1WKMA

The product bound form of the mn(ii)loaded methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title EPR and X-ray crystallographic characterization of the product-bound form of the MnII-loaded methionyl aminopeptidase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wkmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wkmA01
1I6XA 3P9CA 4HOBA 1QBJA 2K86A 1G3WA 1IN6A 1GXQA 5FD5A 2PMHA 2RV8A 1HKQA 4FT8A 1W7PB 1ZRFA 2ESNA 4S04A 2P6SA 4ZNGA 4L0ZB 3JW4A 4Q5SF 1FPQA 4HV6A 2UXNA 3T8RA 3F22A 2EV6A 1LEBA 3NRVA 1H9GA 2WV0A 5CVIA 1CHMA 1QXYA 3FXQA 3WGHA 2G7UA 3IC7A 2BGCA 1IZ1A 3BROA 4R79A 2YX4A 2RDPA 3V7CA 1X3UA 3QPHA 4PNCA 3B73A 4FX4A 4O3MA 1SD7A 1W2MA 3KP3A 4RS8A 1UCRA 2JPBA 2MATA 1D5VA 4MEXF 2BWSA 1WI9A 4L9TA 4U70A 4HLXA 3I0TA 1ZGJA 2BEOA 2P99A 2BH3A 2F5CA 4B28A 4ZZLA 1O3TA 3WODF 5JI6A 4L9NA 1AOYA 3TGNA 1G3TA 1MKMA 1ON2A 1W5SA 2B3LA 1JE8A 1HQCA 1UB9A 2R3SA 1BBYA 3M9AA 2DI3A 4LB6B 4WWCA 3H3UA 4WXHA 1ZG5A 3C7JA 4RB3C 4ZWOA 2W57A 3HYIA 1R5HA 3KP4A 5L3EA 1FP1D 1FP2A 5CYVA 1I1SA 4OOIA 2P98A 4HBLA 2DO7A 2JPCA 1ULYA 5K5QA 4U71A 1OYWA 2XIGA 2VE8A 1ODDA 2NQ6A 4IKSA 1Z05A 1YW7A 5H6RA 1W7VA 3HTUA 3PFIA 4MQ9F 1HW2A 4KT5C 5ICGA 5D6FA 4I0AA 4OOKA 2VBZA 3HSFA 1FY7A 1A16A 2NNYA 2GG7A 4IVNA 1MATA 4L9JA 2EFWA 1R22A 2STWA 2ZMEB 4EQQA 3GXOA 3T8TA 2X4HA 1LJ9A 3Q9VA 3CTAA 2JT1A 1SMTA 2DTRA 5DD8A 3TKYA 2BWTA 2BWXA 3CO6C 3CB6A 2LSOA 1IRFA 4M73A 1CGPA 3ISPA 4LMYA 2Q95A 4EM0B 1XN7A 1R36A 2ZSGA 2H6CA 2G6PA 3JSOA 4CDGA 1C0WA 1D8KA 3WTZA 5K5RA 3K1NA 4HYEA 3MAJA 3HSRA 5E20A 3WTSC 1AWCA 4KFCA 1O7LA 4FLLA 5HDGA 5HS8A 3FZVA 1E2XA 4KYWA 2L3DA 5K5OA 4U6WA 2LDUA 3T5XA 2FU4A 2O6GE 1EV7A 1QNTA 1LDDA 2VBXA 3KP2A 4KUMA 1WL9A 1B6AA 2HYFA 1H9TA 4YIIA 5CNXA 3W6KB 4UVAA 3KZZA 5HLHA 1T39A 2W25A 4EM2A 2BWUA 2XV4S 4K2EA 5ILSA 3HRTA 1FBSA 3ZQ7A 1HKSA 1QXWA 3KEOA 1P4WA 4FO8A 5BPIA 3VOEA 4KN4X 3Q9SA 3RYPA 1BOAA 1Z6TA 3R0JA 2GU7A 3F21A 1RNLA 2QYOA 2Z33A 4IPAA 2RQPA 4AWXB 2ZCWA 3O2PE 3F6OA 2HOEA 3GFLA 4HA8A 4HDUA 1USSA 3RJPA 2PG4A 3ELKA 3IRRA 5E5BA 3M8FA 3TAVA 2V1DA 4AIJA 1FBUA 1KU2A 3OOPA 3EYIA 5DCFA 2HS5A 2H6BA 1ONVA 5F1RA 3PQKA 2P5VA 4KIFA 4ESJA 3IWFA 4U73A 1KQ8A 2P5KA 2PBIA 2OAZA 2YSRA 1K79A 3C3WA 1J7KA 1MJBA 2MD5A 5BOXA 3WTWC 4HQEA 2VN2A 3IU9A 2GQQA 1T0FA 2VBWA 3F8MA 1FSEA 2DK8A 3ERED 4IHTA 3R4KA 5F6FA 3REOA 3PQJA 2R7FA 3HUGA 2DK5A 4ZYHA 5LHIA 4FO7A 2VBYA 2BBYA 2L4AA 4FHTA 4FLJA 2KJBA 3QOPA 4RGZ1 2IW2A 3HOSA 2XUBA 3ZMVA 1U2WA 5E1ZB 1J75A 3IWZA 5IT3A 3IL2A 1SFEA 2V3XA 1QZYA 4WXCA 2YPRA 4ESFA 2V3YA 2AXLA 3KZYA 2PI0A 2GU4A 3GYHX 1LVAA 4ESBA 5FO5A 3RYRA 1R5GA 1STZA 1WBQA 1FZPB 1C24A 1IAWA 3GLXA 2FNPA 3TQNA 2O61A 4AVPA 2PMUA 2GG5A 2PLYA 4IXAA 4A12A 1S8NA 5L3DA 3RKWA 2HZTA 1P4AA 1LB2A 1WRJA 3RPQA 3F8BA 2HEOA 1T98A 1IW7F 4KDPA 4U7DA 3BZ6A 4EV0A 1HSTA 1Z91A 5HLIA 3JSPA 1TNTA 4PZJA 1KQ0A 3MCZA 1IUYA 3WE2A 5EEHA 1BI3A 3KEQA 3H92A 2OZ6A 1R23A 3PKBA 1J9IA 5FLXK 3K0LA 4BHCA 3E6DA 5BPDA 1YJ3A 1WL6A 3MATA 3SFZA 2P8TA 4JUQA 4MATA 2LF8A 5FFXA 1YFHA 4M6XA 3MQ0A 3LAPA 4HF2A 2Y75A 4GXOA 4N9IA 2VT2A 3WGGA 5ED4A 3ABUA 3L24A 2MA3A 4UXNA 1BIBA 4RZYA 4FLIA 2E1NA 3FWEA 2GIVA 1KYWA 3BY6A 2QQBA 1OYYA 3PKAA 3HHGA 2IT0A 4A0XA 4EJOA 2GG9A 1XCVA 3LSTA 5HS7A 4M9ZA 2JTVA 4M6YA 3E5QA 3BP8A 3IHUA 2DBBA 5HDKA 2EFNA 3HIFA 2EJRA 2DQLA 2BN7A 3FM3A 4TV7A 3LA3A 4DNCA 3GWZA 4U0WA 2A3SA 1K6OA 3G73A 5D4SA 2DPUA 4A2UA 3LA7A 4OMYA 2O0YA 1G3SA 4KIBA 3K69A 3BIQA 3BJ6A 1REPC 1J0RA 3C18A 2FNAA 1IN4A 3V8LA 4MTDA 5DV5A 2A5YB 3OV8A 1TQPA 3ZMZA 5AONA 