1WKMA

The product bound form of the mn(ii)loaded methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title EPR and X-ray crystallographic characterization of the product-bound form of the MnII-loaded methionyl aminopeptidase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wkmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wkmA01
4HBLA 1FBQA 4L9VA 1DPUA 3TKYA 2B3KA 2ADUA 3WU0A 4WCGA 2Q96A 4U6JA 2GG5A 2BN7A 4KNYA 3KZYA 4ENMA 2JZYA 2WC2A 4ZNGA 4S01A 4EJVA 2V1XA 4PCQA 3GZ6A 2EK5A 4I0AA 4JUQA 3F22A 3GW2A 4B8XA 3FF5A 1R1UA 5FCFA 1P4WA 4EM1A 5FD5A 1U5TB 3QOPA 1B9MA 4LJZF 3P9CA 4RS8A 4IKRA 3TO9A 2E7XA 2GA2A 1WSUA 3KP6A 2DO7A 1D5VA 4N9IA 2Y75A 1JXSA 3KP2A 2TDXA 3TO7A 3KP4A 4UXNA 2ESHA 2Q0OA 4GYGA 1DUXC 4IECA 1QZYA 1SFEA 4G9YA 5EEGA 4ZYHA 1SD7A 2LNBA 2XAHA 3JSOA 5CIKA 2MH2A 3HOSA 4R60A 2P4WA 3KLNA 3M9AA 2DLLA 3TQNA 3H92A 4Q48A 4I01A 1R5GA 4XLPF 2A5YB 4RAYA 2VBYA 3GWZA 4BYYA 2HTJA 1YYVA 2EV6A 3VEPA 4U0VA 2QWWA 3SQNA 2XIGA 3BZ6A 2H6CA 3ABTA 4UUVA 3DEUA 1Y1NA 1QPMA 5E20A 5L3DA 3WGIA 4CGZA 3O3KA 2HEOA 5EEHA 5ICEA 4U6WA 1PP8F 4WK8F 4IDYA 5BPIA 4A6VA 5E8IA 2GG7A 3J80Z 5HLGA 4OIPF 3PQJA 2P99A 5K1YA 2QM3A 4I98B 1D8KA 3MWMA 1T0FA 2XAQA 2QZ8A 1ZYRF 2HDCA 2DT5A 1I1SA 1BIBA 1YQAA 3CB6A 1Z05A 1QO0D 1RIOH 4KIBA 4XLNF 4U71A 2GG2A 3K1NA 3ZPLA 2ISZA 5LHHA 1IXSB 2HYGD 5E17F 2EFPA 3LA3A 2PEXA 5D4RA 2NNNA 3MQ0A 5JFRA 4AIJA 2PBIA 1K79A 3DPTA 1F5TA 1FSHA 2ISYA 3BJAA 4RGSA 2UZKA 1MJAA 4U75A 2MD5A 4U0WA 2V3ZA 3D27A 4FLIA 1SMTA 2VE9A 1S29A 4HQEA 3MR1A 1FX7A 5FCHA 4G6DA 1HW5A 1LDJA 4PDKA 1P92A 1LJ9A 2FQ3A 2OZ6A 3SZTA 2GZ5A 5E1XA 1WI9A 4IKSA 4A6WA 4Z7MA 5ERIA 2Z5UA 1W7PA 2RN7A 1ZG5A 2DPDA 4HXXA 5JI6A 4MATA 5BMZA 4FT8A 2IA2A 2F5FA 3R0JA 1I5ZA 4KN7X 3FX3A 2ELHA 5TRDA 1XGMA 3TO6A 2MH9A 1PV9A 5IT3A 1DDNA 1KU3A 4M74A 2IA0A 2BWVA 3SXYA 4EJWA 1L0OC 3ZMZA 3V8KA 3W6KB 3WTVC 4ZWUA 2R7FA 2ZMEA 2EJRA 2XROA 5E18F 4IPAA 1XDUA 1X3UA 3V4GA 1YVMA 4WXHA 2YSRA 3KLOA 5F6FA 2XAJA 1IXCA 1J0RA 2XGXA 5L3GA 2MC3A 4LFUA 2P98A 1QXYA 3LA7A 1NHAA 2A68F 3GLXA 4U6EA 4KA4A 3J80K 1R00A 4FHTA 3U2RA 4UNOA 3GO5A 2FRHA 2VT2A 3QAHA 2VBZA 2OAZA 4ZWOA 2YU3A 4EMSA 3MZYA 1ON2A 3RKWA 4BHBA 4U0YA 1KYZA 5FGMA 4AIHA 4HF1A 4ZYDA 5LEJA 1KU7A 2GA1A 3WTXC 4KDPA 1YS6A 5FO5A 4CDGA 5E1ZB 4I09A 3JAMZ 2GGCA 5ED4A 1K6OA 4YFKF 1SFXA 5LGTA 3Q9SA 4LG0B 1BC7C 1C27A 1VTNC 4U73A 2ZCWA 4A5MA 2IT0A 1Z7UA 3LWFA 4I02A 5HS7A 3NQOA 3E3VA 3MATA 2B0LA 2ZMEB 2OQGA 1L3LA 3RDIA 4BNCA 2ETHA 2DW4A 4HLXA 4WXCA 1C21A 4WF2A 1HXDA 1XB4A 3L7WA 4HA8A 1I6XA 1XCBA 1XDSA 1H0MA 2LSOA 1H9GA 4LGWA 4RGUA 1DP7P 2ZJ2A 2JRTA 1BJAA 3CB5A 1J5YA 3RPQA 2A6HF 1MJBA 2Z3YA 1YLFA 4OOIA 2HQNA 2FBHA 2P5KA 3BOQA 3VFZA 3DP7A 2ZNYA 4U7DA 4RB0A 1KQ0A 2D1VA 4CYDA 1GXQA 2GG8A 3GFJA 4MNUA 1LDKB 2UWMA 2A61A 3HRUA 3KEOA 2EFNA 2IJLA 2UXNA 3ISPA 4RGXA 4ZH4F 4P5OA 1ZG1A 2L01A 4IF7A 2ZO4A 2LKPA 3S6BA 1W7VA 2FA5A 1WRJA 4MHGA 5HLIA 2M1BA 1ZLKA 3ZN1A 2H6BA 3ZMTA 3K69A 4PNCA 4BHPA 3HOTA 4IRGA 5CVIA 5DDGA 2IP2A 1TW3A 1RUOA 1ZH5A 2KJBA 3T5XA 3P9IA 2BHBA 2CW0F 3T0YA 2QBYB 4U69A 2JPCA 2OU2A 4H0EA 5CVRA 1E17A 3C18A 2BHAA 4HLYA 1HSTA 3EUHA 1XMKA 3DF8A 2QQ9A 3ZMVA 4RGZ1 2DI3A 1R1VA 3R4KA 4EGZA 1QBJA 5DCMB 2FMLA 4N9HA 1YS7A 1Z6RA 1G3WA 3GEZA 2XRNA 3GUDA 4G7HF 1J75A 1FOKA 3PQKA 4BH9A 1BC8C 1D3YA 2A3SA 1H9TA 3ULQB 1KP0A 3U9GA 1DPRA 5E5BA 3AAFA 3BJOA 3GFMA 2DFIA 1UHWA 5CLSA 1LNWA 3GYHX 1YO5C 1FT9A 3E6CC 3DV8A 1RI7A 2F2EA 5LEKA 3L09A 1O57A 4FLKA 4M9XA 3WGGA 1S8NA 1BI3A 1T38A 2GXBA 2O3FA 3HSEA 4YIIA 1GVJA 3S2WA 3PKBA 5L3EA 2M45A 3EYIA 2QENA 4RB1A 4A0YA 2GXGA 2ZBKA 2BGCA 2VOOA 1FC3A 2R3SA 1UFMA 2ACJA 3QU3A 5HLHA 2W84A 4KICA 5ILVA 1HKSA 1ZAOA 5D4SA 1FBSA 2BH3A 2VOPA 2EA4A 4EGEA 2O61A 4F7ZA 1R5HA 3IWFA 4ENNA 4UVAA 2J5PA 4IJAA 5ILSA 1IXRC 3ERED 2EA2A 1JGSA 2CO5A 3I5UA 1SD6A 4G6QA 2FU4A 1BN5A 2KIUA 2VN2A 4M6YA 5DYMA 2XVCA 3F8BA 2Q93A 3TDZC 1IN5A 3Q6DA 1XGNA 4MGRA 1XNZA 4LD5A 3G73A 1YIOA 2MATA 4S00A 1I27A 3K1PA 1TW2A 4WXDA 2LF7A 2XHKA 1HSJA 2BWUA 2VONA 3KP7A 1Z91A 1OYWA 2BWXA 3TAVA 4HAMA 3VOEA 5LHIA 2DTRA 2WWYA 3TOAA 2P9AA 4EM2A 1FSEA 3HRSA 1BI2A 4RAZA 3T8TA 4Y15A 4FLJA 3CDHA 2W25A 3I71A 2STTA 3F6OA 1SD5A 1EV7A 3V7RA 4CICA 3WODF 2M5WA 1HBXG 4ZZDA 2IVMA 2HS5A 5J8CA 2DQRA 4KYWA 4R8HA 4G8XA 4U6ZA 1R23A 4OU0A 2HKXA 1J7KA 2GU5A 3L7GA 1O3QA 1BI0A 4P9FA 4LMYA 3K1MA 4OIQF 2HTSA 3ECHA 3KCCA 1KYWA 3IG4A 1R1TA 4IF4A 3VODA 1OR7A 3E6MA 2Q2EA 4FLLA 4M9ZA 1K78B 1MD0A 3BIQA 4HDVA 3WTUC 3M8FA 3GF2A 1B6AA 5F64A 4O5VA 5K5QA 3H3UA 3BDDA 4HYEA 3LQQA 1IN8A 5HS8A 2Q8KA 3IC7A 2PMHA 4GCVA 3R61A 1J59A 5BS6A 3F8NA 4A0ZA 1M35A 5HVQC 1ZLJA 3NEUA 2GG9A 1KU2A 4G94A 2XAGA 2OD5A 3WE3A 3J81K 4CHUA 1B1BA 2QQAA 4Y13A 2IA1A 4DNCA 5DCFA 4M71A 2Q92A 4S2TP 2F5CA 5D5WB 4ESBA 2DK8A 3GVAA 4XRFA 2IW5A 3R60A 4ESFA 2KKOA 2HKOA 3P7NA 4AD9A 2NQ7A 1FYKA 2LF8A 5AIPA 4ESJA 2OBPA 5LLQA 2ZXJA 3I59B 5D8KB 1LEAA 3LAJA 2VC1A 1O3RA 4LG0A 2M8EA 3BIPA 1OMIA 1W5SA 3MEXA 1MDMB 4AVPA 1JHFA 3ELKA 3WTSC 4MQVA 2IRFG 4YFNF 5H6RA 3V7CA 4KM3A 4WX9A 3M1EA 2FEZA 2BWYA 2FXAA 3CUQB 3C7JA 1F1ZA 2X4HA 2BHCA 2HQRA 4NB5A 3FXRA 3RYRA 