 5DDGA 4NBQA 1X58A 3PO2J 2IRFG 2VOPA 3NARA 4LK1F 1BN5A 1YW7A 3BJ6A 3VSLA 4HA8A 5E1ZB 2VLAA 2E36A 3HG9A 2E35A 3M8EA 3ONQA 3JRIA 1QNTA 4C3JJ 5LLQA 2GXAA 2Z5UA 1R1TA 3L2UA 4RDUA 2K27A 1D8KA 3KZIC 5HDKA 3ERMA 4LB5A 1U9NA 2ELKA 3KEOA 3IP4B 1T08B 4W1UA 3JTGA 2ZB9A 3BR5A 1MDMA 2DAOA 3HTUA 2COMA 4M3GA 5JFRA 1Y0NA 4IF4A 1ZELA 1IXRC 2DMUA 2CS3A 2NVTJ 3S2DJ 3Q0WA 5DCFA 4WX9A 5M5YJ 2WA0A 5K7HA 3WTXC 2OAZA 4Y17A 1N77A 5E3LA 3K70C 4HRIA 4EGZA 1IV6A 2EZLA 3RIRA 3S3NA 4PFPA 3CJQB 4OIPF 3BR0A 5DUKA 3QU3A 3CF5F 3OL4A 2Y75A 3JSPA 1WN1A 1ETOA 4M6XA 3WGHA 3OYAA 2ESHA 1OKRA 1AU7A 2PJRB 4XLPF 4IKUA 4DNCA 3C1DA 3KYCB 4ENNA 1Z77A 2IPQX 1RKWA 1V3FA 2BVMA 3PSFA 1YTYA 1XCVA 3IKTA 4WXCA 1J9IA 1X3ZB 3ZMZA 2BY3A 3I59A 4YIRX 3JTHA 4OIOF 4U0YA 1S7OA 2W85A 4UVAA 4EVIA 3OMYA 2WAQN 4ENMA 2KP6A 1ZHFA 2EZHA 5HDNA 2Z3YA 4U6ZA 4M9ZA 4HAMA 5ICEA 5E1WA 5LHGA 1YE9A 4XLAA 2B3KA 2IBDA 4RGSA 1X2NA 2E7XA 2FEZA 2MSYA 2WC2A 4GCVA 1RZ4A 4PJ0C 5DS9A 4PSWA 1M1EB 4MFDA 3D5RC 4A0ZA 5AIPA 4O6JA 5F04A 4M6YA 1WBQA 4Q5SF 4M9SA 4PCQA 3L2CA 2E2IJ 2MLKA 4KUMA 1MIJA 5CDEA 3DEWA 2H8RA 2ZFWA 1R4MB 3KETA 5GAGJ 3PJRA 3TMOA 2R7XA 2K9NA 4IJAA 2QVOA 2OQGA 1PUEE 3GCMA 1L0OC 1WI9A 3CDIA 4E70A 1XGMA 2HTSA 3RPQA 1MGTA 3AG3H 4UVBA 4G6TB 4HW0A 1I27A 2DYSH 3OS2A 4D5FA 3ZP5A 3DKXA 2Q92A 2PMZN 3GLXA 5CPRB 3HOWJ 4ZDOA 1S6LA 2EFNA 1HLVA 3RORA 2KIQA 4RB2C 2LBFA 3KZZA 3L7WA 4RBOA 2LY2A 3ZN0A 2BHZA 3A02A 4E7HA 1CHMA 1BJZA 5IOYA 1FBQA 4MTDA 5BNGA 3TO6A 2GGBA 1JHFA 3E7LA 3TEDA 3WG7H 4BKXA 1R1UA 2KHMA 3F9KA 3FMQA 1ITYA 2E7WA 1TQPA 3DU6A 1P9QC 2CYYA 3CUQA 3VOEA 4G8XA 4BDYA 2BW3B 2NXNB 4AIDA 4NB5A 1ERDA 1H9GA 1FIAA 2K9LA 3PL8A 2DBBA 4U0VA 4B28A 4A0YA 1ZR4A 4M71A 1P2FA 2KIMA 3JR9A 1AHDP 5JLWA 5IP7J 2L9NA 3TL4X 2KMUA 4CCNA 2OCEA 1Z6TA 3DPTA 5CJ9A 1TQIA 4R8HA 2R92J 2RNJA 3HRUA 2DQLA 3E6BA 1KGSA 1P7IA 1LFBA 3FX3A 2XAJA 1F5TA 2V26A 3M9AA 2FXAA 2XASA 3CP2A 4XNFA 3PFYA 3FXJA 3QP6A 4GYIA 4G94A 2P7VB 3SQNA 2GG7A 4FE7A 1YJNI 4ZC3A 2CQXA 2HYJA 3JRFA 3HOTA 2BHYA 1T39A 1K83J 1HBXG 3BROA 3FK6A 1MBGA 1XN7A 4BYYA 5CVJA 5EJCA 2M1BA 2QUFA 2EIKH 5GPAA 2GAUA 3PM1A 4PJJA 1MNMC 1W7VA 3VPRA 3PNVA 5EF6A 4KYWA 2X9DA 4MEXF 2JN6A 1Y1WJ 1VQ4I 2Y31A 2JUCA 5TRDA 2AHQA 4RLFA 4EQQA 3T0YA 1CQTA 2A69F 2H1LA 1E3HA 1Y56A 2XDVA 3HSFA 1X3UA 5FLXZ 2D1VA 1X4OA 4N4NB 2Z99A 1KU3A 4L9JA 4RGRA 1FBUA 3OYKA 4HQEA 3GLLA 2GU7A 2V1UA 3W3CA 3HIFA 1JHHA 3H0GJ 4YIFA 2KKOA 1O7LA 3ZRGA 2X6WA 4KDPA 2R4GA 3MN2A 4ABZA 5IPAA 4XMYA 3J80Z 1QZEA 2Y48A 2FBKA 4UUVA 4BNCA 1E17A 3WGIA 2KIUA 2W82A 4MQ9F 1U5TC 