3HRMA 1LQ1A 2RVCA 3TB5A 1YW8A 2PQ8A 5LRRA 4KM3A 1MDMA 3CLOA 1C27A 4RB2C 5LLQA 2MLKA 1W5TA 2Z99A 2ZBKA 5TRDA 3IU8A 5CVRA 1U8RA 2E1CA 2IA2A 5K1YA 4NQWA 4EGYA 5F64A 3HOTA 1XSDA 4OMZA 2NNNA 4EM1A 3F8CA 4IDYA 3KLNA 1FOKA 4U75A 3SXYA 1TQMA 3H3ZA 4P96A 1HXDA 3MEXA 2OKNA 3M7GA 3F6VA 1W4MA 2WC2A 3BDDA 4WCGA 2QM3A 4YFXF 2DQRA 1YVMA 3KETA 3EETA 4A5NA 2WTEA 1O3RA 4Z7MA 1L0OC 4U6JA 2QQAA 1L3LA 3V4GA 5H6QA 3Q6DA 2BWVA 4M71A 4YIFA 1TW2A 4GCVA 3GX4X 5D5XB 1YTYA 1DPUA 2EB7A 3RDIA 4HDVA 2J5PA 1BN5A 4S2TP 4IJAA 4RGSA 2PJPA 3IU7A 4P9FA 4KMUX 2DAOA 3HSEA 2MH2A 2GG0A 5CVUA 2EFQA 4HLYA 5HS9A 1MZBA 3P9KA 2DU9A 1IN8A 3SQNA 2IRFG 3BIPA 1S3JA 4S01A 2UXXA 1SMYF 2DFIA 4OIQF 1IN5A 3C1DA 1T38A 3ZP5A 3DQVC 2Y48A 2RC4A 4FKCA 2CYYA 3FMSA 3MZHA 4ZWPA 2E7XA 4ZZDA 3IRQA 1KYZA 1ZARA 1KQ9A 4UVBA 2Q92A 2GU5A 2KIFA 5E1WA 1CF7A 2GG8A 3DPLC 2O03A 3DXJF 4UV8A 2G9WA 5EEGA 1MJAA 3WTVC 4BAYA 4JK1X 4LLGF 5LEKA 2QQ9A 3EQLF 1XMAA 4FUKA 4IKTA 1XSXA 4A5MA 1UFMA 1ON1A 2HGCA 4RB0A 4UHTA 2ISYA 2O3FA 1T2KA 1R58A 4XSZF 3GEZA 5E18F 5JR3A 5FCHA 4M72A 3J7AO 4LG0A 2VONA 1ZLKA 2H94A 1GHCA 3QAHA 1FYLA 2EA2A 2KJCA 4HX8A 3F8FA 4HW0A 2Z3YA 1DP7P 1F5TA 1G6NA 5BS6A 2WWYA 4EMSA 5L3BA 1USTA 2V1UA 2V9VA 4RAZA 5FLXZ 3R6SA 5E17F 4R8HA 5IT9K 3R60A 3VEPA 4BH9A 4M9XA 4GO1A 3GZ6A 3K2ZA 1FWZA 3MR1A 2ISZA 1ZN2A 3BJAA 2F5DA 5ILVA 1LEAA 1WQ2A 4LD5A 3DP7A 4PGHA 3QPTA 3HRUA 2P9AA 2OU2A 2ADUA 1Z7UA 2A61A 2HYGD 1IXRC 3QP6A 1WN1A 3U1DA 1YW9A 3WTUC 4U1BA 4XSXF 2JSCA 2XAHA 4U0VA 3RIRA 2ESHA 4KMFA 1DUXC 4U6ZA 4RGUA 4U88A 2STTA 3P9IA 1SFXA 5FFZA 1WLRA 4BQAA 4ENMA 1ZYRF 4HXXA 2XAGA 2PN6A 4CO8A 1FT9A 1ZAOA 5DD4A 1DPRA 3WTTC 5ICEA 5J8CA 3ZN0A 1JAWA 3SZTA 1SD5A 3RI4A 3QRFF 1LNWA 3E5XA 3L09A 1TNSA 1SD6A 2K4JA 1WWXA 5HOOA 1O7FA 1ZHFA 3CUQA 4WXDA 2A6EF 4ZH4F 2M8EA 2HOWA 1P4XA 3HRSA 1LDKB 3EUHA 1BM9A 1MDMB 2ZO4A 1B9MA 4EGZA 2NAZA 4Y15A 2P5LC 1R1UA 3CUOA 3AAFA 3ZMUA 2ETHA 2EVOA 1RUNA 3P7NA 4U76A 1U3EM 1V3FA 2XAJA 2M1BA 5ICCA 3TO7A 3WTXC 3ZMSA 2ZXJA 4IU6A 5LGUA 3L7GA 1W7PD 3T0YA 2Q94A 3L7WA 3U9GA 3CTZA 4HQMA 2NS0A 2GXGA 2BHBA 2NYXA 4KICA 1I27A 3R61A 2A6HF 1UHMA 2FA5A 4LLNA 3RPUA 2X0LA 4OIOF 4CHUA 3RVAA 2ACJA 1OKRA 4A6WA 2CO5A 4ENKA 2IW5A 5DUIA 1Z1DA 5LBQA 1XDSA 1YO5C 2H09A 1OMIA 4NHJA 3ZMDA 1PDNC 3LQQA 2ZKZA 4A6DA 3E6CC 5CLSA 2B0LA 4UV9A 5DCMA 2K4BA 1G4DA 1P2FA 4H0EA 2OQRA 3KE2A 4KNYA 4AIHA 2M87A 4PDKA 2HTSA 2H27A 1KU9A 4IF4A 3I4PA 3IKVA 3GW2A 4LB5A 2EV0A 1TQIA 3GFJA 1QPMA 6PAXA 1LDJA 1B1BA 4I7HA 4IRHA 2OA4A 2XASA 2V79A 1Z9CA 4KA4A 3QU3A 1FYKA 4EJVA 2P7VB 2HWVA 4PCQA 4OIPF 3M8EA 2DW4A 1ZRDA 4MNUA 4M9SA 1MGTA 4MHGA 2P7CB 3ULQB 2KRFA 1IRGA 1FBQA 2L54A 4G7OF 5CVVA 4Z2YA 1XNZA 1CF7B 2EVMA 3K9TA 3L2CA 4ZYGA 2GXBA 3TO9A 4ENNA 5LGNA 4CGZA 1PP8F 1HSJA 1MJ9A 4ON0A 2GG3A 2E7WA 2FSWA 3E6BA 5CDLA 5E1XA 2GG2A 3QP5A 3CJNA 2A68F 2DT5A 2M30A 3KP5A 3MFKA 1U5TA 3D0SA 4FLKA 1ZRCA 1F1ZA 2GTXA 3V7RA 2FQ3A 5CVJA 4A0YA 4I09A 4BNCA 4LG0B 4NB5A 1H0MA 2C6YA 4WX9A 5CE6A 5ILUA 5D4RA 2L01A 4EJWA 4ETSA 5IT9Z 2YR2A 4IF7A 4YFKF 1XMKA 3LWFA 2MLGA 1U78A 2FMYA 4CYDA 3WU0A 1XSVA 5AIPA 2QBYB 1JHHA 4RAYA 1HBXG 1HKTA 3ECOA 3ABTA 4G7HF 3WU1B 2FF4A 1KP0A 1ZG1A 3E5UA 1A04A 5D8KB 3MWMA 5D6EA 1HW5A 2D45A 5D8LB 3WE3A 4B8XA 4G6QA 2CW0F 1M35A 1GVJA 2V6CA 5D5UB 4ZYDA 4I01A 1PV9A 2HQNA 4LK0F 4U7BA 1EH8A 2JZYA 3KLOA 3F72A 5DDGA 5A2QK 1JGSA 1E17A 1FC3A 4O6JA 4MGRA 1D3YA 2M5WA 3CB5A 1RI7A 2FRHA 2CSOA 2D2WA 2A07F 2BHCA 3TOAA 1R7JA 1XGOA 1XGSA 3O6BB 1FLIA 5CDVA 1SFUA 1P92A 2G7HA 2BV6A 2NRAC 3FXUA 3MX6A 3CUQB 1G3YA 