2BWSA 1P4AA 2KJCA 4R1HA 2NNYA 2Q95A 1SAXA 1C22A 2BEOA 1C24A 3MX6A 5CNXA 3I64A 1REPC 3DPLC 2DU9A 5D5UB 2Z99A 5D6EA 3F8MA 5AIQA 5DD4A 1LQ1A 4MEXF 3D0SA 1S7AA 2ZNZA 3FZVA 1IN6A 3E5UA 4A12A 2D1HA 1F9NA 1U6GA 2FBIA 4ZYGA 5A2QZ 2MLGA 4Q47A 1GXPA 4O3MA 2G6PA 1WY2A 3REOA 4HV5A 2QQBA 1FPQA 1TNTA 2W85A 5FD6A 1I1GA 4JK1X 3JTHA 2XKPA 4LLGF 4UVBA 2MA3A 5F1RA 1AWCA 1QQIA 3CO7C 2K7LA 1O7FA 1SD4A 3R0AA 3WU1B 3EQLF 1QNTA 3W6JB 4A2UA 4EJUA 2QBYA 4U6CA 1A16A 4M72A 3WGHA 3N97A 1YG2A 5D6FA 5LGNA 2L3DA 5K5RA 1KQ8A 2D45A 4L0YB 5LBQA 4HV6A 3V8JA 1ON1A 4ENKA 5KVRA 3QP6A 4L9NA 4Y17A 2MLKA 5JR3A 3HTUA 2E7WA 2YX7A 5DCMA 5BPDA 3RI4A 2Z33A 5HDKA 4P55A 4BQAA 4D0PA 4ENJA 1FBUA 2DBBA 2BB7A 2W57A 3N4MA 3HRMA 1XSXA 2VBWA 1P6RA 5H6QA 5E8GA 3WE2A 2GU6A 3D5LA 3E97A 2O6GE 3ZP5A 2GGBA 2CG4A 2RNJA 1CHMA 2ZFWA 4XSXF 1G4DA 4A6DA 4IRHA 3CTAA 5L3CA 1R7JA 4LLLA 1IUYA 5J6XA 1V3FA 2A07F 2CYYA 2PQ8A 3FXUA 2X0LA 1G3YA 4UV9A 4E70A 2DQLA 1WWXA 1U8RA 5CDLA 4UVCA 2QYOA 2PN6A 2P7VB 2VBXA 3GXOA 3M7GA 2EB7A 2XKOA 3KFWX 4IKUA 1IAWA 5CYVA 5LRRA 4FX4A 1W4MA 2A69F 3MZHA 2P7CB 1ZN2A 4B28A 2B3HA 4CZZA 2H94A 1XGOA 4JBAA 1A04A 1FYLA 1XGSA 1ODDA 5A2QK 3HHGA 3RTRA 4IRIA 3C3WA 3TDUC 5JVTA 4U70A 2BYVE 2G7HA 3SHFA 1KGSA 3B02A 4XSZF 4MTDA 4HDUA 2XV4S 3E6DA 2P8TA 4Z2YA 4A6EA 4QWQA 3TGNA 2CFXA 1JHHA 2CGPA 3RJPA 1FNNA 1HQCA 1W5TA 1R58A 3BWGA 2PI0A 2HWVA 1IRGA 1SFUA 4I7HA 4YG2F 2RQPA 4KMFA 1LB2A 1T2KA 4P9UA 3IU7A 2NYXA 1C23A 1GHCA 2HFHA 4L9TA 1T39A 2GAUA 1TQIA 4FO8A 2E1NA 4HW0A 1WBQA 4B09A 4YIFA 4N0BA 3BPVA 2RDPA 1Z9CA 3HSFA 4L0ZB 5DD8A 2OA4A 1QZZA 4FO7A 2G9WA 3CTZA 5CJ9A 2K4BA 3L2CA 1U3EM 1SMYF 1Z1DA 3NRVA 4IXAA 1FLIA 4EV0A 2UXXA 3TOBA 5ILUA 3RKYA 2IW2A 1YTYA 4ZZLA 4NHJA 4JQFA 3FHZA 4OIRF 4NQWA 1WL9A 1S3JA 1YW9A 1ZHFA 3IKTA 2HYFA 4QLCU 4HF0A 2V9VA 1BIAA 2FNAA 3EETA 2VC0A 1UCRA 3VB2A 2QVOA 3QPTA 2BBYA 2D2WA 1OYYA 5KK1A 2YX4A 3F8FA 4PV4A 1O3SA 4FUKA 2GQQA 5CDVA 3K2ZA 4OINF 1CGPA 1R22A 4OMYA 2K02A 1D8JA 1FP1D 3FMQA 4RZZA 3I4PA 1K78A 5D5XB 3KP5A 3J81Z 1QXZA 2NQ6A 3TB5A 1PDNC 5H20A 1TQMA 3IU9A 2P5LC 4A5NA 4ON0A 3E6BA 3I0TA 2GTXA 2QLZA 2L4MA 1JE8A 1W7PD 4L5IA 1MATA 3IL2A 3B73A 3U1DA 1XMAA 3P9KA 2RV8A 3WTYC 3ZMUA 5CDEA 2EVOA 3EYYA 5L3FA 4QR8A 3V7SA 3C1DA 4GGGA 1IW7F 4MEYF 1JAWA 4FX0A 2P5VA 5DUKA 5FB2A 3QRFF 3QU6A 3FM5A 2PLYA 1MJ9A 3HSRA 5HOOA 3F72A 2P6SA 2WTEA 3V8LA 1T98A 4R79A 2HZTA 2JTVA 5FLXZ 1WN1A 3WTTC 1RNLA 2NRAC 3MFKA 2DK5A 3G3ZA 4RZYA 2F5EA 3LA2A 1ZRFA 3CUQC 3I59A 4KT5C 4UV8A 2GWRA 2V1UA 4M6XA 2EFQA 5BQTA 1MDMA 1EH8A 2V79A 4UHTA 1LEBA 1WL6A 4KUMA 3BITA 3PFIA 5AONA 1ZREA 4LB5A 1BI1A 4I0BA 3CUQA 3BPXA 3RPUA 3SZPA 1QXWA 2M30A 4GXOA 5DV5A 3RIRA 5D5VB 3WG9A 3HHHA 5D8LB 2QUFA 2O0YA 3ECOA 1USSA 2VXZA 2DPUA 2K4JA 2YR2A 4EM0B 3WTWC 1XCVA 2XASA 2A6EF 4L9JA 1BM9A 2CWEA 2O03A 2EVMA 1ULYA 4HX4A 4CXFA 5FFXA 2HOWA 4O6JA 1IN7A 1N51A 1J9IA 3CO6C 1XSVA 3QPHA 3FMSA 3FMRA 4LK1F 1U78A 4LK0F 3HIFA 2B3LA 1TBXA 5TJJA 3ZMSA 3IHUA 2V1DA 3BROA 2H27A 1B9NA 1HKQA 4EJTA 1UHMA 2BHDA 1J2XA 2CQKA 2FBKA 3L00A 2PJPA 3HRTA 1ZGJA 4U1BA 2VE8A 4L5JA 4WWCA 4ETSA 4ZYEA 4HZFA 1PUEE 2W24A 1FP2A 5LRSA 2XAFA 1B59A 3IWZA 1QGPA 2GIVA 2RKHA 1FY7A 3H3ZA 5ICGA 4K2EA 2KIFA 1Q1HA 1ZG3A 3PKCA 3FWEA 3K9TA 5FLXK 2FOKA 4A0XA 1T6SA 1UB9A 1MKMA 4EJOA 4IKTA 2DAOA 4RB3C 3COAC 3JW4A 1O3TA 3KEQA 5LHGA 2BWTA 2R7DA 3PKDA 4MTEA 3RYPA 1EH6A 3RORA 2XUBA 1OPCA 4PGGA 4RB2C 1MZBA 1OYIA 4LLNA 1TTYA 4PZJA 2C6YA 2EFOA 2STWA 1BBYA 1XN7A 3DFGA 1W2MA 3LFKA 3IU8A 1XSDA 3RVAA 5HDNA 4Q4ZF 2GG0A 3DQVC 3MCZA 1STZA 1F4KA 1WKMA 2OZUA 4HF2A 4S2RP 1O0XA 3F3XA 4HOBA 2ZSGA 1HKTA 2KRFA 1KQ9A 1V4RA 2CSOA 3L9FA 4G7ZF 1ZRCA 2Z9OA 4ZWPA 1LVAA 4EGYA 5L3BA 5JHUA 3F6VA 4G7OF 1KA8A 6PAXA 2EV5A 1PP7U 3T8RA 4HQMA 4LB6B 5BOXA 4DQ2A 1W7PB 1ZRDA 3O6BB 2RGVA 2K86A 3GFIA 3IKVA 1ZGAA 4L18B 1C0WA 1LDDA 1YW7A 2K27A 4PGHA 4P96A 2L02A 3OV8A 2HOEA 2PMUA 3JSPA 1KU9A 2RC4A 2COMA 2FF4A 3PKEA 4KN4X 4EQQA 1FWZA 3IRQA 2Y0MA 1E2XA 1AOYA 4S05A 1IN4A 1USTA 1FYMA 2JSCA 4EVIA 4KFCA 2L54A 1S7OA 2FSWA 4RGRA 1IZ1A 4U88A 2LDUA 1U2WA 3EDPA 3GFLA 2YPRA 1CF7A 2HR3A 3IRRA 3FM3A 2Q94A 1TQPA 1P2FA 3DKWA 1BOAA 1YW8A 3I54A 2G7UA 3PKAA 3M8EA 2JT1A 2ZKZA 3HUGA 5K5OA 1WLRA 2BE5F 5FFZA 3LAPA 1OKRA 1K7AA 4IHTA 1MGTA 2J5OA 2AS5F 1TNSA 1G3TA 2F5DA 2VT3A 2PG4A 3O2PE 1YJ3A 3WTZA 1TLHB 2EV0A 4HX7A 3ROUA 3I53A 3F8CA 1Z6TA 4U76A 2O8XA 4GYIA 3QP5A 1S6LA 4IVNA 1G3SA 3R6SA 3J7AO 5ICFA 2GG3A 2EVCA 2H09A 3LQRA 5IT9Z 3E5QA 2ESNA 4KMUX 3F21A 4FKCA 1YFHA 2NS0A 2FE3A 3CLOA 3HYIA 4MQ9F 4U7BA 4OIOF 5HS9A 5CVJA 2FNPA 1G6NA 4IU6A 3KZZA 4S04A 1WQ2A 2VODA 4KIFA 1P4XA 3I58A 2MBFA 3CJNA 3F23A 3KETA 1EH7A 2P6TA 2FMYA 2OQRA 3L24A 3JTGA 4AIKA 2V3YA 3K0LA 3T1BA 2Y48A 2GU4A 5DUIA 2EFWA 5E1WA 3RKXA 2BWWA 4TV7A 1Y0UA 3OOPA 5J8FA 2E1CA 1CF7B 3DXJF 2L4AA 4BHCA 4HX8A 2V3XA 3BJ6A 4OMZA 1U5TC 2PFBA 3JAMK 2RVCA 3CUOA 4I2OA 1R36A 4M73A 2GZWA 5DEQA 1IRFA 2OKNA 5CVVA 4YFXF 4BAYA 3Q5FA 2JPBA 3ML6A 3GX4X 4M9SA 1ZARA 2V6CA 4XBFA 1HW1A 3Q9VA 3BP8A 3LSTA 3E5XA 3SFZA 1HW2A 1ONVA 4KIGA 2EWNA 3HTSB 4GO1A 1XD7A 1U5TA 2AXLA 4BXUA 1FZPB 1RUNA 2GU7A 2KIMA 3MAJA 1RZ4A 2BV6A 4IHSA 4OOKA 3ABUA 5HDGA 5ICCA 5LGUA 3GZ5A 3BY6A 1O7LA 2HGCA 3FXQA 1IF1A 4CO8A 4ASNA 3KE2A 2M87A 3ZQ7A 1B4AA 2IPQX 2NAZA 4Q5SF 3ZMDA 4AWXB 5CVUA 3KP3A 3ZN0A 2WV0A 5CE6A 5IT9K