4OINF 5TGTA 1IUFA 5J4VA 5CYVA 1WJBA 3IU8A 1Y39A 4L0ZB 1W1WE 3QAHA 2X1DA 2XAQA 4G9YA 1S9HA 3W6KB 3W2VA 4YFXF 1EH6A 1Y1VJ 2FE3A 1XX5A 2H8WA 4DGWB 5JVTA 1R5HA 4P5OA 3ZQLA 1QBJA 2DT7B 2KDOA 2LVSA 2CUZA 2XF7A 1JJ8C 2CUEA 3BG9A 4BBRJ 3F72A 2K3PA 4MLOA 2VIXA 2JA5J 2BWVA 2HNHA 2VBZA 5FCHA 1IG7A 2R5YB 5DD8A 4EV0A 4HX4A 3V42A 4AM3A 4KISA 2DQRA 1I6XA 3S2WA 2YU9J 1HKTA 4U88A 1VQOI 2CMPA 2JRTA 1S3JA 4HOBA 2KFDA 3CZ6A 4HNUA 2QGUA 4FO7A 3HSEA 4QSHA 1WHUA 3CQZJ 4JYKA 1JUPA 1SFKA 1GHCA 4PJLA 1C22A 4IHWA 3GFLA 2XGDA 4N4OB 5L3CA 4JX4A 3TQNA 2V6CA 1X1CA 2WV1A 2I10A 3BCAA 3E0JB 4QPOA 1P4XA 4PK4A 1G59A 4BXXJ 2WTEA 2B3HA 1YI2I 3BC8A 2CQQA 1Z21A 3A01B 2CJJA 2DDAA 2ME6A 4AD9A 2ZC2A 3I0TA 3M7GA 4O3MA 1D0YA 1QVUA 3RQ4A 1ZGJA 5FKOA 2W00A 1SD7A 4ZNGA 3DEEA 2L7KA 1YITI 4F93B 3W2AA 3HGGA 3GTKJ 4F52A 3EETA 5GP9A 1R6RA 1O3QA 3OIQA 2UXNA 4IPAA 4XKCA 2DW4A 2MA3A 4E7LA 2DFFA 2G0EA 2BE5F 4L9TA 5CQEA 4I6ZA 4XRSG 2NVUB 5L3FA 3N4MA 1BA5A 3PQJA 4J00A 4IQ4A 2V9KA 5D5UB 4XIDA 1T8IA 3GFJA 2IS2A 1OFCX 3IH3A 3GTMJ 5FLXK 4BE0A 3BY6A 2M30A 2XAHA 3AG2H 1XCBA 2FQ4A 3KEQA 5J3LA 4PFOA 4GYGA 4BJTA 1HKSA 4IX7A 1JKPC 1MJ9A 4FT8A 2DPUA 4C3HJ 2M8EA 3RI4A 4N9HA 3OYIA 3SZTA 2K9SA 2V1DA 2D2WA 4CZZA 2L4MA 5F08A 3J80K 3JSOA 5D8LB 4HF0A 3Q0VA 2MATA 3J81Z 1ETXA 2NAZA 4BHBA 1G6NA 2K7LA 2NYXA 4PGHA 1DPRA 4L5IA 1I3AA 3L00A 3KYLA 4M3BA 2L02A 2GGCA 3GTLJ 1C0WA 3ZQHA 4IHXA 3AFHA 4P96A 2W4SA 3U2RA 4E7KA 3C2HA 5CNXA 4IRHA 2V4JC 3S1QJ 1PJRA 4U76A 4BJ5C 3HHGA 3LSRA 4KIFA 3GXOA 5L3BA 2L54A 2ID3A 1V5EA 4AIHA 3WTSC 1MDMB 3MEXA 3I9V2 4WXHA 1YRNA 2BWWA 1P4AA 3F21A 4OIQF 1UB9A 2IVMA 3KZYA 2MBFA 1ENHA 4P9UA 2Q2EB 4DBRA 9ANTA 2GTXA 3ELKA 4KM3A 1MATA 1K78A 5LHIA 3ZMSA 2KJCA 2XC7A 1VQ9I 3K4CA 4I02A 3CCEI 1HA8A 2A6HF 4PV4A 2ECCA 4FQGA 3H92A 3C2BA 1SD5A 5EGOA 3HRTA 4HXXA 2IGMA 1WCMJ 1OMIA 3FMRA 4LK0F 4L9NA 5HODA 3MVPA 5AIQA 3IU7A 3LSHA 4FASD 1WJDA 1U8BA 2BXYA 3I59B 5ILVA 1I6HJ 2OBPA 2XIGA 5HS7A 4ZYGA 5ICFA 3E97A 2YX7A 4BJ6C 3SZPA 1YO5C 1MMSA 3A4CA 2O8KA 3CJRB 5FFZA 5JHFA 3L24A 3F8BA 3UNGC 3KX2A 3ZQGA 4P55A 1HSTA 2K5CA 1W36D 1KA8A 3DTEA 2R5ZA 2PJPA 3ASOH 1USSA 4BHCA 2H94A 1Y1NA 5KK1A 1LFUP 2K3FA 1YJWI 3VODA 2GA1A 4AIJA 1SFOJ 4KFCA 2ADUA 1MNDA 1TBXA 2NS8A 4LIVA 3EUHC 2STTA 3CTAA 4GXOA 1WVRA 2A05A 2CU7A 3KP7A 1C23A 3TP3A 3ISPA 4HSRA 4IZZA 4D7NA 1EH8A 1H0MA 3TO7A 2FOKA 4ZWPA 1YS6A 2VASA 1TW3A 2PLYA 2XHKA 5D5WB 1YW9A 2A61A 2Q93A 1VI0A 2UUZA 2AXLA 1R71A 1LUJB 3ECHA 4Z2YA 1RR8C 3DP7A 1X2MA 2LKPA 3J81K 3BTIA 2P4WA 4LG0A 3HRMA 4S2TP 4ASNA 3CCLI 1TNSA 