1QQIA 2FBKA 2V3ZA 3ZMTA 4G94A 3O3KA 1F9NA 3WGIA 4BHBA 1XD7A 3EDPA 1YS7A 2XKOA 4LGWA 2IP2A 2UZKA 4CZZA 4XLNF 2Z5UA 4R60A 2ZFWA 3K1PA 1ZREA 3TOBA 2O8XA 3WG9A 1BC8C 4I98B 2EFPA 3QU6A 2VODA 2XAQA 4Y17A 5LRSA 3TO6A 2IVMA 3SZPA 1BIAA 1KU7A 1I5ZA 4AIKA 2QLZA 3I53A 2P6TA 2M45A 5DEQA 5E8IA 4G6DA 1TTYA 1P6RA 4Y13A 2BHAA 2F2EA 5KK1A 3CUQC 1RIOH 2EA4A 2CG4A 1YQAA 4G9YA 3SHFA 3R0AA 2QWWA 1I1GA 2KKOA 3ZPLA 1BC7C 2QUFA 2XAFA 5JVTA 1R00A 2OZUA 4QWQA 4XRFA 4OU0A 5DCMB 1FSHA 4HV5A 1RUOA 5TJJA 1DDNA 4YFNF 4D0PA 3JTHA 1BI2A 2QVOA 2GAUA 2FMLA 4DQ2A 1K7AA 4HF0A 2UWMA 1IN7A 1R1VA 2AS5F 1OYIA 4RZZA 3N97A 4N0BA 2QZ8A 5HDNA 3FF5A 1WY2A 2MC3A 4L5IA 3GVAA 4U6CA 4EVIA 3J81K 1YS6A 1BJAA 2LKPA 2TDXA 4RGXA 3J80K 3RKYA 2EFOA 4QR8A 2FEZA 2GGBA 1B59A 2GZ5A 2L4MA 4IRGA 5CIKA 2XKPA 1IXCA 2NQ7A 1ZGAA 2QBYA 1TLHB 4BYYA 4L18B 1RZ4A 2XVCA 3GF2A 2ELHA 3L9FA 4AD9A 3FX3A 1B9NA 2VXZA 4XBFA 4Q48A 3I59A 4UNOA 4Q47A 4MEYF 3WTYC 4EJTA 3GFIA 2Q0OA 4GGGA 1U5TB 2HR3A 3DPTA 2B3HA 1S29A 3E6MA 1K78A 2EWNA 4UVCA 3E97A 3JAMK 4Q4ZF 3V8JA 2EV5A 2BWWA 3TDZC 2RN7A 4E70A 2IJLA 2LF7A 3PKDA 4IRIA 3I71A 3CO7C 1PUEE 3S2WA 3U2RA 5FB2A 3FM5A 1YIOA 3D27A 3RKXA 3F3XA 2K7LA 4ASNA 2Z9OA 3DV8A 5E8GA 3DFGA 2HKOA 5L3CA 4JQFA 1WKMA 1XB4A 1XDUA 3M1EA 1Z6RA 3LQRA 4GYGA 2PFBA 4F7ZA 4MQVA 5L3FA 4S2RP 3NEUA 3MZYA 1XCBA 5J6XA 2A69F 2CQKA 2DLLA 3TDUC 3F8NA 2CFXA 2R7DA 2Y0MA 2D1VA 1ZLJA 2RGVA 2YU3A 3GFMA 4P9UA 1U5TC 2VE9A 2CGPA 4U69A 3IKTA 1OR7A 2PEXA 5JHUA 1KA8A 3V7SA 2W85A 3BJOA 3HHHA 1W7PA 5A2QZ 4P55A 4LK1F 3B02A 1TBXA 2OBPA 4O5VA 5DUKA 1QZZA 4L5JA 3GO5A 5DYMA 1NHAA 1T6SA 3EYYA 2FBIA 1WSUA 4HF1A 3KP7A 3BOQA 5BQTA 3FMQA 2L02A 3GZ5A 3ML6A 2IPQX 1S7OA 5AIQA 2HFHA 1JHFA 5FGMA 4BHPA 2JRTA 4ZYEA 5ERIA 2ZJ2A 3KFWX 3VB2A 3JTGA 2OD5A 2GU6A 3COAC 3G3ZA 5J8FA 2IA0A 4I2OA 3L00A 4KN7X 3ECHA 2K02A 1MD0A 1V4RA 1BI0A 2HDCA 3KCCA 1FYMA 3ZN1A 1FX7A 1D8JA 4LJZF 2GA1A 4B09A 4HAMA 2VC0A 3KP6A 2GZWA 2J5OA 3DKWA 2W84A 2GGCA 1OPCA 1XGMA 4PGGA 2BE5F 3I54A 4IECA 4N9HA 5LGTA 2EK5A 2B3KA 1ZH5A 5ICFA 3F23A 2F5FA 2YX7A 4WF2A 3W6JB 4YG2F 3I5UA 1GXPA 2FE3A 3FMRA 1J5YA 4BXUA 1F4KA 2F5EA 3HTSB 1R1TA 4S05A 5JFRA 1O0XA 5KVRA 2VOOA 2FOKA 1ZG3A 3DEUA 3BWGA 2KIMA 5CJ9A 2Q96A 2HTJA 1YG2A 4QLCU 4R1HA 2RKHA 1O57A 1PP7U 3RORA 5FD6A 3LA2A 4EGEA 3N4MA 2COMA 3IG4A 1C22A 4PV4A 4HZFA 2Q2EA 1C23A 3BITA 3Q5FA 2DPDA 2QENA 2ZMEA 2GA2A 1QXZA 1QO0D 3I58A 1XGNA 3FHZA 1HW1A 2MH9A 2IA1A 2XROA 2VT3A 1Y0UA 4XLPF 1IXSB 1C21A 2D1HA 2RNJA 2FXAA 3LFKA 3D5LA 3ROUA 3I64A 3PKEA 4G8XA 5L3GA 4ENJA 4MTEA 5CDEA 4WK8F 2HKXA 2EVCA 1SAXA 3K1MA 3J81Z 1TW3A 1O3SA 5BMZA 1FNNA 3J80Z 2Q8KA 3FXRA 5FCFA 4U0YA 1YYVA 4RGRA 1S7AA 3PKCA 1QGPA 3T1BA 1VTNC 2VC1A 2CWEA 4IHSA 1JXSA 2ZNZA 4CXFA 2GWRA 4P5OA 3VFZA 5LHHA 5LEJA 4OINF 2V1XA 1O3QA 4I0BA 2BYVE 3LAJA 1J59A 2BWYA 5D5WB 3GUDA 5HLGA 4JBAA 2W24A 4GYIA 4IKRA 4S00A 2LNBA 3BPVA 1J2XA 1EH7A 3BPXA 1YLFA 4LLLA 1N51A 2K27A 3I59B 4HX4A 4UUVA 4G7ZF 3JAMZ 2XHKA 3VODA 5LHGA 1EH6A 2KIUA 1S6LA 4L9VA 1K78B 4LFUA 4KIGA 3E3VA 2Q93A 4FX0A 1KGSA 5H20A 1KU3A 1BI1A 4IKUA 4A0ZA 2FBHA 1B4AA 4I02A 4RB1A 3RTRA 1IF1A 2XGXA 3CDHA 2BHDA 4M74A 4HX7A 4A6EA 2HQRA 3S6BA 1U6GA 1Q1HA 2MBFA 4A6VA 3V8KA 1Y1NA 1SD4A 2OQGA 5D5VB 4EJUA 4OIRF 2P4WA 2VOPA 4L0YB 4U6EA 2XRNA 1UHWA 3DF8A 3NQOA 4CICA 5HVQC 2ZNYA 2BB7A 4ZWUA
chains in the Genus database with same CATH superfamily