chains in the Genus database with same CATH superfamily
2E60A 1FBQA 4HBLA 4L9VA 2OC6A 1MNMC 1DPUA 2DDAA 3TKYA 1TL8A 3GTKJ 1NK3P 4A93J 2B3KA 4D7MA 3K7AJ 2ADUA 1MIJA 4IL6C 3WU0A 2P0WA 4WCGA 5M5XJ 2Q96A 3IH4A 4U6JA 3K4MA 4XONA 2LY2A 3G1OA 2BN7A 4KNYA 2GG5A 4C2UA 3KZYA 3QOEA 4ENMA 2CQNA 2JZYA 2WC2A 1ZGWA 4ZNGA 5IP7J 4S01A 4EJVA 4J00A 2V1XA 4PCQA 4IEJA 3FXJA 4W1UA 4V2GA 3GZ6A 2EK5A 2CUFA 4I0AA 1BJZA 4JUQA 3F22A 2E19A 3GW2A 1V55H 2KHMA 4B8XA 4M6VA 1Y8RB 1Z3YA 3FF5A 1R1UA 4RLQA 5FCFA 3AL0B 1P4WA 2KT0A 2LREA 5FRMA 1N25A 2NVQJ 4BQNA 4EM1A 5FD5A 1U5TB 5J1UA 3QOPA 3LSRA 1B9MA 4LJZF 4XKBA 1T08B 3P9CA 4P1WA 4RS8A 4IKRA 3TO9A 2LYCA 2E7XA 2GA2A 3DBRB 1WSUA 1Y39A 3KP6A 1JUSA 4XKWA 2DO7A 1D5VA 4N9IA 3GMEA 2Y75A 2DTZA 3OYIA 4M3EA 1JXSA 4NC7A 5GTHC 3KP2A 1HDDC 2TDXA 3TO7A 3KP4A 4UXNA 1JT6A 2AXTC 5K7FA 2K9SA 2ESHA 2Q0OA 3BQYA 3X2QH 4GYGA 1DUXC 2QSGX 4IHVA 4IECA 1QZYA 1SFEA 4G9YA 5EEGA 4ZYHA 1SD7A 2LH9A 2LNBA 3CCRI 1JI8A 2DOAA 2KLOA 2VJ5A 3VYTB 2XAHA 2VKVA 2LBFB 2HPIA 3JSOA 2M9HA 5CIKA 2MH2A 3HOSA 4R60A 2XGDA 2KPMA 4I99C 2F4MB 3MVPA 4XLFA 2P4WA 3KLNA 3M9AA 2DLLA 3HC7A 4FISA 1IJWC 5TISC 3TQNA 4DYRA 2MFZA 3H92A 4Q48A 2E5NA 4I01A 1R5GA 4ANJA 2Y69H 4XLPF 2A5YB 4RAYA 2VBYA 4C3HJ 3GWZA 4BYYA 4BDZA 1ZKGA 2HTJA 4CCNA 1YYVA 2EV6A 3WHBA 3VEPA 3D5RC 4U0VA 4BQQA 2QWWA 3SQNA 4RM3A 2XIGA 3BZ6A 1Z7LA 2H6CA 3ABTA 1YHQI 3DEUA 2Y9ZA 3I55I 4UUVA 3MKWB 4PSXA 4MO7A 1Y1NA 3PIOF 5JLWA 2RNGA 1QPMA 4PSWA 4XORA 1I50J 5E20A 1T0FC 1R49A 5L3DA 4CYCB 3WGIA 4CGZA 2YU9J 3O3KA 3ASOH 2HEOA 4BJ6C 1IG7A 5EEHA 1BA5A 5ICEA 2KMUA 3J7AY 4U6WA 4Y7NJ 3EUAA 4N4OB 1PP8F 4WK8F 2DODA 4XN3A 4IDYA 5BPIA 2LMDA 2H8RA 5E8IA 2GG7A 4A6VA 3J80Z 1S72I 2O8KA 5HLGA 1MNEA 5IT9K 4UB8C 4OIPF 3PQJA 3HOYJ 2P99A 1K4SA 1RKTA 5K1YA 2QM3A 4AVZA 1FOWA 4I98B 1D8KA 2M4GA 3MWMA 1T0FA 2XAQA 2QZ8A 2N8GA 2VB6A 1ZYRF 2HDCA 3OR2C 3RZOJ 2DT5A 2E2JJ 1I1SA 1BIBA 1YQAA 3CB6A 4DOZA 5K7ZA 1WH5A 1Z05A 1QO0D 2CV2A 1RIOH 4KIBA 3KZIC 4XLNF 1CQTA 1QPIA 4U71A 2GG2A 3K1NA 3ZPLA 2ISZA 4D7NA 2RAEA 2NXNB 2M2EA 2HVRA 5LHHA 2I5UA 4NDLA 5GPCA 1IXSB 2HYGD 2O7OA 2OCCH 2R5YB 5E17F 2WB1A 2EFPA 3LA3A 4E7LA 2ZSHB 4PJLA 2PEXA 2EQRA 3CCLI 5D4RA 3S1MJ 3BR2A 2NNNA 1LKXA 3MQ0A 5JFRA 2PBIA 4AIJA 1K79A 3DPTA 1F5TA 1OCTC 1FSHA 4ZC3A 2ISYA 3BJAA 4RGSA 2UZKA 2EILH 1MJAA 4U75A 2MD5A 4U0WA 2V3ZA 3D27A 4FLIA 1SMTA 3LSPA 2VE9A 1S29A 4HQEA 3MR1A 3BR0A 1FX7A 4CCLA 5FCHA 4G6DA 1ORKA 1HW5A 2W00A 1LDJA 1VQLI 1U9OA 1V5EA 4PDKA 1P92A 1LJ9A 2FQ3A 2OZ6A 2JSPA 2VKEA 1VQNI 1Q1VA 3SZTA 2NVUB 1RPWA 5E1XA 2GZ5A 1WI9A 3CCJI 1OCPA 4IKSA 4A6WA 4Z7MA 5ERIA 1W5CC 3H35A 2Z5UA 5HLTA 5M5WJ 1W7PA 2RN7A 1ZG5A 4RBOA 2ZMEC 2DPDA 3KEYA 2JN6A 5F0HA 5JI6A 4HXXA 4MATA 5BMZA 1FEXA 4FT8A 2IA2A 2F5FA 3R0JA 4JYKA 1I5ZA 1MBKA 2PJRA 2LP0A 4KN7X 3HPGA 3FX3A 2ELHA 5TRDA 3CC4I 1XGMA 2BY3A 2WA0A 3TO6A 2MH9A 4A3FJ 1PV9A 3OYCA 5IT3A 1DDNA 4BKXA 2Q2EB 1VQKI 1JUPA 1APLC 1KU3A 4M74A 2IA0A 1EF4A 2GOMA 2BWVA 3SXYA 4NC8A 4EJWA 1L0OC 1P9QC 3ZMZA 3V8KA 2KDOA 3W6KB 3WTVC 3OIQA 1HCRA 4ZWUA 2R7FA 2ZMEA 3G1MA 3HPHA 3JRIA 4BE0A 2EJRA 2DOEA 1UAAA 2XROA 3L2WA 5E18F 4FTHA 4IPAA 3GLLA 1XDUA 2AO9A 1X3UA 3V4GA 1YVMA 4WXHA 2YSRA 3KLOA 1P7IA 4KITB 5F6FA 2GBYA 2XAJA 1IXCA 2E34A 1J0RA 2XGXA 1B8IB 5L3GA 2MC3A 1F36A 3WHCA 1JKQC 4LFUA 2P98A 1QXYA 3LA7A 1NHAA 2A68F 3GLXA 4U6EA 4KA4A 3J80K 3CP8A 3HBLA 1R00A 3OY9A 4FHTA 2M8GX 4D5FA 3HOUJ 2YS9A 1AKHB 3U2RA 4UNOA 3GO5A 2HQ5A 2JJ7A 2FRHA 2HOSA 1HC8A 2DFEA 2VT2A 3BQZA 3QAHA 2VBZA 2OAZA 3K4NA 4ZWOA 2YU3A 4EMSA 3MZYA 1ON2A 3DKYA 3RKWA 2X6YA 2BY1A 3OMYA 4BHBA 4U0YA 4BJTA 5IYBJ 2R7WA 3WU2C 1VQ8I 1KYZA 5FGMA 4AIHA 4HF1A 1ZR4A 4ZYDA 5LEJA 5B5EC 1KU7A 2GA1A 4XRMA 3WTXC 4KDPA 1X1BA 3F0CA 4AC0A 3GBGA 4E6KG 3OIPA 1YS6A 5F08A 5FO5A 2MD0A 4CDGA 4YELA 1BR2A 3HGYA 5E1ZB 4I09A 3JAMZ 2GGCA 1BR4A 3VDXA 4BY1J 2PJRB 3S16J 1OJLA 5ED4A 5GAEJ 1K6OA 4YFKF 4OAZA 1SFXA 3CCEI 4ZJZA 5LGTA 2UV1A 3PJRA 3Q9SA 1ETOA 3LSGA 4LG0B 1WFXA 2XAUA 3IAS2 2B7EA 1BC7C 3HOZJ 1C27A 2HOAA 1VTNC 2ID3A 4U73A 2EIJH 2ZCWA 1ITYA 4A5MA 1I3QJ 2DMPA 2IT0A 1Z7UA 2MABA 3LWFA 2CV0A 4I02A 5HS7A 3E0JB 2Y0SA 2VKHA 1PVEA 3NQOA 5HODA 3E3VA 3MATA 1JTYA 2B0LA 2ZMEB 2OQGA 3ZXSA 1L3LA 2K9NA 3RDIA 4BNCA 4ZDLA 4FETA 2ETHA 2DW4A 4HLXA 2HU9A 4WXCA 2E71A 1C21A 2NVYJ 4WF2A 3GZNB 5C44J 3OYGA 3H0GJ 4AU7A 1HXDA 1JUMA 1XB4A 3L7WA 1TWAJ 1NK2P 4HA8A 4BBSJ 1YE9A 1I6XA 2K9LA 3LSIA 1XCBA 1WI3A 1XDSA 2LSOA 1H9GA 2QGUA 1H0MA 4LGWA 4FE4A 3SEZA 2HDDA 4RGUA 1DP7P 2ZJ2A 2CS3A 2WBMA 2CW8A 2JRTA 1BJAA 2HPMA 5J1YA 2CQXA 5B66C 3CB5A 1J5YA 3RPQA 2XRLA 2A6HF 4X6AJ 1MJBA 2Z3YA 3FXLA 5CPRB 1YLFA 4OOIA 4BQOA 4II3A 2HQNA 1SANA 2KZGA 2XSJC 2FBHA 1OQYA 1WJEA 2P5KA 3BOQA 3VFZA 3DP7A 2ZNYA 2L7MP 2M7BA 2VPLA 1A31A 4U7DA 4RB0A 1KQ0A 2D1VA 4CYDA 1GXQA 3TW7A 3SFIA 1QU3A 2GG8A 3GFJA 3H5RA 4MNUA 1LDKB 2UWMA 2A61A 2O5RA 3HRUA 3KEOA 2EFNA 2IJLA 2UXNA 3ISPA 3MKZA 4RGXA 4ZH4F 1WJBA 1WGXA 