1FTTA 2FNAA 2MYSA 1IRGA 2WB1A 3DBRB 4PUSA 1XB4A 2XAUA 4HDUA 2BZTA 4RM2A 5GTIC 4R1HA 1Y8QB 3NAUA 3FXKA 1AWCA 3R4KA 3M8JA 2LBFB 3HJEA 5CIKA 5BPDA 3OR1C 3RTRA 1VQ8I 2BH3A 1B6AA 3EYYA 1LEBA 5J8FA 3KLNA 2D5VA 3OYNA 3BIPA 2MW8A 1UHSA 2BHDA 3GFIA 3IRRA 1LDDA 4CA0A 1N78A 2OCCH 4XLCA 3IH4A 3CUQB 1DGRM 3I58A 3ABKH 3DLAA 4B1RA 3GVAA 1RESA 2P98A 2X1EA 2AO9A 2BXZA 3VB2A 3MX6A 3BZKA 4XORA 3RKQA 2NNYA 4KT5C 4BS9A 1G3TA 1QGPA 3BIQA 4QR8A 2VJ5A 3I71A 2GXBA 1IC8A 2O9LA 4U7BA 1KYWA 3G1LA 1BW6A 3LAPA 4C2UA 5CDVA 3HZJA 2Y0SN 2IS4A 1X3WB 4Z7MA 2L9VA 2KJBA 2A3SA 3E5QA 4Y13A 3TW6A 3ZOBA 2R3SA 2E1CA 3A0BC 2M9HA 3TDZC 3DXJF 3F6OA 2R5YA 2F5EA 2DN0A 2HS5A 2QQ8A 4BU2A 3BPXA 2GG0A 1DUXC 3JRAA 3FHNA 3GTPJ 3S15J 2WY7Q 4AC0A 1R00A 2XVCA 3E5XA 4ENJA 2LYCA 2O5RA 1MBFA 4ZWUA 4U70A 1X4PA 2QEXI 4J01A 3S17J 3WTVC 4U73A 2YS9A 1RC9A 3LA2A 2DK5A 4IO9F 2F5CA 3VYUB 1J59A 5FKKA 3H5NA 2RDPA 4B48A 4L9VA 2Y69H 4DOZA 2ME0A 3KP2A 2B3LA 2E19A 3CP8A 4V19K 5BOXA 2TDXA 2YPRA 3JRGA 2RC4A 1IO2A 2WAEA 2VQGA 4U6JA 1ODDA 2H6BA 3GBGA 3LQQA 1LVAA 3O8GA 4ZJZA 3FMSA 2X0LA 1ZG1A 3SZGA 1BJAA 5K7ZA 3I56I 3FBNB 4F91B 1A04A 2W25A 4BHPA 4A3IJ 4XN3A 2A5WA 1UG2A 1TTYA 1VQNI 3MAJA 3FXRA 4A5NA 2B0LA 1QRYA 2EINH 3WTTC 2BN7A 3LA3A 2CUJA 5ERIA 3K1PA 5FB2A 2JT1A 3IUOA 1T6SA 1V54H 3OR2C 2CW8A 2JA2A 1SVOA 1J5YA 4M3DA 4C9YA 2PMUA 5KHDA 3IG4A 3LSTA 3QU6A 2QKMB 3V7CA 2FD5A 2LRDA 1YW8A 1BL0A 2R7WA 3BOQA 4IXAA 1R22A 3GZ5A 3CCVI 2F5FA 4D9JA 2MH2A 1XG1A 3VFZA 2HFHA 1Z05A 2KPMA 5ICCA 2NS0A 2AQEA 1E3OC 3H5AA 3CTZA 3K1MA 1F4KA 4IECA 3LSIA 2DXIA 2PQ8A 4XRMA 2WAQA 1TC3C 4C2MJ 2EV0A 2HWVA 1TWFJ 1O57A 2MG4A 1APLC 4UNOA 2VONA 3T1BA 1YFHA 3CD6I 3OYJA 1SEUA 1BI2A 3EDPA 4I0AA 1WJ5A 2XRLA 4AVPA 5ILSA 2OJED 3EPZA 2BWUA 2FMLA 4U7DA 3OYBA 2WY8Q 2HXIA 2LKXA 4GRIA 4BBSJ 4AU7A 4E7JA 2EVMA 1GT0C 3LNQA 3VYSB 2L4AA 2QENA 2XSJC 3GW2A 3K69A 2HEOA 4B47A 1BI0A 4I76A 3S16J 3RYPA 3RKYA 4LITA 4BQAA 1G3WA 2CQKA 3F6VA 1WKMA 2CFXA 2VL8A 2FRHA 1KP0A 3LSGA 1JT6A 4ZYDA 2P9AA 1NK3P 1TZLA 4CGZA 1B9NA 4XBFA 1OCTC 2Q2EA 1B72B 2M45A 4DZJA 3LOCA 4CCLA 5E5BA 4D0PA 4A3BJ 3H1CA 5H6RA 2M8GX 4MGRA 1SMTA 1U8RA 3Q9VA 2PMZA 4HX7A 5E3NA 1G4DA 2KT0A 1GVDA 1QXWA 3CO7C 2LFBA 3I64A 4AYBN 2BHAA 2A5YB 5J1YA 5JVGF 1MKMA 1J09A 4XRFA 4CCOA 1FMWA 3J7AO 3BTCA 1ZLKA 3DQVC 3OYGA 1ZK8A 1WWXA 3DV8A 5EZGA 1R58A 4EM2A 1MH3A 1H88C 1MSEC 2OF7A 1B8IA 3TOBA 4IKRA 2CQ7A 3OV8A 3A2KA 1BC7C 2K4BA 4OWRB 2M2EA 2MC3A 4RGUA 2YX4A 5HLIA 1Z7UA 4G6DA 1XDSA 3RZDJ 4CUGA 1A36A 2R0QC 2ESNA 4Y4RA 2R7ZJ 2P8TA 2V9VA 1HCRA 