2L7ZA 3H9GA 3G4SI 1ZR2A 2VJJA 1I6XA 3P9CA 3G2BA 3HEFA 4HOBA 3OIPA 1QBJA 2K86A 1G3WA 4DZPA 1RR8C 1IN6A 1GXQA 5FD5A 2PMHA 2RV8A 3VYTB 3TP3A 2AXTC 1HKQA 4FT8A 3O8GA 1W7PB 1ZRFA 1BR1A 2ESNA 2P81A 4S04A 4JOMA 2P6SA 4ZNGA 1K4SA 3JW4A 4L0ZB 2WA0A 2EIJH 4II3A 4Q5SF 1YOVB 1FPQA 4HV6A 2UXNA 3T8RA 3F22A 2VLAA 2EV6A 3CCEI 1LEBA 3NRVA 1H9GA 3S3NA 2W00A 3E1SA 2WV0A 5CVIA 1CHMA 1QXYA 3FXQA 5FKNA 3WGHA 1VQKI 3PO3J 2G7UA 4J00A 2GXAA 3HOXJ 3GTGJ 3IC7A 3PUFA 1GVDA 1H89C 4LOCA 2BGCA 1IZ1A 3BROA 3DTKA 4R79A 2YX4A 5E3OA 4E7HA 2RDPA 3V7CA 2DA1A 1X3UA 2VKDA 3CF5F 3QPHA 5F08A 2R4GA 2CQNA 1VFCA 4D1QA 3D5RC 4PNCA 3B73A 3JRFA 1X58A 4FX4A 2ZJRF 4BE2A 1WJBA 4O3MA 1SD7A 1W2MA 2DA2A 2DJIA 3KP3A 4RS8A 2ID3A 1UCRA 2JPBA 1S7EA 2MATA 5C3EJ 1D5VA 2WY7Q 2HVQA 1JT6A 4PFPA 4MEXF 2BWSA 2VKHA 1OR7C 1WI9A 4FCYA 4L9TA 4U70A 1SAUA 2KT0A 3IH3A 4IHVA 4V2FA 3MD2A 4HLXA 2DFEA 2LY2A 3I0TA 1JTYA 1ZGJA 2BEOA 3F9KA 2BH3A 2F5CA 3ABLH 2P99A 4B28A 4B3XA 4ZZLA 1O3TA 2BY2A 3WODF 5JI6A 5F04A 4L9NA 1AOYA 3TGNA 1G3TA 4Y3OA 5M3FJ 2MFZA 1MKMA 4BEHA 2K9QA 2KHMA 1ON2A 1UELB 1Z21A 1BOBA 2EZHA 4CYCA 5M5WJ 1W5SA 3UR3C 2B3LA 1JE8A 4UUSB 2IAIA 1HQCA 1UB9A 3KZIC 2R3SA 1BBYA 3M9AA 4RAFA 2DI3A 4LB6B 4WWCA 3H3UA 3ASNH 4XKWA 2CUFA 2CW7A 4WXHA 1K4TA 2FD5A 1ZG5A 2W1OA 3HB9A 4C9YA 3C7JA 4RB3C 5J4VA 3CMMA 1FTZA 4ZWOA 2W57A 3HYIA 1R5HA 3KP4A 5L3EA 1FP1D 1T95A 2X51A 3IAM2 5IYDJ 1FP2A 5CYVA 1X1PA 1I1SA 1MBGA 2GIZA 4OOIA 2P98A 4HBLA 2DO7A 2JPCA 1YITI 1ULYA 2NOGA 5K5QA 4U71A 1OYWA 2XIGA 2VE8A 2HQ5A 1IV6A 1BL0A 1ODDA 1TC3C 2NQ6A 4IKSA 4CH7A 2R92J 5FKLA 2IEKA 1Z05A 1YW7A 3QOEA 5H6RA 1W7VA 3HTUA 3PFIA 3OYLA 2ZC2A 4MQ9F 4XK4A 4KT5C 5ICGA 1HW2A 5D6FA 4I0AA 5CQEA 2Q2EB 4OOKA 3CC7I 3M1CA 2VBZA 3HSFA 1FY7A 1ETQA 1A16A 2NNYA 4DBQA 2GG7A 4IVNA 2JJ7A 1MATA 2BOLA 2DDBA 2XF6A 4L9JA 5HNFA 1QHGA 5J1YA 2EFWA 1R22A 2STWA 2ZMEB 4EQQA 3GXOA 5FKOA 3T8TA 2X6WA 3K10A 5KHDA 1X4PA 2X4HA 1LJ9A 3Q9VA 1LFUP 1Y8QB 2AQEA 1DQUA 3CTAA 2JT1A 1SMTA 2DTRA 5CKTA 5DD8A 3TKYA 2BWTA 2I5UA 2BWXA 3CO6C 3CB6A 2LSOA 1IRFA 4XNFA 1D0ZA 4M73A 1MH4A 2UUZA 3BR0A 2FJ1A 2R0QC 3L2QA 2R5YA 5GADJ 3ISPA 1CGPA 1WZ2A 3GTPJ 2CFOA 4LMYA 2Q95A 4EM0B 1XN7A 1R36A 3PL8A 4XKCA 2ZSGA 3J7AY 2H6CA 2G6PA 2MABA 3JSOA 4CDGA 3MZ8A 2VQGA 4FQGA 3M07A 2M4GA 3N05A 1C0WA 1D8KA 3WTZA 2Y30A 2QKMB 2R7OA 2LH9A 1SFKA 1Y39A 5K5RA 3K1NA 1Y0NA 2ZSHB 4HYEA 2JK3A 1A31A 3H9JA 4RBOA 5J47A 3MAJA 3TL4X 3A4CA 1RKTA 3HSRA 5E20A 3WTSC 1AWCA 4KFCA 1O7LA 3W3CA 3OR1C 3BT9A 1X1CA 5B5EC 2KRHA 3OYEA 2GOXB 2L2OA 4FLLA 5HDGA 5HS8A 3FZVA 2ZMEC 1E2XA 2CQQA 5H2FC 4KYWA 2R7XA 1DGRM 2L3DA 5K5OA 4U6WA 4JP0A 2LDUA 4PJMA 3T5XA 1X2MA 4C3JJ 2FU4A 2O6GE 1EV7A 2E1OA 1APLC 2DODA 1Y1VJ 1U0JA 3CCQI 2KZGA 1QNTA 1LDDA 2VBXA 2M7BA 3KP2A 2Z16A 4KUMA 1WL9A 1TT5B 3DBHB 1B6AA 1OLTA 4W1UA 2LKSA 2HYFA 1H9TA 4YIIA 5DM6F 5CNXA 4CCOA 3W6KB 1XX5A 3KZZA 4UVAA 5HLHA 1QVTA 2GBYA 4BQNA 2W25A 1T39A 4JX6A 4B3AA 4EM2A 1MMSA 2BWUA 1W5CC 1MIJA 2XV4S 4DIQA 3E0JB 4K2EA 3NWSA 5ILSA 3HRTA 1FBSA 3ZQ7A 1HKSA 1VQLI 4BQQA 1QXWA 3KEOA 1P4WA 5K7HA 4FO8A 3V42A 5BPIA 4BL0B 3VOEA 4KN4X 3PIOF 3Q9SA 3RYPA 1BOAA 1Z6TA 3R0JA 4E6KG 2W4SA 2GU7A 3F21A 1RNLA 2QYOA 4RA2A 3IH2A 2Z33A 3LSPA 4IPAA 2RQPA 4PSWA 4AWXB 3DKXA 2O7OA 2ZCWA 3O2PE 3F6OA 2HOEA 3GFLA 2PJRA 1ZQ3P 4HA8A 3BR2A 2KL4A 1GLNA 2QA4I 2LOOA 3WHBA 4HDUA 1USSA 3RJPA 1VNDA 2Q1ZB 2PG4A 3ELKA 4MFDA 3BTIA 4XIDA 3IRRA 5E5BA 5KAIC 1EA3A 2A6TA 5FRMA 3M8FA 3TAVA 2K40A 3CZ6A 2VJ5A 4XR6A 2V1DA 1X1AA 4AIJA 3W6VA 1FBUA 1KU2A 3OOPA 3EYIA 5DCFA 2HS5A 3X2QH 2H6BA 1ONVA 5GPCA 2LVSA 2GLOA 1VQ8I 5F1RA 3PQKA 2P5VA 3DEEA 3K6GA 4KIFA 2GM4A 3OYAA 4ESJA 4CCJA 3IWFA 2L9VA 4U73A 1KQ8A 2P5KA 1HC8A 4OWRB 2PBIA 