4P5OA 3D1NI 2MGQA 1ZG1A 1MW7A 5IPAA 3CMYA 2L01A 4IF7A 2HVQA 2ZO4A 4PJ0C 2LKPA 4B3XA 3BTLA 5BNGA 3S6BA 1W7VA 2FA5A 3CCVI 1MMDA 2VQGA 1WRJA 4MHGA 5HLIA 4DYQA 2M1BA 3LSHA 3NWSA 1ZLKA 2WAFA 3ZN1A 4RAGA 2H6BA 3PO3J 3ZMTA 3K69A 4PNCA 2DCEA 4BHPA 1GV5A 1GVDA 4JP0A 3HOTA 4IRGA 5CVIA 5DDGA 1ETKA 2IP2A 1TW3A 3P5JA 1RUOA 2HI3A 1ZH5A 2KJBA 3T5XA 3TL4X 3P9IA 2PMZA 1VQPI 2BHBA 3OYDA 2CW0F 2R7RA 3T0YA 2QBYB 3CCQI 4XLEA 5FRNA 3S2DJ 4U69A 2JPCA 4X0GA 2OU2A 3FBNB 4H0EA 4NC6A 5CVRA 1E17A 3C18A 4LOCA 1E3PA 4C2TA 2BHAA 2KRCA 1ZTRA 4HLYA 1DGWY 1HSTA 2X51A 3EUHA 1HA8A 1XMKA 3DF8A 2QQ9A 1T33A 3ZMVA 4RGZ1 2DI3A 1R1VA 3R4KA 4B48A 3FK6A 3HOXJ 4EGZA 1QBJA 3A1YA 5DCMB 1ETWA 1X2MA 3I3LA 2FMLA 3ZGKA 1V5FA 4N9HA 1YS7A 1Z6RA 3S15J 1X58A 1G3WA 4PJJA 2F4OB 3S93A 3GEZA 2XRNA 4XRSG 3GUDA 3BZKA 4G7HF 1J75A 1YJWI 3K4CA 1FOKA 4CA0A 1R4NB 3PQKA 4BH9A 4IX7A 1BC8C 4U87A 4XMYA 1D3YA 2A3SA 1H9TA 5E79C 3ULQB 1JJ6C 1KP0A 3U9GA 1DPRA 5E5BA 3AAFA 4Y4RA 3BJOA 3CJTB 3GFMA 4Y33A 1MBGA 3OOUA 2DFIA 3CF2A 1UHWA 5CLSA 4N4NB 1X1DA 1LNWA 3M1CA 4ZDPA 3BLYA 1LVKA 3KYLA 3CCUI 3GYHX 1YO5C 4HNTA 1FT9A 3HEFA 4RAFA 3E6CC 4BEHB 3BG6A 3DV8A 3HM5A 4XRSA 1RI7A 2AQEA 5CQGA 1MH4A 2TRTA 1WH7A 2F2EA 2OV7A 2Y0SN 3DBLB 4XR6A 5EJCA 5LEKA 3B6AA 3L09A 4E4HA 1JKRC 4B4CA 2EIMH 1O57A 4BL0B 4FLKA 4M9XA 3WGGA 1S8NA 4CZCA 1BI3A 3DCFA 1T38A 2GXBA 2O3FA 3HSEA 2CJJA 2CUJA 4YIIA 2KFDA 1GVJA 3S2WA 4XL9A 3O8HA 5DM7F 3PKBA 5L3EA 2M45A 4C3JJ 4BGDA 3S32A 3EYIA 2QENA 4LIVA 4RB1A 5CQEA 3M07A 3SDBA 4A0YA 5GTIC 2GXGA 2ZBKA 2BGCA 3RPUD 2VOOA 1Z0XA 3L2QA 3FK7A 1FC3A 2R3SA 1UFMA 2TCTA 2A6TA 3PUBA 3MN2A 1GDTA 3JRDA 1WZ2A 2ACJA 2KDZA 3QU3A 2R7QA 5HLHA 4F92B 2W84A 4KICA 5ILVA 2R7XA 1HKSA 1ZAOA 5D4SA 3FXKA 1FBSA 2QCOA 2BH3A 4E7SA 2VOPA 3CCMI 2EA4A 3HB9A 4EGEA 4V2FA 2O61A 4F7ZA 4FASD 1R5HA 3IWFA 1JGGA 4ENNA 2R7VA 4UVAA 2J5PA 3A03A 1AU7A 4IJAA 5ILSA 1IXRC 5EG0A 1ZQ3P 4CYCA 2DMTA 3ERED 2EA2A 1JGSA 4XKCA 2CO5A 2XB0X 3I5UA 1SD6A 4G6QA 2E2HJ 1R4MB 2DA4A 2FU4A 2JVHA 1JTXA 2NS8A 1IV6A 2KL4A 3DLLF 2BOLA 1BN5A 2KIUA 2VN2A 4M6YA 5DYMA 1ETYA 2XVCA 3F8BA 2Q93A 3TDZC 2X1EA 1IN5A 3Q6DA 3VSKA 4XM3A 1XGNA 2LOOA 4MGRA 1XNZA 1OCOH 4JX4A 2LR8A 4LD5A 3G73A 1VQ9I 1YIOA 4ABZA 3JRHA 1AHDP 3JRFA 1IGNA 2MATA 1UG0A 2LD5A 1I27A 4S00A 2L9SA 3K1PA 1TW2A 4WXDA 2LY1A 2LF7A 3CZ6A 2XHKA 2KISA 4QTRA 3Q0WA 1HSJA 2BWUA 2PMZN 3VPRA 2VONA 1K6YA 1NG7A 3KP7A 1Z91A 3QPLA 3WG7H 1QVUA 2JUGA 1OYWA 3CLQA 2BWXA 2VI6A 3TAVA 4HAMA 3PUFA 1WJAA 2EZKA 3VOEA 5LHIA 1XTAA 2R5YA 2DTRA 4IOCF 1BW5A 1YJNI 2WWYA 2WAEA 5TGTA 3TOAA 2P9AA 2OF7A 4EM2A 1FSEA 1IRZA 2CMPA 3HRSA 3W2VA 1IO2A 4XOPA 1BI2A 2KZVA 3FXMA 2LVSA 3K70C 3CC2I 4RAZA 5J3LA 3T8TA 4Y15A 1VQ5I 4FLJA 3HDDA 3CDHA 2ME6A 5IYDJ 3KYDB 5JHFA 2W25A 2R4GA 5EZHA 3I71A 2FJ1A 2STTA 1HOMA 3F6OA 3MMYB 1MBFA 2WY7Q 1SD5A 1EV7A 1OR7C 3S17J 3V7RA 1MBEA 3KPHA 3PNVA 4CICA 1R71A 5LFAA 2VJIA 3WODF 2M5WA 1HBXG 4ZZDA 1ACIA 1HDPA 4CCOA 2IVMA 2HS5A 5J8CA 2DQRA 2H1LA 3OYAA 4KYWA 3H5NA 4R8HA 4RMNA 9ANTA 4G8XA 5EG0B 2R0QC 4U6ZA 1R23A 2X9DA 4OU0A 2VL8A 4B44A 1E0EA 1D0ZA 3FISA 2HKXA 3ERMA 1J7KA 2GU5A 3L7GA 1O3QA 1BI0A 2Y2ZA 4LIUA 3ZQQA 3RZDJ 2IS2A 2L0KA 4P9FA 3S1QJ 4LMYA 2ZJQF 3K1MA 1VI0A 3ZQFA 1W36D 4OIQF 2HTSA 3ECHA 3KCCA 1LUJB 1KYWA 3OS0A 5GAHJ 1TWGJ 4IKFA 3IG4A 1R1TA 3DU6A 1X1PA 4IF4A 3U1KA 3VODA 2HNHA 1OR7A 3E6MA 2GOXB 2Q2EA 4FLLA 5KAIC 4M9ZA 3SYTA 1K78B 2Q1ZB 1MD0A 4PFOA 2MYSA 3BIQA 4HDVA 3WTUC 4S0HB 3M8FA 2H8WA 3GF2A 4HSTA 1B6AA 3DWLE 5F64A 4O5VA 3PNTA 5K5QA 1QA6A 3H3UA 1MBHA 3CP2A 3BDDA 4HYEA 3LQQA 4LG3A 1IN8A 5HS8A 2BZTA 2Q8KA 3IC7A 2PMHA 4GCVA 2NS7A 3R61A 1J59A 5F0CA 2I8DA 1IDZA 5BS6A 3F8NA 1GT0C 3PFYA 1WHUA 4A0ZA 1B8IA 1M35A 5C4JJ 2K85A 4UUSA 3J7ZI 5HVQC 5KCMA 1ZLJA 1NG6A 2WAQA 3NEUA 5FJ8J 2EZIA 5FKKA 2GG9A 3B6CA 1KU2A 3H9JA 4G94A 2XAGA 2OD5A 4DJAA 2VASA 1MMSA 1G59A 3I9V2 3WE3A 3J81K 1AKHA 2CQ7A 4CHUA 2O9LA 1B1BA 2QQAA 4Y13A 2IA1A 4Y3OA 4DNCA 1JJ8C 2MW8A 4BUPA 1ZELA 2K9QA 5DCFA 4M71A 4DBRA 2Q92A 1YOVB 2F5CA 1PUFA 5D5WB 4S2TP 4UY8I 4ESBA 4CSWA 3VYRB 2DK8A 3GVAA 5FROA 4XRFA 3VWBA 2IW5A 4XNFA 3R60A 2XDVA 4ESFA 2KKOA 2HKOA 3P7NA 4AD9A 3CMMA 4W97A 5J47A 1TT0A 2HXOA 2NQ7A 1E3HA 5HNFA 1OCCH 1FYKA 2DA7A 4M3BA 2LF8A 3JRAA 5AIPA 3GTGJ 2EH3A 4ESJA 2OBPA 5LLQA 2ZXJA 3I59B 5D8KB 1LEAA 1SFOJ 2X85A 4RM2A 2NVXJ 3OYHA 2JA8J 2RQQA 1VF9A 3LAJA 3CMAI 2VC1A 1O3RA 2ELJA 1T56A 3BZCA 1ETVA 4LG0A 2M8EA 2LFBA 3BIPA 1OMIA 1W5SA 3OYEA 2DMUA 2QQ8A 3MEXA 1MDMB 1W1WE 4AVPA 3GTPJ 2H1KA 1JHFA 3E7LA 2BXZA 3ELKA 2QSFX 3WTSC 4MQVA 2GLOA 1N77A 4ZYAA 2IRFG 4YFNF 5H6RA 2UUZA 1Y1WJ 3V7CA 4KM3A 2E1OA 3AG3H 1VFCA 1VQMI 2ID6A 4E7JA 4WX9A 2WADA 2Y31A 3M1EA 2FEZA 4C2MJ 1FJLA 2BWYA 2FXAA 3CUQB 3C7JA 1F1ZA 2X4HA 1U9NA 2ICWG 2MC4A 4XICA 2HQRA 2BHCA 5E3LA 4NB5A 3IV5A 2DN0A 1YX5A 3FXRA 3RYRA 2NOGA 2E36A 4E7IA 3A2KA 2BWSA 2XF7A 1P4AA 2KJCA 4R1HA 2NNYA 2DJNA 3TP3A 2Q95A 1SAXA 4HRIA 3C2BA 1C22A 2BEOA 1C24A 4UUSB 4NNJA 3MX6A 5CNXA 3I64A 3JREA 1REPC 3DPLC 2R7ZJ 2DU9A 5D5UB 2Z99A 3A0BC 3K4BA 4QIWN 4HNVA 1D0XA 3FBIB 4A3GJ 5D6EA 4PJNA 3F8MA 2R7UA 2XF6A 2EZLA 3A01B 1WCMJ 3AFHA 3CD6I 