1U0JA 4E6KG 2DCEA 2RREA 1D1CA 1NG7A 4I2OA 5DEQA 4C3IJ 2VODA 3HC7A 4XL9A 4S05A 4C2TA 2LDUA 4ZWOA 1OCCH 3OL3A 4MO7A 2YSRA 4HZFA 3KCCA 1W2MA 5J8CA 2HOWA 1HF0A 4CO8A 5FRMA 3OYFA 2ELHA 5IYBJ 2PBIA 1VQ7I 3HOZJ 2E1NA 3CDLA 3IRQA 1FP1D 1MBHA 1LEAA 3E3VA 1KQ9A 1DQUA 4V2GA 3ROUA 3BTJA 1GVJA 2F5VA 4A6VA 1OCZH 5IYDJ 3CCMI 3GFMA 3CCUI 1MW7A 3QWLA 2B7EA 4S01A 1XMXA 4A3DJ 4EGEA 1YRNB 3DWLE 1V55H 4DIQA 1E3PA 2PFBA 2DA7A 2X85A 3EQLF 3G71I 4EGYA 2FNPA 5HS9A 4Z6YA 4BEHB 2VUMJ 1RRJA 4RM3A 4LIUA 1K78B 3LFKA 1IGNA 3UKGA 2QYOA 3ML6A 4LJZF 3U9GA 5EEGA 4DJAA 2R7TA 2RV8A 1W5TA 2O3FA 4KN7X 4EATA 2EVCA 2ZXJA 1GV5A 1HW1A 1TWGJ 2XPVA 4IRIA 2G7UA 5DCMA 4B3XA 2J5OA 3BQZA 5EGOB 2FBHA 1FY7A 3S93A 2EB7A 1YS7A 2O7OA 3D5SC 4HX8A 5DTDA 4M3EA 3RKWA 3VEPA 4A3GJ 3G1MA 3F22A 4U6EA 3BR1A 3RYRA 5CKTA 5ILUA 3L1PA 4FLKA 3K70D 3CMMA 2E1MC 2COBA 2YR2A 3CC4I 3LSKA 4ZYAA 4GGGA 2GU6A 3D1NI 2EV6A 3VDXA 2IW5A 4XONA 2ZJQF 3IKVA 2M87A 2NRAC 1VZ0A 4U0WA 2R7VA 2BGCA 2VE9A 3U1KA 2GXGA 4PNCA 3D27A 1Q1VA 3OYMA 3TW7A 2LTPA 3KPHA 5BS6A 2GG5A 2R5ZB 1S8NA 4HEA2 1HW2A 4IHVA 1DU6A 1MH4A 1WY2A 3CB5A 2DT5A 5M5WJ 1A6QA 3RCOA 1CGPA 1X1AA 4U87A 2LNBA 3PUFA 4RLQA 3BCBA 3QQAA 1M35A 1OYWA 2QM3A 4NDLA 2R7QA 2XB0X 4BL0B 1YOVB 4XLNF 5LBQA 1W4MA 1ORKA 4D7MA 4HNVA 5IT9K 3AL0B 2RQPA 4W97A 4X0GA 2HYFA 2HR3A 4MQVA 3FBIB 1FPQA 2GA2A 3PKDA 1ONVA 3BTLA 1BM9A 1DPUA 2Q96A 3A1YA 4DQ2A 5JR3A 4LG0B 1Z1DA 1OYYA 4FLJA 1E2XA 4N9IA 2M3AA 1NK2P 1O3RA 4FX0A 2F6CA 2KRFA 2ZMEC 3FM5A 1JKQC 1F43A 5H20A 4UUTA 1GUUA 3HKZN 4II2A 5B5EC 3I53A 3OOUA 3L9FA 2QA4I 4BE1A 2OUMA 3BPVA 3TBIA 5K5RA 2VKDA 3KE2A 3RJPA 3SFZA 1HSJA 1DDNA 4Q48A 1DU0A 4HNTA 4IDYA 4UV9A 1HC8A 2FA5A 4HYEA 1TL8A 3QYBA 4G12A 1SFEA 4G7HF 1UHMA 4HF1A 5C44J 2DTRA 2K02A 2X51A 1OR7A 3S6BA 1MMGA 1RR7A 1TNTA 2IGOA 4ZTJA 1O7FA 3F8NA 2F4IA 2DMTA 2HDCA 1BIAA 2GM4A 1GDTA 2V3YA 1W0TA 2ICWG 1K6OA 3N97A 4KN4X 2DMPA 5KCMA 4FETA 1Z3XA 1U9OA 5B66C 5IP6A 2EIMH 1LNWA 2W24A 2HOEA 2H6CA 1MZBA 4JUQA 2VXZA 5EDNA 2K86A 2BWTA 4HDVA 3R60A 4XR6A 4XOPA 1RI7A 1WFXA 2PI0A 4LLGF 4A2UA 4R79A 3M1EA 3QRFF 2O61A 1EJ9A 2DDBA 3O6BB 4KMUX 1I5ZA 5CVRA 3HOYJ 4HLXA 2OTJI 4B43A 4R60A 2BWYA 2XPWA 2ZJRF 1W7PD 1H9TA 2W57A 4LGWA 2VC1A 3K4KA 3W6JB 1T0FC 3NWTA 2LLKA 2P81A 2DU9A 1XPXA 1SAXA 2DOAA 2CFOA 1T95A 3KLOA 2XUBA 3F23A 3CB6A 1H89C 4RB1A 1Z6RA 3RDIA 2RAEA 1T2KA 4NUBA 2A6TA 3F8CA 4PZJA 1GV2A 1QO0D 1LPQA 3BJOA 2G7HA 3ZMUA 1B72A 1B59A 1VF9A 1ZN2A 3CCQI 3CLOA 4FO8A 3KFWX 1IDYA 3MKLA 4HBLA 4IEJA 1FP2A 4OIRF 4OOIA 1KZHA 1LFPA 1XD7A 3J7YJ 3TGNA 2H1KA 1QHGA 2BV6A 4L5JA 4OU0A 1HW5A 3V7RA 1YYVA 3JAMZ 1XSVA 1STZA 2X4HA 3OOPA 4KIGA 1J7KA 3NEUA 2GOMA 1XDUA 2LY1A 2NS7A 2BYVE 1I39A 3DTKA 2DT6A 2RNGA 2JWTA 3ZMTA