2OAZA 2YSRA 1K79A 3CC2I 2L7MP 3C3WA 1VQ6I 2VQCA 1J7KA 4E7KA 1MJBA 2MD5A 5BOXA 3WTWC 4HQEA 2VN2A 3IU9A 2GQQA 3PUBA 1T0FA 2VBWA 3F8MA 2QSHX 1FSEA 2NVTJ 2DK8A 4DW6A 3ERED 4NC6A 3EUKL 4BXFA 4IHTA 3R4KA 4XOTA 5F6FA 3FKIJ 3REOA 3PQJA 2R7FA 3HUGA 1RC9A 5HODA 2LBFA 2DK5A 4ZYHA 5LHIA 3GTJJ 4FO7A 3IUOA 3DTEA 2VBYA 2BBYA 2L4AA 4FHTA 3AKZA 2EBIA 4FLJA 5B66C 1OJLA 3H0DA 2KJBA 3QOPA 1OQYA 4RGZ1 2DJNA 2IW2A 5E3LA 3HOSA 2XUBA 2O8KA 1ZKGA 4IKFA 4G12A 3ZMVA 1MBJA 1U2WA 5E1ZB 5E3MA 3J7ZI 1J75A 2WAQA 1K83J 3IWZA 5IT3A 3IL2A 1ITYA 3OSGA 1SFEA 2IBDA 2V3XA 1QZYA 3DEWA 4WXCA 3S3OA 2YPRA 4ESFA 2V3YA 2AXLA 3KZYA 4Y7NJ 2PI0A 2GU4A 4XKBA 3KEYA 3GYHX 1LVAA 4I76A 4ESBA 5FO5A 4B43A 3C2BA 1N25A 1EF4A 4MO7A 3RYRA 1R5GA 1STZA 5LFAA 4J19A 3IV5A 1QHHD 1WBQA 1FZPB 1C24A 4HEA2 4M3BA 3JRAA 1IAWA 3GLXA 1VQ9I 3RCOA 4NDLA 5EZHA 2FNPA 1V5GA 3TQNA 3QQAA 2O61A 4AVPA 4DGWB 4PSXA 3OYHA 2PMUA 2GG5A 2PLYA 3BG7A 4IXAA 4A12A 1S8NA 4N4OB 3MMYB 4RM3A 4DYQA 5L3DA 1IV8A 3RKWA 2DMUA 3RZOJ 2HZTA 3BZCA 2F5VA 2MC4A 3A0HC 2YS9A 1P4AA 4NC7A 4XLFA 3AFHA 3JRGA 5K7FA 3Q3SA 3ZQLA 1LB2A 2K9LA 3OY9A 1WRJA 3RPQA 5GAGJ 3F8BA 2HEOA 3OIQA 1T98A 1IW7F 4BEHB 4KDPA 2ICWG 4U7DA 3BZ6A 4EV0A 1HSTA 1Z91A 1J09A 5HLIA 2IS6A 3JSPA 4RM2A 1TNTA 5J1RA 1D1CA 3CESA 4PZJA 2V26A 1KQ0A 5EGOA 2EZLA 2XF5A 3MCZA 1IUYA 3WE2A 5EEHA 1BI3A 3KEQA 2KZVA 3H92A 4MLOA 2OZ6A 1R23A 3PKBA 4IHWA 2DT7B 1J9IA 5FLXK 3K0LA 4BHCA 3S1QJ 3E6DA 5BPDA 1YJ3A 3OYFA 4XICA 1E3HA 1WL6A 3MATA 3SFZA 2DA6A 3HOZJ 1POGA 2P8TA 4JUQA 1XG1A 4MATA 2LF8A 5FFXA 1YFHA 4XLEA 4M6XA 3MQ0A 3LAPA 4HF2A 1V55H 2Y75A 4GXOA 4N9IA 2VT2A 3WGGA 5ED4A 1WJDA 1R4NB 3ABUA 3S16J 3L24A 2MA3A 4UXNA 4E7ZA 1BIBA 2HZDA 3LSGA 3WHCA 4RZYA 4RDUA 4FLIA 2E1NA 3FWEA 2GIVA 1KYWA 1ETKA 3BY6A 5GAEJ 1IC8A 2HVRA 1U9NA 2QQBA 1OYYA 3C2GA 3PKAA 4A3FJ 3HHGA 2HI3A 3FK7A 2IT0A 4G6TB 2KMUA 4A0XA 4EJOA 4I99C 4IL6C 1MSFC 2GG9A 4AVZA 1XCVA 2IGMA 3LSTA 1ETVA 2M9HA 2W48A 1HF0A 5HS7A 4M9ZA 2JTVA 4M6YA 1RRJA 4DOZA 3E5QA 4F93B 3BP8A 1SVLA 2WB1N 5GAHJ 3IHUA 4RLQA 2LKXA 2DBBA 5HDKA 2EFNA 3HIFA 3EPZA 3HXLA 2EJRA 5C44J 2DQLA 1MBHA 3TMOA 2BN7A 3FM3A 1VQNI 4BJ5C 4TV7A 1IDYA 3LA3A 4DNCA 3GWZA 2R5YB 4U0WA 2A3SA 1K6OA 3G73A 5D4SA 2DPUA 4A2UA 4HRIA 1MW7A 3LA7A 4OMYA 1GT0C 3HOYJ 2O0YA 3OS0A 1G3SA 4KIBA 3K69A 3BIQA 3BJ6A 5IP7J 1REPC 2AO9A 1J0RA 3PSFA 3C18A 2FNAA 4CZCA 1IN4A 3V8LA 4MTDA 5DV5A 3L1PA 5DS9A 2A5YB 4AU7A 2ZB9A 3OV8A 1TQPA 4FISA 2LMDA 1M1EB 3ZMZA 1H88C 5AONA 3HRMA 1LQ1A 2RVCA 1B8IB 3TB5A 1YW8A 2PQ8A 5LRRA 5B3SH 4KM3A 1MDMA 2JRMA 2LC2A 1RKWA 3BQZA 3CLOA 1C27A 3OYDA 1JJ6C 3H5NA 2LLKA 2NVYJ 2Z2SB 3LMMA 4RB2C 5LLQA 2MLKA 1W5TA 5KNLA 2Z99A 2ZBKA 5TRDA 2V9KA 3IU8A 3HOVJ 2E2JJ 5CVRA 1U8RA 1A6QA 1FMVA 2E1CA 1D1BA 2XSJC 2IA2A 1B72B 5K1YA 4OAYA 4BY1J 1S72I 4NQWA 1W36D 2CV0A 5FKMA 4EGYA 4MFEA 5F64A 3HOTA 1PYVA 5DTDA 3OYKA 1K6YA 1XSDA 4ZYAA 4OMZA 4ABZA 5IYBJ 2NNNA 2X6YA 3MKZA 2QGUA 3F8CA 4EM1A 2K5CA 1MNEA 1JKRC 1ETXA 4IDYA 3KLNA 2JA5J 1JUMA 2DCEA 2N8GA 1FOKA 4U75A 3SXYA 1TQMA 1R4MB 5JVGF 2EH3A 3H3ZA 1LFPA 4P96A 1HXDA 2E36A 2ZSIB 2MG4A 3MEXA 3DLLF 2OKNA 3M7GA 3ZOBA 3F6VA 1W4MA 2WAQN 2WC2A 3BC8A 3BDDA 2JVGA 4WCGA 2QM3A 2LK2A 3CD6I 4PFOA 2DQRA 4YFXF 1IO2A 1YVMA 3KETA 3B6AA 1Z7LA 3BLYA 3EETA 4A5NA 2WTEA 1AKHA 1O3RA 4Z7MA 1L0OC 4U6JA 2QQAA 3JRDA 1L3LA 3V4GA 2H8WA 2JA7J 3H36A 3W2WA 3DBRB 4A3LJ 3S1NJ 1LE8A 5H6QA 4AM3A 2BWVA 4M71A 3Q6DA 1VQOI 4YIFA 1TW2A 4GCVA 3GX4X 5D5XB 2DMPA 3K70D 2PJRB 3PM1A 2XGEA 1YTYA 2ZJPF 1DPUA 3GZNB 2I10A 5B1BH 1VF9A 2EB7A 3RDIA 4HDVA 