5AIQA 2IS6A 5DD4A 1JKOC 1LQ1A 1X19A 2XB5A 3ZQIA 1B72B 4MEXF 3D0SA 1S7AA 3A0HC 4C3IJ 2ZNZA 3FZVA 1IN6A 3E5UA 4A12A 1PUFB 2EINH 2D1HA 4GDFA 4M3FA 5J1RA 3AKZA 3TMOA 4E7ZA 1F9NA 5J4YA 1U6GA 1OCZH 3HXLA 2R93J 2CUEA 3BTCA 2FBIA 4ZYGA 3ABKH 5A2QZ 1A36A 5FLMJ 4JOMA 2MLGA 1R9TJ 2K9MA 4Q47A 2D5VA 1GXPA 1SEUA 2DYSH 4O3MA 2G6PA 3H9QA 1X2NA 2X1DA 3QODA 1WY2A 3REOA 1K4TA 4HV5A 2QQBA 1FPQA 1TNTA 2QKLB 2A05A 2W85A 5FD6A 1I1GA 4JK1X 4BXXJ 1X4OA 2L7FP 5B1AH 2ZFUA 1U8BA 3JTHA 2OTJI 1UZCA 2XKPA 4LLGF 1W0TA 4DIQA 4UVBA 2MA3A 5F1RA 3OYKA 1AWCA 4E7HA 1QQIA 3CO7C 2K7LA 1O7FA 1SD4A 2V9KA 4B1RA 3R0AA 4HPQA 5EGOB 3WU1B 3EQLF 1QNTA 4DYCA 3W6JB 2JQ7A 4A2UA 4EJUA 3OSGA 1FMWA 2QBYA 4A3LJ 4BY7J 4U6CA 2L2OA 1A16A 3LNQA 4M72A 3BR5A 3PSIA 2M34A 3ABMH 3WGHA 2DJIA 1TP4A 2WAQN 3N97A 3A4CA 1YG2A 1MMAA 4DBQA 1YIJI 5D6FA 5GPAA 2L3DA 5LGNA 5K5RA 1A6QA 1KQ8A 2D45A 4L0YB 4ZTFA 5LBQA 4FQGA 4HV6A 1ON1A 3V8JA 4ENKA 1TWCJ 3TW6A 3KYCB 3FIWA 3QP6A 5KVRA 3W2WA 2VQLA 4L9NA 1V5GA 4PK4A 4Y17A 2MLKA 1Z21A 1XS9A 5JR3A 3HTUA 2E7WA 2M0CA 3SDGA 2YX7A 3OYFA 5DCMA 1QRYA 2JA5J 5BPDA 1UG2A 3RI4A 2Z33A 1YI2I 5HDKA 4IQ4A 4P55A 4BXFA 4BQAA 4D0PA 1VZ0A 2V26A 2LY9A 1FOYA 4ENJA 1FBUA 2DBBA 5C3EJ 2BB7A 4A3CJ 2W57A 4XLHA 3HRMA 3N4MA 1WVRA 1XSXA 2X48A 2VBWA 4XIDA 1P6RA 5H6QA 5E8GA 3OSFA 4A3KJ 2V6EA 1R5ID 3WE2A 2GU6A 4IO9F 2B63J 3D5LA 3E97A 2O6GE 3FHNA 3ZP5A 2GGBA 2CG4A 2RNJA 1WJCA 1CHMA 2ZFWA 4XSXF 2ZSIB 2WV1A 3CDLA 1G4DA 3OYLA 3ZQCA 4A6DA 3L1PA 4IRHA 3AG1H 3CTAA 1D1CA 2HOTA 1E3OC 5L3CA 1R7JA 2LK2A 4XK4A 1ETXA 4LLLA 3RQ4A 4BEHA 5J6XA 1IUYA 1V3FA 2A07F 2VKDA 2CYYA 2Z1DA 2PQ8A 3FXUA 2X0LA 1V54H 1G3YA 4BE1A 3PIPF 4UV9A 1VQ4I 4E70A 5M5YJ 1T95A 2DQLA 2R92J 4B43A 1WWXA 1U8RA 5CDLA 2L9VA 3C2GA 4UVCA 2QYOA 5F27A 2PN6A 2P7VB 2VBXA 3BG3A 3GXOA 4PJMA 3PL8A 1ETQA 3M7GA 2EB7A 2DA1A 2XKOA 3KFWX 4IKUA 1IAWA 2JRMA 5CYVA 5LRRA 4FX4A 1W4MA 2A69F 3K10A 3QWLA 1EJ9A 3MZHA 5FKMA 2P7CB 1ZN2A 3BTJA 4B28A 2B3HA 4CZZA 2H94A 2XPUA 1XGOA 4JBAA 3JRCA 1A04A 4F3QA 1FYLA 1XGSA 1ODDA 4ITVA 5A2QK 2VXDA 3FDYA 1MNDA 3HHGA 2K40A 2VPRA 4XKVA 3RTRA 1LFBA 2GXAA 1OLTA 4IRIA 3C3WA 3TDUC 5JVTA 3SEQA 3DKXA 5IP9J 4MFDA 4U70A 2BYVE 2G7HA 1TZLA 3G1LA 1G2HA 3QYBA 1EKEA 1QHHD 1SVOA 3SHFA 1KGSA 3B02A 2DXIA 4AYBN 4BDYA 4XSZF 1OISA 4MTDA 4IHWA 1Y8QB 4HDUA 2XV4S 2AQFA 5HNHA 3E6DA 2P8TA 3H1CA 4Z2YA 4A6EA 4QWQA 4F52A 1Y0NA 3TGNA 2CFXA 1JHHA 5B3SH 2CGPA 2HDWA 3RJPA 1FNNA 4B47A 1HQCA 1DGRM 1W5TA 3VSLA 5M3FJ 1R58A 3BWGA 2PI0A 2HWVA 3HKZA 1IRGA 1S9HA 4I7HA 1SFUA 1IDYA 3BG9A 4YG2F 2RQPA 4KMFA 1LB2A 2K5CA 4PUSA 1T2KA 2V4JC 4P9UA 3IU7A 2NYXA 1C23A 1GHCA 2HFHA 1I39A 2QF7A 4L9TA 2W4SA 3LMMA 2GAUA 1T39A 2CV1A 1TQIA 4FO8A 3JRBA 2E1NA 4FE7A 4HW0A 1WBQA 2MG4A 2VIXA 2OCEA 1RKWA 3ASNH 4B09A 4YIFA 4N0BA 3BPVA 1ENHA 1S5LC 2RDPA 1Z9CA 3HSFA 4L0ZB 5DD8A 1EA3A 2LLKA 1U0JA 2DMQA 2OA4A 2R7TA 1H89C 3DLAA 1A5JA 1QZZA 4FO7A 3GCMA 2G9WA 5IP6A 3CTZA 5CJ9A 2K4BA 2HYJA 3L2CA 1D1AA 1WJFA 3FKIJ 3QYEA 1U3EM 2ZXWH 1SMYF 1Z1DA 3NRVA 4IXAA 2JA7J 4EV0A 1FLIA 3PNYA 3L2RA 2UXXA 3TOBA 5ILUA 3RKYA 3BG5A 2IW2A 4IOAF 2CRGA 1YTYA 4CCKA 2DFHA 3SJMA 4ZZLA 4NHJA 4JQFA 3FHZA 2R7SA 2CU7A 3H36A 4OIRF 2COBA 3S1RJ 2OPTA 4NQWA 1WL9A 1S3JA 4C30A 3DTIA 1YW9A 1MSFC 3LSKA 4A3IJ 1ZHFA 4A3MJ 3IKTA 1Z77A 2HYFA 1A35A 3M8JA 3NWTA 4QLCU 3MZ8A 4RLFA 4HF0A 1UELB 2V9VA 4JX5A 4AM3A 1X3ZB 2L7ZA 1BIAA 4IZZA 1YJ9I 4MLOA 2FNAA 5GADJ 1KZHA 2Z16A 3EETA 1YRNB 4NUBA 2VC0A 4H4KC 1UCRA 3VB2A 2QVOA 5CKTA 3NAUA 2QA4I 3QPTA 2HVSA 1HLVA 2FOWA 2BBYA 2D2WA 1J09A 3DTEA 1OYYA 3M3YJ 4HG2A 5KK1A 2YX4A 3F8FA 2XGEA 4PV4A 1O3SA 4FUKA 1BOBA 3HOWJ 2GQQA 3Q0VA 5CDVA 3K2ZA 4OINF 1CGPA 1R22A 4OMYA 2K02A 1G8XA 1D8JA 3CMEI 1FP1D 2VQCA 4MFEA 3FMQA 4RZZA 3I4PA 3OIOA 5E3OA 2P81A 4D5CA 4DZJA 1FOXA 4FCYA 1H88C 1K78A 1RC9A 5D5XB 3KP5A 3J81Z 1QXZA 3HZJA 2NQ6A 3TB5A 1D0YA 1PDNC 5H20A 1TQMA 3IU9A 2P5LC 3H3VK 4A5NA 4A3BJ 4ON0A 2CFOA 3H0DA 3E6BA 2CQQA 4XOTA 3I0TA 2GTXA 1LE8A 2QLZA 2L4MA 1IV8A 5EYRA 1MSEC 1JE8A 1Y56A 4Y52J 3ABLH 5FKNA 1W7PD 4L5IA 3TBIA 4GRIA 5DM6F 3B73A 3IL2A 1MATA 2IGMA 3AG4H 1XMAA 3U1DA 1DP3A 3LSMA 3P9KA 2RV8A 3WTYC 3ZMUA 4XN0A 4J19A 2DT6A 5CDEA 3N05A 2EVOA 3EYYA 5FKOA 5L3FA 4QR8A 3V7SA 1QHGA 2L5QA 3C1DA 4GGGA 1IW7F 3UR3C 4MEYF 3FXOA 5DTDA 1JAWA 4QPQA 4FX0A 1OCRH 4HSRA 4NQWB 2P5VA 5J4VA 1RRJA 5IOZA 1D5YA 2R5ZB 2VQHA 2BVLA 5DUKA 5FB2A 3QRFF 3V42A 3QU6A 3FM5A 4A69C 2PLYA 2Y9YA 1MJ9A 3HSRA 2F5VA 3CF5F 3RSNA 2AHQA 5HOOA 1WJDA 3F72A 4EEFG 2P6SA 3L2UA 3S3MA 2MSYA 2WTEA 2NOJB 3V8LA 3HKZN 3ZQGA 1T98A 1X3WB 2KQRA 4R79A 2HZTA 2L9NA 2XC7A 4PFPA 2JTVA 5FLXZ 1WN1A 4BS9A 3WTTC 1RNLA 1D1BA 3AG2H 2OJED 4M3DA 2OTLI 1ZK8A 2FQ4A 4XLAA 3MFKA 2NRAC 2DK5A 3HG9A 4QSHA 1TWFJ 1UMQA 2ECCA 3HGGA 3G3ZA 4RZYA 2F5EA 3LA2A 3W3CA 3G6EI 1ZRFA 2GM4A 2L9RA 3BR6A 3CUQC 2ZC2A 4OWRB 2ME0A 4RDUA 3I59A 4KT5C 4UV8A 2GWRA 1RESA 2V1UA 2DFFA 2LC2A 4M6XA 4ZTJA 2DA3A 3CJRB 4MIMA 2EFQA 5BQTA 1DU0A 2E5ZA 2IGKA 1LFPA 1MDMA 2EIKH 1EH8A 5B1BH 2M7AA 3U21A 2V79A 4UHTA 1LEBA 1WL6A 3G2BA 4KUMA 3BITA 3L2VA 3PFIA 1VQ6I 2M0MA 1N78A 3G71I 4I6ZA 5AONA 1NH3A 2W48A 1ZREA 4LB5A 