chains in the Genus database with same CATH topology
2IJLA 5LHHA 4AIKA 3K1NA 2V3ZA 3FZVA 4CHUA 4U6CA 4RAYA 2BEOA 3QOPA 3TAVA 3WU1B 1FLIA 2G6PA 4B09A 1SMYF 4FLIA 1A16A 3GEZA 5HLHA 3MATA 5E20A 2CWEA 5A2QZ 2ACJA 1IN7A 4EMSA 1IXCA 3T8RA 4I7HA 4I01A 1HQCA 4UV8A 2VC0A 4S2RP 3F8FA 4LLNA 3E6MA 2QQ9A 3GO5A 2P6SA 1B9MA 1MD0A 2D1HA 1FBSA 1ZG5A 4WXDA 1YG2A 1L3LA 3PKEA 2VBWA 1IUYA 5LGTA 1IRFA 4RAZA 5L3EA 5DV5A 2DO7A 1XSDA 1FNNA 1UCRA 2RVCA 2BWXA 3DKWA 4FHTA 1FWZA 5FD5A 3D0SA 4YG2F 1FZPB 2VBYA 4LMYA 2GQQA 1BI1A 4RZYA 1ZYRF 3L7GA 3WE3A 1SFUA 1FSHA 1PP8F 2Q8KA 3JAMK 2ZKZA 3HUGA 4HV6A 1ZH5A 4RB3C 4Y15A 1XGSA 2HTJA 1FYMA 2LF7A 3K2ZA 3DEUA 3IWZA 3PKAA 2P5VA 2FMYA 3B73A 2DI3A 4JQFA 4IVNA 1W7PA 1EV7A 3G3ZA 3BZ6A 2WV0A 1AOYA 1IZ1A 3FXQA 2PMHA 1UFMA 3HRSA 2O8XA 1IF1A 1GXQA 5D4SA 2XGXA 1ZARA 3V8JA 5A2QK 4BXUA 4U69A 5F64A 2ISYA 2GG8A 1P92A 1RUNA 4A6EA 3FM3A 2UWMA 1KU2A 4HF2A 1P6RA 2GZWA 2OZ6A 3V7SA 2FSWA 5FFXA 5FD6A 2FF4A 5DCMB 2C6YA 1YQAA 2XKPA 3ZPLA 1LDKB 1J0RA 3CUQC 3P7NA 3ERED 1Q1HA 3WTYC 1PDNC 1ON2A 2EV5A 1FYKA 3DFGA 1USTA 1V4RA 2OZUA 4IHSA 4FX4A 4U6WA 1YIOA 1S7AA 5D5XB 5LRSA 3ZMDA 3RKXA 3E6CC 3WGGA 1D5VA 1U6GA 3SHFA 3LAJA 1U5TA 3TOAA 2MH9A 5BQTA 2GZ5A 4XSZF 4LD5A 4A12A 1WLRA 2GU4A 4NQWA 1JXSA 3DF8A 3C18A 1XGOA 2Z33A 3U1DA 3V8LA 2R7DA 3JW4A 3PKBA 2MLGA 3REOA 5D5VB 1CF7A 1JE8A 2ZJ2A 2DFIA 4YIIA 3ZMVA 3WU0A 3T5XA 4IKSA 2IA2A 4RZZA 4PDKA 1ZG3A 3P9CA 1U78A 1Y0UA 4XSXF 4MTEA 2HKOA 1XGNA 4ZZLA 3IHUA 2JPCA 2H09A 3IWFA 3KP3A 5D6EA 3LWFA 5DYMA 2CW0F 5LEJA 2QQBA 3CO6C 3ECOA 5LGUA 4CXFA 1LB2A 1IN5A 3Q5FA 2IA0A 4KIBA 1BC8C 4A0XA 4U71A 2R7FA 4ON0A 2JSCA 4EM1A 1C27A 5BMZA 4P9FA 1IW7F 1BBYA 2DPDA 4OOKA 4JK1X 1KU9A 1SD6A 3C3WA 1OYIA 2G9WA 2L01A 1HKQA 2PN6A 5LEKA 4LB6B 2W84A 4UXNA 2GG2A 2QZ8A 4TV7A 5EEHA 4EJTA 2RKHA 5HOOA 2GG3A 4WWCA 1Z91A 2QBYA 1J2XA 3FHZA 5JI6A 3F3XA 2BB7A 4BH9A 4HLYA 1MJAA 2NNNA 5IT9Z 3MR1A 5H6QA 2EWNA 3NRVA 3PFIA 4M72A 2F2EA 4A6WA 2ETHA 1U3EM 2UZKA 3O2PE 2ZNZA 4ZYEA 2PEXA 2IA1A 2O6GE 2O0YA 1FX7A 4QLCU 1FT9A 1ZRCA 2RN7A 4K2EA 5FGMA 3I54A 3C7JA 4A6DA 4IF7A 3K9TA 3EUHA 1O3SA 1KYZA 5E8IA 4G7ZF 2XRNA 5D4RA 2XAGA 1T38A 5J6XA 2HGCA 4FLLA 3LA7A 4PGGA 1W5SA 3F8MA 4RS8A 5CDLA 1ZREA 4KICA 2VT3A 5HLGA 3WE2A 2A68F 5HDGA 1QPMA 4I09A 4EJWA 3WODF 5CVIA 2EA2A 2VOOA 3ZN1A 1B1BA 2IT0A 2Y0MA 1IXSB 2J5PA 1U2WA 2VE8A 2UXXA 2P5KA 5K5OA 