2J5PA 2F4MB 1FOYA 1BN5A 4S2TP 4IJAA 4RGSA 2PJPA 3IU7A 1U8BA 3H0GJ 3CJRB 4P9FA 3OOUA 1QZEA 2CUZA 4ZC3A 4KMUX 2DAOA 3FBNB 3HSEA 5GTIC 4C30A 2MH2A 3L2WA 2GG0A 1WFXA 5CVUA 2JVHA 1LUJB 2EFQA 4HLYA 5HS9A 2CU7A 1MZBA 2E5ZA 1ZK8A 3CCVI 2NXNB 3P9KA 2DU9A 1IN8A 3DBLB 3SQNA 3A01A 3SJMA 2IRFG 3BIPA 1LPQA 5FJ8J 4CUGA 1S3JA 1P7JA 4S01A 2UXXA 1SMYF 2DFIA 2R7WA 2MD0A 4OIQF 1IN5A 2W82A 1A36A 2M34A 1V5FA 3BR1A 3C1DA 4XKVA 4HSRA 2LD5A 1T38A 1Y8RB 3JRCA 4V2GA 3BG6A 2M7AA 1R49A 4NUBA 3ZP5A 4MIMA 3DQVC 2Y48A 2RC4A 4FKCA 2CYYA 2FOWA 3FMSA 3MZHA 4ZWPA 2E7XA 4ZZDA 3HUGB 3IRQA 1YJWI 2LP0A 3GTKJ 1KYZA 2LBFB 1ZARA 1KQ9A 4UVBA 1E3PA 1AA7A 2O9LA 3A0BC 2Q92A 4PJNA 2GU5A 2KIFA 1FIAA 4XN3A 1SVMA 5E1WA 1JGGA 3BCAA 2X9DA 3HJEA 3PIPF 1CF7A 1G59A 4C3HJ 5EYRA 3CDLA 2GG8A 3DPLC 1WPKA 2O03A 1D0YA 2K9SA 3DXJF 2NVXJ 2VPLA 2RAEA 1TWFJ 4UV8A 1ACIA 3CCUI 1LKXA 2G9WA 5EEGA 1TWGJ 3KYCB 1W0TA 1MJAA 2IXSA 3WTVC 3GTMJ 3DLAA 4BAYA 4JK1X 3S17J 3LOCA 4LLGF 5LEKA 2QQ9A 2HU9A 3ASOH 3EQLF 1XMAA 4FUKA 4IKTA 3DU5A 1XSXA 3SZGA 4A5MA 1UFMA 1ON1A 4A3BJ 4UB6C 2HGCA 4RB0A 3LNQA 4BDYA 4UHTA 2ISYA 2O3FA 2BVMA 1F36A 1T2KA 1R58A 3C2HA 1T56A 4XSZF 1PUFA 3GEZA 1T0FC 4C2UA 4P1WA 5E18F 5JR3A 5FCHA 4M72A 4PJJA 3J7AO 3M8JA 4LG0A 2CQ7A 3NARA 4EATA 2VONA 1ZLKA 3CLQA 2H94A 1GHCA 3I9V2 3QAHA 1FYLA 1KZHA 1A35A 2EA2A 2KJCA 4HX8A 2HQAA 3K4LA 4IQ4A 2I8DA 4E4HA 1N78A 3F8FA 2MSYA 4HW0A 1MMDA 4D9JA 2Z3YA 3H5AA 1DP7P 1F5TA 1G6NA 5BS6A 1UAAA 2WWYA 4EMSA 5L3BA 5HNHA 2MW8A 1USTA 2V1UA 4S00A 2V9VA 4RAZA 4OAZA 3R6SA 2Y31A 5FLXZ 5E17F 2LY9A 4R8HA 5M5XJ 1SVOA 1A5JA 2CQXA 5EGOB 3H1CA 4PK4A 3OMYA 3TW7A 5IT9K 1XC5A 1ZELA 3R60A 3VEPA 4BH9A 4M9XA 4GO1A 3GZ6A 3K2ZA 1FWZA 4F52A 2XDVA 3MR1A 4F55A 1ZN2A 2ISZA 3BJAA 2F5DA 3OYCA 5ILVA 1LEAA 1WQ2A 4LD5A 5IY5H 3DP7A 4PGHA 3QPTA 2Y9ZA 3HRUA 2P9AA 4QSHA 2KPMA 2ECBA 3ZGKA 4M6VA 2OU2A 5FLMJ 2V1NA 2ADUA 1Z7UA 2WAEA 2A61A 2L5QA 3K2AA 2HYGD 4PJ0C 5JLXA 2WV1A 1IXRC 3QP6A 4ZDOA 2R7VA 1WN1A 2LY1A 4HNVA 3U1DA 1YW9A 2ZFUA 3WTUC 4J01A 1B8IA 3KIOA 4LIUA 3JCUC 4U1BA 1JKOC 4XSXF 5EEAA 1KONA 2JSCA 2XAHA 3I55I 3S1MJ 5E79C 4U0VA 3RIRA 2ESHA 4KMFA 1DUXC 4U6ZA 4RGUA 4U88A 5FLVA 2STTA 3P9IA 1ETWA 2HVSA 1SFXA 5FFZA 1WLRA 3CDIA 4NNJA 4ENMA 4BQAA 2EZIA 2VPRA 3A02A 4V19K 1B72A 3GLLA 3K4CA 1ZYRF 2EQRA 3W2VA 3M4OJ 4HXXA 2AQFA 2XAGA 3FHNA 4Y52J 4A3MJ 2PN6A 4CO8A 1FT9A 1ZAOA 4S0HB 5DD4A 1WJ5A 1DPRA 2ELJA 1ZGWA 2KQRA 3WTTC 3BZKA 2YUSA 5ICEA 2XB5A 2X1CA 5J8CA 2M4KA 2R7TA 3K4MA 4M3FA 3ZN0A 2CV1A 1JAWA 1YHQI 3SZTA 3S2DJ 1SD5A 3K7AJ 3RI4A 3I3LA 4F91B 2L9NA 3QRFF 2DXIA 1LNWA 3E5XA 1LVKA 3JREA 1ZTRA 3L09A 2QEXI 4M3DA 1WI3A 2WADA 1XTAA 1TNSA 3VYSB 1SD6A 2K4JA 2DA4A 2ECCA 2WB1A 2L9RA 4D5FA 1WWXA 4IX7A 3ONQA 2LRDA 4BXXJ 2K85A 2PX9A 2F4IA 5EF6A 5HOOA 1O7FA 5DM7F 1ZHFA 3CUQA 2AHQA 3G1LA 4WXDA 3CJTB 2A6EF 3BG9A 4ZH4F 2M8EA 3VWBA 3HDDA 4BBSJ 1FOWA 1WJEA 2E2IJ 4E7JA 3DCFA 4I6ZA 2HOWA 1P4XA 1QA6A 3HRSA 3HM5A 1LDKB 1WJFA 4KT6A 3EUHA 1BM9A 5EJCA 2IS2A 4CCNA 1VQPI 1MDMB 1H8AC 2ZO4A 1OCRH 1B9MA 3D5SC 4EGZA 3BR5A 2NAZA 4Y15A 2P5LC 1R1UA 1I3AA 3CUOA 2DDAA 3AAFA 3ZMUA 2ETHA 2JSPA 3PSIA 4E7SA 1RUNA 2EVOA 4XLHA 3P7NA 4U76A 1YJ9I 2IGKA 1U3EM 1V3FA 3FDYA 3GMEA 4NQWB 5IP9J 2HDDA 1MNMC 2XAJA 2M1BA 2OPTA 2X6XA 3TO7A 5ICCA 3WTXC 3ZMSA 2ZXJA 4IU6A 5LGUA 3L7GA 4QPOA 1UMQA 1W7PD 1X4OA 4HPQA 5J40A 3T0YA 3BTJA 3L7WA 3U9GA 3K4KA 2Q94A 3CTZA 4HQMA 3GTLJ 3PFYA 2NS0A 3NAUA 3RQ4A 3MKWB 2GXGA 2BHBA 3CP2A 2NYXA 2FUG2 4KICA 1I27A 2BW3A 1IDZA 3R61A 2A6HF 1UHMA 1JKQC 2FA5A 4LLNA 3PO2J 3RPUA 