1BI1A 4I0BA 1BL0A 3W6VA 1SFKA 3CUQA 3BPXA 3H9GA 2BHYA 3RPUA 3SZPA 4E7KA 1LE8B 2KP6A 1QXWA 5F04A 2BW3A 3GTLJ 2CUZA 2M30A 4GXOA 5DV5A 2VJJA 3RIRA 2V7FA 3E1SA 5D5VB 2QEXI 1FTTA 3S14J 3FKJA 3HHHA 3WG9A 5D8LB 3I56I 2QUFA 2IGNA 2O0YA 3ECOA 4A3EJ 4DZPA 1GUUA 1USSA 2VXZA 2DPUA 2LG4A 2VJ4A 2K4JA 2YR2A 4EM0B 1XMXA 3WTWC 1VQ7I 1XCVA 4AIDA 2XASA 2A6EF 3A01A 3PO2J 3LFUA 4X1EA 4L9JA 5E3NA 3HOVJ 5GP9A 2DMNA 3GTQJ 1BM9A 1Y6IA 2FD5A 2CWEA 2O03A 3W2AA 3M4OJ 3O8GA 4UUTA 2EVMA 3BCBA 1B72A 1ULYA 4HX4A 2E2IJ 4CXFA 5FFXA 2HOWA 4O6JA 1IN7A 1MBJA 3OWTA 1N51A 1J9IA 3CO6C 1XSVA 3QPHA 3FMSA 3FMRA 4LK1F 2ECBA 2BY0A 4LK0F 3HIFA 1U78A 2B3LA 2XF5A 3ZQHA 1JT0A 1TBXA 5TJJA 3ZMSA 2DOFA 2V1DA 3IHUA 4BJ5C 2X6XA 3BROA 2H27A 1B9NA 1HKQA 3OYJA 2A5WA 1UHMA 4EJTA 1J2XA 2BHDA 2V9PA 2CQKA 1PYVA 2FX0A 3DEEA 2FBKA 3L00A 3BR3A 2PJPA 3DPUA 2JK3A 1MMGA 2G0EA 2DA6A 3HRTA 2LRDA 1ZGJA 3BCAA 4U1BA 2VE8A 4L5JA 3RQIA 3NARA 4WWCA 5LD2C 2E35A 3TP0A 2QSHX 4ETSA 4ZYEA 4HZFA 3EPZA 1SVMA 1PUEE 2W24A 4V19K 1FP2A 5LRSA 1YX3A 2XAFA 1B59A 3IWZA 1QGPA 3ESWB 2GIVA 2RKHA 5EGOA 5EEAA 1FY7A 3H3ZA 4K2EA 5ICGA 2KIFA 1Q1HA 1ZG3A 2X1CA 2XGCA 3IH2A 3F9KA 5IY5H 3PKCA 3FWEA 3K9TA 3RKQA 1UHSA 2F48A 3OS1A 5FLXK 1T8IA 4G12A 2FOKA 2V1NA 3MKYB 4A0XA 1T6SA 1UB9A 2IXSA 2BW3B 2M3AA 3BG7A 1MKMA 4EJOA 2JMWA 1X1CA 4YEJA 2NVTJ 2IS1A 4IKTA 4XQFA 2DAOA 4RB3C 4IQJA 4Z6YA 1K61A 1TC3C 3COAC 1X4PA 1W36C 3JW4A 1O3TA 3A02A 3KEQA 5LHGA 2BWTA 4ZDOA 2R7DA 3PKDA 4MTEA 2PX9A 3RYPA 5EDNA 1EH6A 4D1QA 3RORA 2XUBA 1OPCA 4PGGA 4F93B 4RB2C 1MZBA 2I10A 2YUSA 1OYIA 4LLNA 1TTYA 4PZJA 2BXYA 4F55A 1Z3XA 2C6YA 2EFOA 2STWA 1ERDA 1M1EB 3IUOA 4AYBA 1BBYA 3ZOBA 1JKPC 1XN7A 3DFGA 1W2MA 3LFKA 3IU8A 1XSDA 2L7KA 5HDNA 4Q4ZF 5KAFC 3DQVC 2GG0A 5F0FA 3MCZA 3RVAA 1YITI 2DA2A 2K3PA 1SAUA 1STZA 3ZCOA 4D9JA 2LKXA 1RR8C 1F4KA 4AUXA 1WKMA 2OZUA 4HF2A 3UNGC 4S2RP 2GIZA 2IEKA 2LKSA 1XPXA 1IRXA 1O0XA 1XC5A 2Y30A 3F3XA 3DEWA 4HOBA 5K7HA 1HKTA 2ZSGA 2KRFA 1KQ9A 2HZDA 1V4RA 2CSOA 2ELKA 3PM1A 3IAM2 4CH7A 3ZQLA 3H5AA 3L9FA 4G7ZF 1ZRCA 1SVLA 2Z9OA 4ZWPA 4NBQA 1LVAA 4EGYA 1A6IA 2ZXHA 5L3BA 3I4NJ 3K4JA 5JHUA 3F6VA 4G7OF 1MMNA 1KA8A 5M3MJ 2CH0A 6PAXA 2EV5A 1PP7U 3T8RA 3TEDA 4HQMA 4LB6B 1F43A 5BOXA 3PSFA 1DU6A 3OYMA 1HF0A 4DQ2A 3Q0UA 1W7PB 1ZRDA 3O6BB 3S1NJ 2RGVA 2K86A 4CCJA 4A3JJ 3GFIA 3IKVA 1ZGAA 1FIPA 2ZXIA 3OL4A 4L18B 1C0WA 1LDDA 1WPKA 1YW7A 2K27A 4P96A 2KRHA 1MH3A 2DT7B 2L02A 3OV8A 4PGHA 2WY8Q 2HOEA 2DYRH 2PMUA 1I3AA 2IBDA 3JSPA 1KU9A 2RC4A 2COMA 4CCMA 3J7YJ 2FF4A 4LITA 3PKEA 4HEA2 4KN4X 4EQQA 3BR1A 1FWZA 3C2HA 3ZR8X 3CC7I 3IH3A 3IRQA 3MD2A 3CESA 2Y0MA 1W0UA 2ZJRF 1AA7A 1E2XA 4L5EA 1AOYA 1FIAA 3OL3A 4S05A 2X6WA 1IN4A 4UB6C 1USTA 1FYMA 2JSCA 4EVIA 4KFCA 2L54A 4KJZA 1S7OA 2FSWA 3DBHB 1IZ1A 4RGRA 4U88A 3I4MJ 4II2A 2LDUA 1R6RA 1IC8A 1U2WA 2WB1N 3EDPA 3GFLA 1OFCX 3MKLA 2YPRA 4BBRJ 2HR3A 3OS2A 1CF7A 3IRRA 2BY2A 3S3NA 3VYSB 3FM3A 2Q94A 1TQPA 1P2FA 3DKWA 1BOAA 1YW8A 4A3DJ 2XPVA 3I54A 4BE2A 2G7UA 3PKAA 2LTPA 3M8EA 2JT1A 4YRVA 2ZKZA 3HUGA 5FKLA 5K5OA 1LPQA 3S8PA 1WLRA 3Q3SA 2BE5F 4G6TB 5FFZA 3LAPA 3S3OA 1OKRA 1FTZA 5DS9A 1K7AA 4IHTA 1MGTA 2J5OA 2AS5F 1TNSA 1G3TA 2F5DA 5EZGA 4DW6A 2VT3A 5C4XJ 3DTKA 2E1MC 2PG4A 3O2PE 1YJ3A 3BT9A 3WTZA 1TLHB 1XG1A 5JLXA 2KIQA 2Z2SB 3GTMJ 2EV0A 4HX7A 3ROUA 4QPOA 3HL2A 5IOYA 3I53A 3F8CA 3CDIA 1SC7A 1Z6TA 2HXIA 4U76A 2O8XA 4GYIA 4YIRX 3QP5A 1S6LA 3CJQB 4IVNA 5KHDA 3RCOA 1G3SA 2RREA 1POGA 3R6SA 3J7AO 5ICFA 2GG3A 2EVCA 1RR7A 2H09A 3LQRA 3QYFA 5IT9Z 2IS4A 5GAGJ 4EATA 3E5QA 4OAYA 3ZRGA 3QQAA 1BR1A 2ESNA 1BW6A 4F91B 4KMUX 3JCUC 3SZGA 3F21A 4FKCA 1YFHA 2NS0A 1P7JA 2JVGA 3KX2A 1TWHJ 2W1OA 2FE3A 3CLOA 3HYIA 2IAIA 1Z67A 4MQ9F 4U7BA 4OIOF 5F1JA 5HS9A 5CVJA 2FNPA 1G6NA 3K4LA 1O4XA 4IU6A 3KZZA 4S04A 3KIOA 1WQ2A 1FMVA 2X6OA 2VODA 3OYBA 2BVMA 4KIFA 1P4XA 3OR1C 3I58A 3EUHC 4M3GA 2MBFA 3CJNA 2W82A 3F23A 3KETA 4IHXA 1EH7A 2P6TA 2FMYA 4B3AA 3OYNA 3CQZJ 4GFBA 1N75A 2OQRA 5E3MA 3L24A 3UKGA 2ZB9A 3JTGA 4AIKA 2V3YA 3K0LA 3T1BA 2Y48A 3CCYA 3BTIA 3CCSI 1VQOI 2GU4A 5DUIA 2EFWA 1I6HJ 3BC8A 5E1WA 3RKXA 4I76A 2BWWA 1PJRA 4TV7A 2VLAA 1Y0UA 3G4SI 4J01A 1YRNA 3OOPA 2DA5A 4KT6A 5J8FA 2E1CA 1CF7B 1KONA 3DXJF 2L4AA 2B9SA 3EUKL 5FLVA 3AL0C 4BHCA 3S2HJ 4HX8A 2V3XA 3BJ6A 4CUGA 4HNUA 2FUG2 1U5TC 2PFBA 4OMZA 3JAMK 3K4KA 2RVCA 3CUOA 2ZJPF 1X1AA 4BACA 1QVTA 1XX5A 2EBIA 4I2OA 1R36A 4M73A 3LSJA 3HUGB 2R7OA 2GZWA 5DEQA 1IRFA 2OKNA 2OUMA 5CVVA 4YFXF 2F4IA 1GV2A 4BAYA 1Y1VJ 3Q5FA 2JPBA 2JUCA 3ML6A 3GX4X 4M9SA 1QZEA 1ZARA 2V6CA 2W7NA 4XBFA 4JX6A 3K6GA 1HW1A 3Q9VA 3GTOJ 1ZR2A 3BP8A 1K83J 2CW7A 1GLNA 3LSTA 5JVGF 1TT5B 2DDBA 3D5SC 3E5XA 3SFZA 5IYCJ 1HW2A 1ONVA 4KIGA 2EWNA 3K2AA 3HTSB 2BHZA 3HJEA 2K3FA 4GO1A 4KISA 1XD7A 1U5TA 2IGOA 2XPWA 2AXLA 3LOCA 1IUFA 4BXUA 1S7EA 1FZPB 1RUNA 2GU7A 2KIMA 3MAJA 2JA6J 1RZ4A 2BV6A 1LFUP 4IHSA 1WJ5A 4C9YA 1UJ8A 3ABUA 5HDGA 4OOKA 1VNDA 5H2FC 4IHYA 4XLCA 5ICCA 5LGUA 3IP4B 1DQUA 2EPFA 3ONQA 2HQAA 3GTJJ 3GZ5A 3JR9A 3BY6A 1O7LA 2E1MB 2HGCA 3K70D 3LL7A 1H8AC 5J40A 3FXQA 1IF1A 4DGWB 4CO8A 4ASNA 3KE2A 2VUMJ 3JRGA 2R5ZA 2M87A 3ZQ7A 3VYUB 1B4AA 3DU5A 5KNLA 2F6CA 2XSDC 2IPQX 5EF6A 1NTCA 2NAZA 4Q5SF 2QKMB 1RETA 3ZMDA 4AWXB 5CVUA 2LBFA 4BU2A 3KP3A 3QPSA 2JA2A 2JWTA 2EZHA 3ZN0A 2WV0A 5CE6A 2M4KA 4RA2A