3AAFA 1SFXA 1LQ1A 2CGPA 1BOAA 1I1SA 1PP7U 1J75A 3I4PA 2A6EF 1ON1A 1W7PB 5HVQC 3R0AA 2F5DA 1FSEA 3HTSB 2ZSGA 4H0EA 4UVCA 1QXYA 1ZAOA 3CDHA 4ZYHA 3M8FA 1FYLA 3TKYA 2CSOA 2OA4A 4HQMA 3ABTA 3K0LA 1QXZA 1XSXA 4EJVA 1WRJA 3NQOA 3MWMA 2FBIA 1KU7A 5DUIA 2EFOA 5LRRA 4Q47A 5F6FA 3COAC 1B4AA 2ZMEB 2VT2A 3E5UA 3ABUA 2MD5A 3D5LA 4GO1A 4N0BA 1LDJA 2ZBKA 2XKOA 2HQNA 4YFNF 1U5TB 1C24A 2P7CB 3BWGA 2FU4A 3WTUC 3IL2A 1GXPA 4M9XA 2GIVA 5ICGA 5E18F 3KP4A 4G6QA 3TB5A 3FXUA 3R61A 3H3UA 2JTVA 4F7ZA 4YFKF 4IHTA 5JHUA 4S04A 1CF7B 2IP2A 3KP6A 3T8TA 2BHCA 3BDDA 3ULQB 1TQMA 4FUKA 4U75A 1ZRDA 1O0XA 1DP7P 5KVRA 1ZLJA 4CDGA 5HS8A 2GU5A 2NQ6A 5AONA 4EJUA 4BAYA 1R23A 4MNUA 1FOKA 3MZYA 2EFQA 2ISZA 4IU6A 1XMKA 1T98A 3E6DA 3MCZA 4OMYA 2P99A 3HSRA 6PAXA 2EFWA 2DLLA 3DPLC 4NHJA 3WTWC 3BJAA 1IAWA 1RUOA 4JBAA 2NQ7A 2V79A 4LFUA 1FC3A 2M5WA 4RGXA 3BITA 4WK8F 3H3ZA 1QZZA 3IU9A 4A5MA 1XMAA 3CUOA 3TO9A 1P4WA 4WF2A 2OD5A 2QLZA 2EJRA 2ZO4A 4L18B 5L3DA 4UHTA 5CLSA 2Q0OA 1YLFA 3P9IA 2O03A 1LJ9A 4IKTA 1KQ8A 2L3DA 3GUDA 2Q95A 3RVAA 2CO5A 4KNYA 1REPC 1R36A 3HYIA 3CJNA 1KQ0A 2P6TA 2QQAA 3LQRA 1RIOH 5E8GA 4ZH4F 5FCFA 2WWYA 3FWEA 4I98B 3Q9SA 4ESJA 4HV5A 4ESFA 4G7OF 4L0YB 1G3YA 1NHAA 2QBYB 3IC7A 1UHWA 1VTNC 2OKNA 1BIBA 3R0JA 3MQ0A 3V4GA 5ED4A 2EA4A 1IN4A 2OQRA 5IT3A 3PQKA 3R6SA 4B8XA 3V8KA 3RPUA 4EJOA 2DK8A 1ULYA 4LLLA 2YU3A 1I1GA 2RGVA 1BI3A 1EH7A 5CVVA 2HZTA 5LGNA 5D8KB 4O5VA 5CE6A 1G3SA 3GF2A 2XROA 3WTZA 3GYHX 3Q6DA 2EFPA 1YJ3A 1TLHB 5K1YA 3BP8A 2VN2A 3O3KA 4U1BA 5FO5A 4WCGA 2HKXA 2FQ3A 2OU2A 1SD4A 4M73A 1JGSA 2CG4A 1YVMA 2D45A 4S00A 5BPIA 1N51A 3GWZA 3FF5A 4ZZDA 2A07F 1ZGAA 1Z9CA 2BWSA 2ZMEA 2V1XA 1R1VA 4IRGA 3HHHA 2LSOA 1IN8A 1RNLA 5E1XA 2JZYA 2ZNYA 4ETSA 3MZHA 4FKCA 1C21A 1K79A 4CYDA 2PG4A 3ZQ7A 3SXYA 1JAWA 2H27A 3B02A 2Z9OA 2ZCWA 4RGZ1 4MHGA 1ZRFA 3PKCA 2Q94A 1R5GA 4QWQA 1R7JA 3TDUC 2BHBA 2BBYA 5L3GA 2V3XA 1PV9A 2HYGD 2HQRA 4I0BA 3GX4X 1WL9A 2LF8A 5TJJA 1F1ZA 2JPBA 4OMZA 2K4JA 1QQIA 1F9NA 5F1RA 1WQ2A 1D3YA 3QPTA 2EVOA 2XAFA 4M74A 4MEYF 3KP5A 3QPHA 1T0FA 1WL6A 1MJBA 3GZ6A 4ENKA 4Q4ZF 4CICA 4RB0A 1QZYA 3L09A 2GWRA 1S29A 2EK5A 5E17F 1O3TA 1IN6A 2XV4S 2GG9A 3P9KA 3HOSA 3WG9A 5K5QA 4ESBA 2KIFA 1WSUA 2IW2A 5DD4A 2P5LC 4KA4A 1OPCA 1D8JA 2VBXA 3EYIA 5CVUA 2AS5F 1TW2A 3MFKA 3G73A 2STWA 5D6FA 1K7AA 4AWXB 2QWWA 1XNZA 3I5UA 1HXDA 4KMFA 4EM0B 3QP5A 4MATA 5DDGA 2IRFG 2VOPA 4LK1F 1BN5A 1YW7A 3BJ6A 4HA8A 5E1ZB 3M8EA 1QNTA 5LLQA 2Z5UA 1R1TA 2K27A 1D8KA 5HDKA 4LB5A 3KEOA 3JTGA 1MDMA 2DAOA 3HTUA 2COMA 5JFRA 4IF4A 1IXRC 4WX9A 