2X0LA 4OIOF 1G2HA 4CHUA 4N4NB 3RVAA 1BA5A 4JYKA 2F48A 2ACJA 3I56I 1OKRA 4A6WA 2CO5A 3KYDB 1AKHB 4ENKA 1DP3A 1D1AA 3F0CA 2IW5A 5GP9A 4XLCA 1WJCA 5DUIA 1Z1DA 5LBQA 4HSTA 2IGOA 1XDSA 1LE8B 1YO5C 2BY1A 2H09A 1OMIA 3OWTA 5F0CA 4NHJA 3ZMDA 1PDNC 4BBRJ 2CMPA 3LQQA 2E34A 2JMWA 2ZKZA 4A6DA 4UB8C 5CLSA 3E6CC 2B0LA 4B44A 4GDFA 1D0XA 2FQ4A 1N75A 4DZJA 4AC0A 4UV9A 2ZXHA 5DCMA 1NH3A 2K4BA 4W97A 1G4DA 2F4OB 1P2FA 3U21A 2BXZA 2LYCA 4U87A 3FKJA 4H0EA 2OQRA 3KE2A 2HXIA 4KNYA 2H1LA 4AIHA 2M87A 3A03A 2NS8A 3ZXSA 4PDKA 2EIKH 4B47A 4B4CA 2HTSA 2H27A 1RR7A 1KU9A 2LFBA 5CQGA 1BW6A 4IF4A 5KCMA 3I4PA 3IKVA 2DA5A 3GW2A 4LB5A 2EV0A 1TQIA 3GFJA 3LSJA 2M2EA 4CA0A 1QPMA 6PAXA 4AUXA 3A01B 2L9SA 4DYRA 1LDJA 1B1BA 1UZCA 1DGWY 4I7HA 4IRHA 3HKZN 3KX2A 3SEZA 2OA4A 2XASA 5FKKA 2V79A 4XMYA 1Z9CA 4KA4A 4IOAF 3QU3A 1FYKA 3PNYA 2WBMA 5J1UA 4GFBA 1P7IA 1TP4A 4EJVA 2P7VB 2HWVA 4ZTFA 4PCQA 2H8RA 4OIPF 3M8EA 1MSEC 2DW4A 1ZRDA 4MNUA 4BKXA 4M9SA 3TP0A 3MN2A 1MGTA 4MHGA 2P7CB 2NVQJ 3ULQB 4XORA 3JR9A 4B1RA 2KRFA 1IRGA 2VXDA 3J7YJ 1FBQA 1WH7A 2L54A 4G7OF 5CVVA 1GUUA 2OCCH 4Z2YA 1Z67A 1XNZA 1OCOH 1CF7B 2EVMA 3K9TA 2V6EA 2D5VA 3L2CA 4ZYGA 3A2KA 2GOMA 2GXBA 4QIWN 3TO9A 4ENNA 4X1EA 1IG7A 5LGNA 3BCBA 2BY3A 3QWLA 1WCMJ 4D5CA 4CCMA 1PP8F 1HSJA 4CGZA 4A3DJ 1MJ9A 2OF7A 4ON0A 4A3IJ 2GG3A 1FTTA 1A6IA 2E7WA 2FSWA 2VI6A 4Y33A 3ZRGA 3E6BA 5CDLA 3QYFA 5E1XA 2R5ZA 3CJQB 2GG2A 2EIMH 3QP5A 2X85A 3QYEA 4C2MJ 3OYNA 1OCZH 3CJNA 4BQOA 3TEDA 2A68F 2KDOA 2DT5A 2X1EA 2M30A 3KP5A 3MFKA 1U5TA 3D0SA 4FLKA 4DYCA 1ZRCA 3QODA 3S2HJ 1F1ZA 2GTXA 1PJRA 3V7RA 1VQ5I 4CCKA 2FQ3A 1OCTC 5CVJA 1PUFB 1O4XA 4A0YA 4I09A 4BNCA 4F92B 2XRLA 3IP4B 4LG0B 4YIRX 3OR2C 3BG5A 4NB5A 1HLVA 3FBIB 3RSNA 2XPWA 1H0MA 2O5RA 4C3IJ 3HOUJ 1JT0A 2C6YA 3MKLA 4WX9A 1W0UA 5CE6A 5ILUA 2LR8A 3PJRA 1ZR4A 5D4RA 2L01A 3TW6A 4EJWA 4ETSA 2R7UA 2KP6A 3FK6A 1YJNI 1QRYA 5IT9Z 2YR2A 4IF7A 1NK3P 3Q0UA 2R7QA 5F27A 4YFKF 1LFBA 1XMKA 3LWFA 2MLGA 1U78A 2FMYA 4YRVA 2P0WA 1DU6A 4CYDA 3WU0A 1XSVA 3MVPA 1SEUA 4ITVA 5AIPA 2Y69H 2QBYB 1JHHA 3FISA 3KYLA 4RAYA 1HBXG 1HKTA 3ECOA 3ABTA 1ETYA 4G7HF 2VJIA 4H4KC 5IPAA 4B48A 3VPRA 5F1JA 3WU1B 2FF4A 1KP0A 3HZJA 3ERMA 1BJZA 2MYSA 5KAFC 2XAUA 4NC8A 5IOYA 1ZG1A 2K3FA 3E5UA 1A04A 5D8KB 1T33A 2HOAA 3MWMA 4M3EA 5D6EA 2R7RA 4BU2A 3CCJI 3HL2A 2E19A 1MMNA 3QYBA 1HW5A 2EPFA 2D45A 5D8LB 3WE3A 3K4BA 3ZQFA 4B8XA 4G6QA 2CW0F 1M35A 1GVJA 2V6CA 1VQ7I 2JUCA 4AIDA 5D5UB 4ZYDA 4I01A 1PV9A 2VQLA 2HQNA 2DOEA 2QSFX 4LK0F 4U7BA 3LSMA 2JQ7A 1EH8A 2JZYA 2JUGA 4X6AJ 3KLOA 3Q0WA 3F72A 5DDGA 4LIVA 4QPQA 1OFCX 5A2QK 1SFOJ 1JGSA 1OISA 3G71I 4HNUA 1E17A 1FC3A 4O6JA 3OS1A 4MGRA 1D3YA 2M5WA 2KIQA 1E0EA 1X3WB 3CB5A 4KJZA 1X3ZB 1RI7A 2FRHA 3WG7H 2CSOA 2D2WA 3CMEI 4XQFA 2A07F 2BHCA 1YI2I 4XL9A 4BJTA 3TOAA 2VKEA 1R7JA 1XGOA 4F3QA 1XGSA 3G6EI 3O6BB 3GCMA 1FLIA 1R71A 5CDVA 1SFUA 1I50J 5IP6A 1G8XA 1P92A 2G7HA 2BV6A 5TISC 3SEQA 2NRAC 5C4XJ 3FXUA 1MH3A 2L7FP 3MX6A 3WU2C 3CUQB 1G3YA 2DYSH 4FE4A 2QF7A 1QQIA 2FBKA 1CQTA 1IRZA 1WH5A 2V3ZA 3ZMTA 4G94A 2M8GX 1FOXA 4ZDPA 3O3KA 1F9NA 3WGIA 1YX5A 5GTHC 2ZJQF 5IYCJ 4BHBA 1XD7A 3EDPA 1YS7A 2VL8A 2XKOA 4LGWA 2IP2A 4XRMA 2UZKA 3P5JA 2XB0X 3ZR8X 4CZZA 4AYBN 5EG0A 5J4YA 2V4JC 4XLNF 4IHXA 2Z5UA 4R60A 2WAFA 2ZFWA 3K1PA 1ZREA 3TOBA 2O8XA 3WG9A 1BC8C 4I98B 2A5WA 2V9PA 2B9SA 2EFPA 4M3GA 3QU6A 3VSKA 2VODA 1Z3YA 2PMZA 2XAQA 3BG3A 4Y17A 5LRSA 3TO6A 2CRGA 2IVMA 3SZPA 1BIAA 1KU7A 1I5ZA 2ID6A 2Z1DA 4AIKA 2QLZA 2EILH 3G1OA 3DKYA 3OIOA 2BW3B 3I53A 5EDNA 2P6TA 3O8HA 2M45A 5DEQA 