chains in the Genus database with same CATH topology
4HBLA 1FBQA 4L9VA 1DPUA 3TKYA 2B3KA 2ADUA 3WU0A 4WCGA 2Q96A 4U6JA 2GG5A 2BN7A 4KNYA 3KZYA 4ENMA 2JZYA 2WC2A 4ZNGA 4S01A 4EJVA 2V1XA 4PCQA 3GZ6A 2EK5A 4I0AA 4JUQA 3F22A 3GW2A 4B8XA 3FF5A 1R1UA 5FCFA 1P4WA 4EM1A 5FD5A 1U5TB 3QOPA 1B9MA 4LJZF 3P9CA 4RS8A 4IKRA 3TO9A 2E7XA 2GA2A 1WSUA 3KP6A 2DO7A 1D5VA 4N9IA 2Y75A 1JXSA 3KP2A 2TDXA 3TO7A 3KP4A 4UXNA 2ESHA 2Q0OA 4GYGA 1DUXC 4IECA 1QZYA 1SFEA 4G9YA 5EEGA 4ZYHA 1SD7A 2LNBA 2XAHA 3JSOA 5CIKA 2MH2A 3HOSA 4R60A 2P4WA 3KLNA 3M9AA 2DLLA 3TQNA 3H92A 4Q48A 4I01A 1R5GA 4XLPF 2A5YB 4RAYA 2VBYA 3GWZA 4BYYA 2HTJA 1YYVA 2EV6A 3VEPA 4U0VA 2QWWA 3SQNA 2XIGA 3BZ6A 2H6CA 3ABTA 4UUVA 3DEUA 1Y1NA 1QPMA 5E20A 5L3DA 3WGIA 4CGZA 3O3KA 2HEOA 5EEHA 5ICEA 4U6WA 1PP8F 4WK8F 4IDYA 5BPIA 4A6VA 5E8IA 2GG7A 3J80Z 5HLGA 4OIPF 3PQJA 2P99A 5K1YA 2QM3A 4I98B 1D8KA 3MWMA 1T0FA 2XAQA 2QZ8A 1ZYRF 2HDCA 2DT5A 1I1SA 1BIBA 1YQAA 3CB6A 1Z05A 1QO0D 1RIOH 4KIBA 4XLNF 4U71A 2GG2A 3K1NA 3ZPLA 2ISZA 5LHHA 1IXSB 2HYGD 5E17F 2EFPA 3LA3A 2PEXA 5D4RA 2NNNA 3MQ0A 5JFRA 4AIJA 2PBIA 1K79A 3DPTA 1F5TA 1FSHA 2ISYA 3BJAA 4RGSA 2UZKA 1MJAA 4U75A 2MD5A 4U0WA 2V3ZA 3D27A 4FLIA 1SMTA 2VE9A 1S29A 4HQEA 3MR1A 1FX7A 5FCHA 4G6DA 1HW5A 1LDJA 4PDKA 1P92A 1LJ9A 2FQ3A 2OZ6A 3SZTA 2GZ5A 5E1XA 1WI9A 4IKSA 4A6WA 4Z7MA 5ERIA 2Z5UA 1W7PA 2RN7A 1ZG5A 2DPDA 4HXXA 5JI6A 4MATA 5BMZA 4FT8A 2IA2A 2F5FA 3R0JA 1I5ZA 4KN7X 3FX3A 2ELHA 5TRDA 1XGMA 3TO6A 2MH9A 1PV9A 5IT3A 1DDNA 1KU3A 4M74A 2IA0A 2BWVA 3SXYA 4EJWA 1L0OC 3ZMZA 3V8KA 3W6KB 3WTVC 4ZWUA 2R7FA 2ZMEA 2EJRA 2XROA 5E18F 4IPAA 1XDUA 1X3UA 3V4GA 1YVMA 4WXHA 2YSRA 3KLOA 5F6FA 2XAJA 1IXCA 1J0RA 2XGXA 5L3GA 2MC3A 4LFUA 2P98A 1QXYA 3LA7A 1NHAA 2A68F 3GLXA 4U6EA 4KA4A 3J80K 1R00A 4FHTA 3U2RA 4UNOA 3GO5A 2FRHA 2VT2A 3QAHA 2VBZA 2OAZA 4ZWOA 2YU3A 4EMSA 3MZYA 1ON2A 3RKWA 4BHBA 4U0YA 1KYZA 5FGMA 4AIHA 4HF1A 4ZYDA 5LEJA 1KU7A 2GA1A 3WTXC 4KDPA 1YS6A 5FO5A 4CDGA 5E1ZB 4I09A 3JAMZ 2GGCA 5ED4A 1K6OA 4YFKF 1SFXA 5LGTA 3Q9SA 4LG0B 1BC7C 1C27A 1VTNC 4U73A 2ZCWA 4A5MA 2IT0A 1Z7UA 3LWFA 4I02A 5HS7A 3NQOA 3E3VA 3MATA 2B0LA 2ZMEB 2OQGA 1L3LA 3RDIA 4BNCA 2ETHA 2DW4A 4HLXA 4WXCA 1C21A 4WF2A 1HXDA 1XB4A 3L7WA 4HA8A 1I6XA 1XCBA 1XDSA 1H0MA 2LSOA 1H9GA 4LGWA 4RGUA 1DP7P 2ZJ2A 2JRTA 1BJAA 3CB5A 1J5YA 3RPQA 2A6HF 1MJBA 2Z3YA 1YLFA 4OOIA 2HQNA 2FBHA 2P5KA 3BOQA 3VFZA 3DP7A 2ZNYA 4U7DA 4RB0A 1KQ0A 2D1VA 4CYDA 1GXQA 2GG8A 3GFJA 4MNUA 1LDKB 2UWMA 2A61A 3HRUA 3KEOA 2EFNA 2IJLA 2UXNA 3ISPA 4RGXA 4ZH4F 4P5OA 1ZG1A 2L01A 4IF7A 2ZO4A 2LKPA 3S6BA 1W7VA 2FA5A 1WRJA 4MHGA 5HLIA 2M1BA 1ZLKA 3ZN1A 2H6BA 3ZMTA 3K69A 4PNCA 4BHPA 3HOTA 4IRGA 5CVIA 5DDGA 2IP2A 1TW3A 1RUOA 1ZH5A 2KJBA 3T5XA 3P9IA 2BHBA 2CW0F 3T0YA 2QBYB 4U69A 2JPCA 2OU2A 4H0EA 5CVRA 1E17A 3C18A 2BHAA 4HLYA 1HSTA 3EUHA 1XMKA 3DF8A 2QQ9A 3ZMVA 4RGZ1 2DI3A 1R1VA 3R4KA 4EGZA 1QBJA 5DCMB 2FMLA 4N9HA 1YS7A 1Z6RA 1G3WA 3GEZA 2XRNA 3GUDA 4G7HF 1J75A 1FOKA 3PQKA 4BH9A 1BC8C 1D3YA 2A3SA 1H9TA 3ULQB 1KP0A 3U9GA 1DPRA 5E5BA 3AAFA 3BJOA 3GFMA 2DFIA 1UHWA 5CLSA 1LNWA 3GYHX 1YO5C 1FT9A 3E6CC 3DV8A 1RI7A 2F2EA 5LEKA 3L09A 1O57A 4FLKA 4M9XA 3WGGA 1S8NA 1BI3A 1T38A 2GXBA 2O3FA 3HSEA 4YIIA 1GVJA 3S2WA 3PKBA 5L3EA 2M45A 3EYIA 2QENA 4RB1A 4A0YA 2GXGA 2ZBKA 2BGCA 2VOOA 1FC3A 2R3SA 1UFMA 2ACJA 3QU3A 5HLHA 2W84A 4KICA 5ILVA 1HKSA 1ZAOA 5D4SA 1FBSA 2BH3A 2VOPA 2EA4A 4EGEA 2O61A 4F7ZA 1R5HA 3IWFA 4ENNA 4UVAA 2J5PA 4IJAA 5ILSA 1IXRC 3ERED 2EA2A 1JGSA 2CO5A 3I5UA 1SD6A 4G6QA 2FU4A 1BN5A 2KIUA 2VN2A 4M6YA 5DYMA 2XVCA 3F8BA 2Q93A 3TDZC 1IN5A 3Q6DA 1XGNA 4MGRA 1XNZA 4LD5A 3G73A 1YIOA 2MATA 4S00A 1I27A 3K1PA 1TW2A 4WXDA 2LF7A 2XHKA 1HSJA 2BWUA 2VONA 3KP7A 1Z91A 1OYWA 2BWXA 3TAVA 4HAMA 3VOEA 5LHIA 2DTRA 2WWYA 3TOAA 2P9AA 4EM2A 1FSEA 3HRSA 1BI2A 4RAZA 3T8TA 4Y15A 4FLJA 3CDHA 2W25A 3I71A 2STTA 3F6OA 1SD5A 1EV7A 3V7RA 4CICA 3WODF 2M5WA 1HBXG 4ZZDA 2IVMA 2HS5A 5J8CA 2DQRA 4KYWA 4R8HA 4G8XA 4U6ZA 1R23A 4OU0A 2HKXA 1J7KA 2GU5A 3L7GA 1O3QA 1BI0A 4P9FA 4LMYA 3K1MA 4OIQF 2HTSA 3ECHA 3KCCA 1KYWA 3IG4A 1R1TA 4IF4A 3VODA 1OR7A 3E6MA 2Q2EA 4FLLA 4M9ZA 1K78B 1MD0A 3BIQA 4HDVA 3WTUC 3M8FA 3GF2A 1B6AA 5F64A 4O5VA 5K5QA 3H3UA 3BDDA 4HYEA 3LQQA 1IN8A 5HS8A 2Q8KA 3IC7A 2PMHA 4GCVA 3R61A 1J59A 5BS6A 3F8NA 4A0ZA 1M35A 5HVQC 1ZLJA 3NEUA 2GG9A 1KU2A 4G94A 2XAGA 2OD5A 3WE3A 3J81K 4CHUA 1B1BA 2QQAA 4Y13A 2IA1A 4DNCA 5DCFA 4M71A 2Q92A 4S2TP 2F5CA 5D5WB 4ESBA 2DK8A 3GVAA 4XRFA 2IW5A 3R60A 4ESFA 2KKOA 2HKOA 3P7NA 4AD9A 2NQ7A 1FYKA 2LF8A 5AIPA 4ESJA 2OBPA 5LLQA 2ZXJA 3I59B 5D8KB 1LEAA 3LAJA 2VC1A 1O3RA 4LG0A 2M8EA 3BIPA 1OMIA 1W5SA 3MEXA 1MDMB 4AVPA 1JHFA 3ELKA 3WTSC 4MQVA 2IRFG 4YFNF 5H6RA 3V7CA 4KM3A 4WX9A 3M1EA 2FEZA 2BWYA 2FXAA 3CUQB 3C7JA 1F1ZA 2X4HA 2BHCA 2HQRA 4NB5A 3FXRA 3RYRA 2BWSA 1P4AA 2KJCA 4R1HA 2NNYA 2Q95A 1SAXA 1C22A 2BEOA 1C24A 3MX6A 5CNXA 3I64A 1REPC 3DPLC 2DU9A 5D5UB 2Z99A 5D6EA 3F8MA 5AIQA 5DD4A 1LQ1A 4MEXF 