5DCFA 3WTXC 2OAZA 4Y17A 4EGZA 3RIRA 4OIPF 5DUKA 3QU3A 2Y75A 3JSPA 1WN1A 3WGHA 4M6XA 2ESHA 1OKRA 4IKUA 4XLPF 4DNCA 3C1DA 4ENNA 2IPQX 1V3FA 1YTYA 1XCVA 3IKTA 4WXCA 1J9IA 3ZMZA 3I59A 3JTHA 4OIOF 4U0YA 1S7OA 2W85A 4UVAA 4EVIA 4ENMA 5HDNA 1ZHFA 2Z3YA 4U6ZA 4M9ZA 4HAMA 5ICEA 5E1WA 5LHGA 2B3KA 4RGSA 2E7XA 2FEZA 2WC2A 4GCVA 1RZ4A 4A0ZA 5AIPA 4O6JA 4M6YA 1WBQA 4Q5SF 4M9SA 4PCQA 3L2CA 2MLKA 4KUMA 5CDEA 2ZFWA 3KETA 4IJAA 2QVOA 2OQGA 1PUEE 1L0OC 1WI9A 4E70A 1XGMA 2HTSA 3RPQA 1MGTA 4UVBA 4HW0A 1I27A 3ZP5A 2Q92A 3GLXA 1S6LA 2EFNA 3RORA 4RB2C 3KZZA 3L7WA 3ZN0A 1CHMA 1FBQA 4MTDA 3TO6A 2GGBA 1JHFA 1R1UA 3FMQA 2E7WA 1TQPA 2CYYA 3CUQA 3VOEA 4G8XA 4NB5A 1H9GA 2DBBA 4U0VA 4B28A 4A0YA 4M71A 1P2FA 2KIMA 1Z6TA 3DPTA 5CJ9A 1TQIA 4R8HA 2RNJA 3HRUA 2DQLA 3E6BA 1KGSA 3FX3A 2XAJA 1F5TA 3M9AA 2FXAA 2XASA 4GYIA 3QP6A 4G94A 2P7VB 3SQNA 2GG7A 3HOTA 1T39A 1HBXG 3BROA 1XN7A 4BYYA 5CVJA 2M1BA 2QUFA 2GAUA 1W7VA 4KYWA 4MEXF 5TRDA 4EQQA 3T0YA 2A69F 3HSFA 1X3UA 5FLXZ 2D1VA 2Z99A 1KU3A 4L9JA 4RGRA 1FBUA 4HQEA 2GU7A 2V1UA 3HIFA 1JHHA 4YIFA 2KKOA 1O7LA 4KDPA 3J80Z 2Y48A 2FBKA 4UUVA 4BNCA 1E17A 3WGIA 2KIUA 4MQ9F 1U5TC 4OINF 5CYVA 3IU8A 4L0ZB 3QAHA 2XAQA 4G9YA 3W6KB 4YFXF 1EH6A 2FE3A 5JVTA 1R5HA 4P5OA 1QBJA 3F72A 2BWVA 2VBZA 5FCHA 5DD8A 4EV0A 4HX4A 2DQRA 1I6XA 3S2WA 1HKTA 4U88A 2JRTA 1S3JA 4HOBA 4FO7A 3HSEA 1C22A 3GFLA 5L3CA 3TQNA 2V6CA 1GHCA 1P4XA 2WTEA 2B3HA 4AD9A 3I0TA 3M7GA 4O3MA 1ZGJA 1SD7A 4ZNGA 3EETA 1O3QA 2UXNA 4IPAA 2DW4A 2MA3A 4L9TA 2BE5F 5L3FA 3N4MA 3PQJA 5D5UB 3GFJA 5FLXK 3BY6A 2M30A 2XAHA 1XCBA 3KEQA 4GYGA 1HKSA 1MJ9A 4FT8A 2DPUA 3RI4A 2M8EA 4N9HA 3SZTA 2V1DA 2D2WA 4CZZA 2L4MA 3J80K 3JSOA 5D8LB 4HF0A 2MATA 3J81Z 2NAZA 4BHBA 1G6NA 2K7LA 2NYXA 4PGHA 1DPRA 4L5IA 3L00A 2L02A 2GGCA 1C0WA 4P96A 3U2RA 5CNXA 4IRHA 4U76A 3HHGA 4KIFA 3GXOA 5L3BA 2L54A 4AIHA 3WTSC 1MDMB 3MEXA 4WXHA 2BWWA 1P4AA 3F21A 4OIQF 1UB9A 2IVMA 3KZYA 2MBFA 4P9UA 2GTXA 3ELKA 4KM3A 1MATA 1K78A 5LHIA 3ZMSA 2KJCA 4I02A 2A6HF 4PV4A 3H92A 1SD5A 4HXXA 3HRTA 1OMIA 3FMRA 4LK0F 4L9NA 5AIQA 3IU7A 3I59B 5ILVA 2OBPA 2XIGA 5HS7A 4ZYGA 5ICFA 3E97A 2YX7A 1YO5C 3SZPA 5FFZA 3L24A 3F8BA 4P55A 1HSTA 1KA8A 2PJPA 1USSA 4BHCA 2H94A 1Y1NA 5KK1A 3VODA 2GA1A 4AIJA 4KFCA 2ADUA 1TBXA 2STTA 3CTAA 4GXOA 3KP7A 1C23A 3ISPA 1EH8A 1H0MA 3TO7A 2FOKA 4ZWPA 1YS6A 1TW3A 2PLYA 2XHKA 5D5WB 1YW9A 2A61A 2Q93A 2AXLA 3ECHA 4Z2YA 3DP7A 2LKPA 3J81K 2P4WA 4LG0A 3HRMA 4S2TP 4ASNA 1TNSA 2FNAA 1IRGA 1XB4A 4HDUA 4R1HA 1AWCA 3R4KA 5CIKA 5BPDA 3RTRA 2BH3A 1B6AA 3EYYA 1LEBA 5J8FA 3KLNA 3BIPA 2BHDA 3GFIA 3IRRA 1LDDA 3CUQB 3I58A 3GVAA 2P98A 3VB2A 3MX6A 2NNYA 4KT5C 3BIQA 1G3TA 1QGPA 4QR8A 3I71A 2GXBA 4U7BA 1KYWA 3LAPA 5CDVA 4Z7MA 2KJBA 2A3SA 3E5QA 4Y13A 2R3SA 2E1CA 3TDZC 3DXJF 3F6OA 2F5EA 2HS5A 3BPXA 2GG0A 1DUXC 1R00A 2XVCA 3E5XA 4ENJA 4ZWUA 4U70A 3WTVC 4U73A 3LA2A 2DK5A 2F5CA 1J59A 2RDPA 4L9VA 2B3LA 3KP2A 5BOXA 2TDXA 2YPRA 2RC4A 4U6JA 1ODDA 2H6BA 3LQQA 1LVAA 3FMSA 2X0LA 1ZG1A 1BJAA 1A04A 2W25A 4BHPA 1TTYA 3MAJA 3FXRA 4A5NA 2B0LA 3WTTC 2BN7A 3LA3A 5ERIA 3K1PA 5FB2A 2JT1A 1T6SA 1J5YA 3IG4A 2PMUA 3LSTA 3QU6A 3V7CA 1YW8A 3BOQA 4IXAA 1R22A 3GZ5A 2F5FA 2MH2A 3VFZA 2HFHA 1Z05A 5ICCA 2NS0A 3CTZA 3K1MA 1F4KA 4IECA 2PQ8A 2EV0A 2HWVA 4UNOA 1O57A 2VONA 3T1BA 1YFHA 1BI2A 3EDPA 4I0AA 4AVPA 5ILSA 2BWUA 2FMLA 4U7DA 2EVMA 2L4AA 2QENA 3GW2A 3K69A 2HEOA 1BI0A 3RYPA 3RKYA 4BQAA 1G3WA 2CQKA 3F6VA 1WKMA 2CFXA 2FRHA 1KP0A 4ZYDA 2P9AA 4CGZA 1B9NA 4XBFA 2Q2EA 2M45A 5E5BA 4D0PA 1U8RA 5H6RA 4MGRA 1SMTA 3Q9VA 4HX7A 1G4DA 1QXWA 3CO7C 3I64A 2BHAA 2A5YB 1MKMA 4XRFA 3J7AO 1ZLKA 3DQVC 1WWXA 3DV8A 1R58A 4EM2A 3TOBA 4IKRA 3OV8A 1BC7C 2K4BA 2MC3A 4RGUA 2YX4A 5HLIA 1Z7UA 4G6DA 1XDSA 2ESNA 2P8TA 2V9VA 4I2OA 5DEQA 2VODA 4S05A 2LDUA 4ZWOA 2YSRA 4HZFA 3KCCA 1W2MA 5J8CA 2HOWA 4CO8A 2ELHA 2PBIA 2E1NA 3IRQA 1FP1D 1LEAA 3E3VA 1KQ9A 3ROUA 1GVJA 4A6VA 3GFMA 4S01A 4EGEA 2PFBA 3EQLF 4EGYA 2FNPA 5HS9A 1K78B 3LFKA 2QYOA 3ML6A 4LJZF 3U9GA 5EEGA 2RV8A 1W5TA 2O3FA 4KN7X 2EVCA 2ZXJA 1HW1A 4IRIA 2G7UA 5DCMA 2J5OA 2FBHA 1FY7A 2EB7A 1YS7A 4HX8A 3RKWA 3VEPA 4U6EA 3F22A 3RYRA 5ILUA 4FLKA 2YR2A 4GGGA 2GU6A 2EV6A 2IW5A 3IKVA 2M87A 2NRAC 4U0WA 2BGCA 2VE9A 2GXGA 4PNCA 3D27A 5BS6A 2GG5A 1S8NA 1HW2A 1WY2A 3CB5A 2DT5A 1CGPA 2LNBA 1M35A 1OYWA 2QM3A 4XLNF 5LBQA 1W4MA 5IT9K 2RQPA 2HYFA 2HR3A 4MQVA 1FPQA 2GA2A 3PKDA 1ONVA 1BM9A 1DPUA 2Q96A 4DQ2A 5JR3A 4LG0B 1Z1DA 1OYYA 4FLJA 1E2XA 4N9IA 1O3RA 4FX0A 2KRFA 3FM5A 5H20A 3I53A 3L9FA 3BPVA 5K5RA 3KE2A 3SFZA 3RJPA 1HSJA 1DDNA 4Q48A 4IDYA 4UV9A 2FA5A 4HYEA 1SFEA 4G7HF 1UHMA 4HF1A 2DTRA 2K02A 1OR7A 3S6BA 1TNTA 1O7FA 3F8NA 2HDCA 1BIAA 2V3YA 1K6OA 3N97A 4KN4X 1LNWA 2W24A 2HOEA 2H6CA 1MZBA 4JUQA 2VXZA 2BWTA 2K86A 4HDVA 3R60A 1RI7A 2PI0A 4LLGF 4A2UA 4R79A 3QRFF 3M1EA 2O61A 4KMUX 3O6BB 1I5ZA 5CVRA 4HLXA 4R60A 2BWYA 1W7PD 1H9TA 2W57A 4LGWA 2VC1A 3W6JB 1SAXA 2DU9A 3KLOA 3F23A 2XUBA 3CB6A 4RB1A 1Z6RA 3RDIA 1T2KA 3F8CA 4PZJA 1QO0D 3BJOA 2G7HA 3ZMUA 1B59A 1ZN2A 3CLOA 4FO8A 3KFWX 4HBLA 1FP2A 4OIRF 4OOIA 1XD7A 3TGNA 2BV6A 4OU0A 4L5JA 3V7RA 1HW5A 3JAMZ 1YYVA 1XSVA 1STZA 2X4HA