3D0SA 1S7AA 2ZNZA 3FZVA 1IN6A 3E5UA 4A12A 2D1HA 1F9NA 1U6GA 2FBIA 4ZYGA 5A2QZ 2MLGA 4Q47A 1GXPA 4O3MA 2G6PA 1WY2A 3REOA 4HV5A 2QQBA 1FPQA 1TNTA 2W85A 5FD6A 1I1GA 4JK1X 3JTHA 2XKPA 4LLGF 4UVBA 2MA3A 5F1RA 1AWCA 1QQIA 3CO7C 2K7LA 1O7FA 1SD4A 3R0AA 3WU1B 3EQLF 1QNTA 3W6JB 4A2UA 4EJUA 2QBYA 4U6CA 1A16A 4M72A 3WGHA 3N97A 1YG2A 5D6FA 5LGNA 2L3DA 5K5RA 1KQ8A 2D45A 4L0YB 5LBQA 4HV6A 3V8JA 1ON1A 4ENKA 5KVRA 3QP6A 4L9NA 4Y17A 2MLKA 5JR3A 3HTUA 2E7WA 2YX7A 5DCMA 5BPDA 3RI4A 2Z33A 5HDKA 4P55A 4BQAA 4D0PA 4ENJA 1FBUA 2DBBA 2BB7A 2W57A 3N4MA 3HRMA 1XSXA 2VBWA 1P6RA 5H6QA 5E8GA 3WE2A 2GU6A 3D5LA 3E97A 2O6GE 3ZP5A 2GGBA 2CG4A 2RNJA 1CHMA 2ZFWA 4XSXF 1G4DA 4A6DA 4IRHA 3CTAA 5L3CA 1R7JA 4LLLA 1IUYA 5J6XA 1V3FA 2A07F 2CYYA 2PQ8A 3FXUA 2X0LA 1G3YA 4UV9A 4E70A 2DQLA 1WWXA 1U8RA 5CDLA 4UVCA 2QYOA 2PN6A 2P7VB 2VBXA 3GXOA 3M7GA 2EB7A 2XKOA 3KFWX 4IKUA 1IAWA 5CYVA 5LRRA 4FX4A 1W4MA 2A69F 3MZHA 2P7CB 1ZN2A 4B28A 2B3HA 4CZZA 2H94A 1XGOA 4JBAA 1A04A 1FYLA 1XGSA 1ODDA 5A2QK 3HHGA 3RTRA 4IRIA 3C3WA 3TDUC 5JVTA 4U70A 2BYVE 2G7HA 3SHFA 1KGSA 3B02A 4XSZF 4MTDA 4HDUA 2XV4S 3E6DA 2P8TA 4Z2YA 4A6EA 4QWQA 3TGNA 2CFXA 1JHHA 2CGPA 3RJPA 1FNNA 1HQCA 1W5TA 1R58A 3BWGA 2PI0A 2HWVA 1IRGA 1SFUA 4I7HA 4YG2F 2RQPA 4KMFA 1LB2A 1T2KA 4P9UA 3IU7A 2NYXA 1C23A 1GHCA 2HFHA 4L9TA 1T39A 2GAUA 1TQIA 4FO8A 2E1NA 4HW0A 1WBQA 4B09A 4YIFA 4N0BA 3BPVA 2RDPA 1Z9CA 3HSFA 4L0ZB 5DD8A 2OA4A 1QZZA 4FO7A 2G9WA 3CTZA 5CJ9A 2K4BA 3L2CA 1U3EM 1SMYF 1Z1DA 3NRVA 4IXAA 1FLIA 4EV0A 2UXXA 3TOBA 5ILUA 3RKYA 2IW2A 1YTYA 4ZZLA 4NHJA 4JQFA 3FHZA 4OIRF 4NQWA 1WL9A 1S3JA 1YW9A 1ZHFA 3IKTA 2HYFA 4QLCU 4HF0A 2V9VA 1BIAA 2FNAA 3EETA 2VC0A 1UCRA 3VB2A 2QVOA 3QPTA 2BBYA 2D2WA 1OYYA 5KK1A 2YX4A 3F8FA 4PV4A 1O3SA 4FUKA 2GQQA 5CDVA 3K2ZA 4OINF 1CGPA 1R22A 4OMYA 2K02A 1D8JA 1FP1D 3FMQA 4RZZA 3I4PA 1K78A 5D5XB 3KP5A 3J81Z 1QXZA 2NQ6A 3TB5A 1PDNC 5H20A 1TQMA 3IU9A 2P5LC 4A5NA 4ON0A 3E6BA 3I0TA 2GTXA 2QLZA 2L4MA 1JE8A 1W7PD 4L5IA 1MATA 3IL2A 3B73A 3U1DA 1XMAA 3P9KA 2RV8A 3WTYC 3ZMUA 5CDEA 2EVOA 3EYYA 5L3FA 4QR8A 3V7SA 3C1DA 4GGGA 1IW7F 4MEYF 1JAWA 4FX0A 2P5VA 5DUKA 5FB2A 3QRFF 3QU6A 3FM5A 2PLYA 1MJ9A 3HSRA 5HOOA 3F72A 2P6SA 2WTEA 3V8LA 1T98A 4R79A 2HZTA 2JTVA 5FLXZ 1WN1A 3WTTC 1RNLA 2NRAC 3MFKA 2DK5A 3G3ZA 4RZYA 2F5EA 3LA2A 1ZRFA 3CUQC 3I59A 4KT5C 4UV8A 2GWRA 2V1UA 4M6XA 2EFQA 5BQTA 1MDMA 1EH8A 2V79A 4UHTA 1LEBA 1WL6A 4KUMA 3BITA 3PFIA 5AONA 1ZREA 4LB5A 1BI1A 4I0BA 3CUQA 3BPXA 3RPUA 3SZPA 1QXWA 2M30A 4GXOA 5DV5A 3RIRA 5D5VB 3WG9A 3HHHA 5D8LB 2QUFA 2O0YA 3ECOA 1USSA 2VXZA 2DPUA 2K4JA 2YR2A 4EM0B 3WTWC 1XCVA 2XASA 2A6EF 4L9JA 1BM9A 2CWEA 2O03A 2EVMA 1ULYA 4HX4A 4CXFA 5FFXA 2HOWA 4O6JA 1IN7A 1N51A 1J9IA 3CO6C 1XSVA 3QPHA 3FMSA 3FMRA 4LK1F 1U78A 4LK0F 3HIFA 2B3LA 1TBXA 5TJJA 3ZMSA 3IHUA 2V1DA 3BROA 2H27A 1B9NA 1HKQA 4EJTA 1UHMA 2BHDA 1J2XA 2CQKA 2FBKA 3L00A 2PJPA 3HRTA 1ZGJA 4U1BA 2VE8A 4L5JA 4WWCA 4ETSA 4ZYEA 4HZFA 1PUEE 2W24A 1FP2A 5LRSA 2XAFA 1B59A 3IWZA 1QGPA 2GIVA 2RKHA 1FY7A 3H3ZA 5ICGA 4K2EA 2KIFA 1Q1HA 1ZG3A 3PKCA 3FWEA 3K9TA 5FLXK 2FOKA 4A0XA 1T6SA 1UB9A 1MKMA 4EJOA 4IKTA 2DAOA 4RB3C 3COAC 3JW4A 1O3TA 3KEQA 5LHGA 2BWTA 2R7DA 3PKDA 4MTEA 3RYPA 1EH6A 3RORA 2XUBA 1OPCA 4PGGA 4RB2C 1MZBA 1OYIA 4LLNA 1TTYA 4PZJA 2C6YA 2EFOA 2STWA 1BBYA 1XN7A 3DFGA 1W2MA 3LFKA 3IU8A 1XSDA 3RVAA 5HDNA 4Q4ZF 2GG0A 3DQVC 3MCZA 1STZA 1F4KA 1WKMA 2OZUA 4HF2A 4S2RP 1O0XA 3F3XA 4HOBA 2ZSGA 1HKTA 2KRFA 1KQ9A 1V4RA 2CSOA 3L9FA 4G7ZF 1ZRCA 2Z9OA 4ZWPA 1LVAA 4EGYA 5L3BA 5JHUA 3F6VA 4G7OF 1KA8A 6PAXA 2EV5A 1PP7U 3T8RA 4HQMA 4LB6B 5BOXA 4DQ2A 1W7PB 1ZRDA 3O6BB 2RGVA 2K86A 3GFIA 3IKVA 1ZGAA 4L18B 1C0WA 1LDDA 1YW7A 2K27A 4PGHA 4P96A 2L02A 3OV8A 2HOEA 2PMUA 3JSPA 1KU9A 2RC4A 2COMA 2FF4A 3PKEA 4KN4X 4EQQA 1FWZA 3IRQA 2Y0MA 1E2XA 1AOYA 4S05A 1IN4A 1USTA 1FYMA 2JSCA 4EVIA 4KFCA 2L54A 1S7OA 2FSWA 4RGRA 1IZ1A 4U88A 2LDUA 1U2WA 3EDPA 3GFLA 2YPRA 1CF7A 2HR3A 3IRRA 3FM3A 2Q94A 1TQPA 1P2FA 3DKWA 1BOAA 1YW8A 3I54A 2G7UA 3PKAA 3M8EA 2JT1A 2ZKZA 3HUGA 5K5OA 1WLRA 2BE5F 5FFZA 3LAPA 1OKRA 1K7AA 4IHTA 1MGTA 2J5OA 2AS5F 1TNSA 1G3TA 2F5DA 2VT3A 2PG4A 3O2PE 1YJ3A 3WTZA 1TLHB 2EV0A 4HX7A 3ROUA 3I53A 3F8CA 1Z6TA 4U76A 2O8XA 4GYIA 3QP5A 1S6LA 4IVNA 1G3SA 3R6SA 3J7AO 5ICFA 2GG3A 2EVCA 2H09A 3LQRA 5IT9Z 3E5QA 2ESNA 4KMUX 3F21A 4FKCA 1YFHA 2NS0A 2FE3A 3CLOA 3HYIA 4MQ9F 4U7BA 4OIOF 5HS9A 5CVJA 2FNPA 1G6NA 4IU6A 3KZZA 4S04A 1WQ2A 2VODA 4KIFA 1P4XA 3I58A 2MBFA 3CJNA 3F23A 3KETA 1EH7A 2P6TA 2FMYA 2OQRA 3L24A 3JTGA 4AIKA 2V3YA 3K0LA 3T1BA 2Y48A 2GU4A 5DUIA 2EFWA 5E1WA 3RKXA 2BWWA 4TV7A 1Y0UA 3OOPA 5J8FA 2E1CA 1CF7B 3DXJF 2L4AA 4BHCA 4HX8A 2V3XA 3BJ6A 4OMZA 1U5TC 2PFBA 3JAMK 2RVCA 3CUOA 4I2OA 1R36A 4M73A 2GZWA 5DEQA 1IRFA 2OKNA 5CVVA 4YFXF 4BAYA 3Q5FA 2JPBA 3ML6A 3GX4X 4M9SA 1ZARA 2V6CA 4XBFA 1HW1A 3Q9VA 3BP8A 3LSTA 3E5XA 3SFZA 1HW2A 1ONVA 4KIGA 2EWNA 3HTSB 4GO1A 1XD7A 1U5TA 2AXLA 4BXUA 1FZPB 1RUNA 2GU7A 2KIMA 3MAJA 1RZ4A 2BV6A 4IHSA 4OOKA 3ABUA 5HDGA 5ICCA 5LGUA 3GZ5A 3BY6A 1O7LA 2HGCA 3FXQA 1IF1A 4CO8A 4ASNA 3KE2A 2M87A 3ZQ7A 1B4AA 2IPQX 2NAZA 4Q5SF 3ZMDA