5E8IA 4G6DA 4YEJA 1TTYA 2DYRH 1P6RA 4Y13A 2BHAA 2F2EA 2XGCA 2EZKA 5KK1A 3CUQC 1RIOH 3OS2A 2EA4A 2DMTA 2IGNA 2CG4A 1YQAA 3RQIA 1NK2P 3BQYA 4G9YA 3SHFA 2E2HJ 3R0AA 2BVLA 2K9NA 3CP8A 3SDBA 1JKPC 3EUHC 3RKQA 1TZLA 2QWWA 1I1GA 2KKOA 4BJ6C 3ZPLA 1BC7C 1Z77A 1GV5A 2CV2A 2QUFA 2XAFA 5JVTA 3AL0B 1R00A 2OZUA 4QWQA 1TT0A 4XRFA 5F0HA 4OU0A 3LSRA 5DCMB 1FSHA 1UG2A 5LD2C 4HV5A 1RUOA 4Y4RA 3L2UA 3OYGA 5TJJA 2DMQA 1DDNA 4A93J 4YFNF 1NG6A 4ZDLA 4D0PA 3JTHA 1BI2A 2QVOA 1Y6IA 4C2TA 1GV2A 2GAUA 2FMLA 5EZGA 4DQ2A 3G1MA 3LFUA 4IZZA 1K7AA 4HF0A 2UWMA 1IN7A 1R1VA 2AS5F 1OYIA 1ETOA 4DBRA 2XC7A 4RZZA 3N97A 2VQHA 2CW8A 3HPHA 4N0BA 2QZ8A 5HDNA 2K9MA 3FF5A 1W1WE 1WY2A 1Y1WJ 3S15J 2MC3A 4L5IA 2E5NA 3HPGA 3GVAA 3DU6A 2VJ4A 2KDZA 4BE1A 1TWHJ 4U6CA 4EVIA 1PVEA 3MKYB 3J81K 3ABMH 1YS6A 1BJAA 2LKPA 2TDXA 4RGXA 3J80K 3RKYA 2E60A 3FXKA 4IHYA 2ELKA 2EFOA 1WVRA 4QR8A 1XS9A 1YE9A 2FEZA 1D5YA 2GGBA 1B59A 2B63J 3UKGA 1EJ9A 2EINH 3AL0C 2GZ5A 2L4MA 3SDGA 1N77A 2OCEA 3HKZA 4IRGA 5CIKA 2XKPA 3Q0VA 4II2A 3LL7A 1IXCA 1IJWC 2NQ7A 1ZGAA 3DPUA 2QBYA 4BY7J 4IQJA 1QPIA 1TLHB 1VQMI 4BYYA 4L18B 1VZ0A 2DOFA 5E3NA 1IRXA 4IEJA 1WGXA 1X1BA 1RZ4A 2B7EA 4XM3A 2XVCA 3GF2A 5IOZA 4HNTA 2ELHA 3L9FA 4AD9A 3ZQGA 2K3PA 3FX3A 1B9NA 2VXZA 4XBFA 4Q48A 2R5ZB 3I59A 2HYJA 4UNOA 1JUSA 4MEYF 4Q47A 3WTYC 2HNHA 4EJTA 3GFIA 1QVUA 4HG2A 2NVUB 2Q0OA 4GGGA 4A3CJ 1YX3A 1U5TB 2UV1A 1YRNA 2HR3A 1WHUA 3DPTA 2B3HA 1S29A 2F6CA 2JWTA 2CUEA 2EWNA 3E6MA 2WY8Q 1K78A 4UVCA 3E97A 3JAMK 4A3EJ 4Q4ZF 3V8JA 2EV5A 1MNDA 2VASA 2QQ8A 2BWWA 3TDZC 3GBGA 3SYTA 2RN7A 1UHSA 2IJLA 3S93A 2LF7A 4E70A 4IRIA 2E35A 2E71A 3PKDA 3I71A 4XOPA 3CO7C 1PUEE 4A3GJ 5FROA 3VYRB 2NS7A 3AG2H 2DN0A 3ZQHA 1F43A 3S2WA 3U2RA 5FB2A 2DFHA 3UNGC 3FXOA 3FM5A 1YIOA 3D27A 2HPIA 3RKXA 3F3XA 2K7LA 4RMNA 4ASNA 4A3KJ 3DV8A 5E8GA 2Z9OA 3DFGA 2HKOA 1I39A 4NBQA 5L3CA 1MBEA 4JQFA 1WKMA 1XB4A 1XDUA 3M1EA 1Z6RA 3LQRA 4GYGA 4FASD 2PFBA 4F7ZA 4MQVA 3OYJA 5L3FA 4S2RP 3NEUA 3MZYA 1XCBA 2OC6A 5J6XA 2A69F 2CQKA 4RAGA 2DLLA 3M3YJ 1I3QJ 3TDUC 3F8NA 1MBKA 3K4NA 2CFXA 2R7DA 2Y0MA 2BHYA 2D1VA 5JLWA 1ZLJA 2COBA 1E3OC 2RGVA 4BS9A 2R7ZJ 2YU3A 4YELA 3OYMA 3GFMA 3I4NJ 4ZTJA 4P9UA 1U5TC 2VE9A 2CGPA 1X19A 2HXOA 2TCTA 2PMZN 4U69A 3IKTA 1OR7A 2PEXA 5JHUA 1KA8A 3V7SA 2W85A 3JRHA 2Y9YA 1FEXA 3BJOA 3HHHA 1W7PA 1WJAA 5A2QZ 4P55A 2M3AA 4LK1F 3B02A 1TBXA 2M0MA 2OBPA 4O5VA 2ME0A 3BTLA 5DUKA 5FRNA 1QZZA 3ZQQA 4L5JA 3DTIA 4XONA 1XMXA 1YIJI 3GO5A 3NWTA 1NHAA 1OCCH 2KLOA 2X48A 1T6SA 5DYMA 1MMAA 3HBLA 2NOJB 3EYYA 2FBIA 1WSUA 2RQQA 2JA2A 1Z3XA 4GRIA 4HF1A 3KP7A 3W2AA 3BOQA 3B6CA 5BQTA 3FMQA 4FTHA 2Y0SA 2L02A 3S3MA 3GZ5A 3ML6A 2IPQX 1S7OA 1BR2A 5AIQA 2HFHA 3KPHA 1JHFA 5FGMA 4BHPA 5GPAA 2JRTA 1MMGA 4ZYEA 3BTCA 3QPLA 5ERIA 2KFDA 2X6OA 2ZJ2A 2R7SA 3QPSA 3KFWX 1R5ID 1NG7A 1P9QC 2TRTA 2IS4A 2QSGX 3VB2A 3FIWA 3S1RJ 3JTGA 2OD5A 5BNGA 2GU6A 5K7ZA 3COAC 1ENHA 1JUPA 3G3ZA 3OSFA 5J8FA 2IA0A 2BHZA 4I2OA 1W36C 3L00A 4KN7X 3HG9A 4XLAA 3ECHA 2K02A 1MD0A 1V4RA 1BI0A 2HDCA 1X1DA 2LTPA 3KCCA 1FYMA 3ZN1A 1FX7A 2VKVA 2L0KA 1D8JA 4X0GA 4LJZF 2GA1A 3S32A 4B09A 4KITB 4HAMA 2VC0A 3KP6A 4KISA 2GZWA 1UG0A 2J5OA 3DKWA 3D1NI 3CC4I 4UY8I 1K61A 2W84A 2ME6A 1MBFA 2GGCA 1OPCA 3ABKH 2H1KA 1XGMA 1NTCA 1S5LC 4PGGA 2BE5F 3I54A 2HPMA 3ZCOA 4IECA 3OYIA 2RREA 4FE7A 4BACA 2XGDA 4N9HA 5LGTA 5EG0B 4UUSA 3RPUD 3CCRI 2CUJA 2EK5A 2B3KA 1ZH5A 2JA8J 5ICFA 3F23A 2F5FA 2YX7A 1HDDC 1QU3A 2VB6A 4XRSA 4WF2A 3W6JB 1Y56A 3LSIA 2KISA 4YG2F 3S14J 3I5UA 4PUSA 1GXPA 2FE3A 3FMRA 2OTJI 2XPVA 1J5YA 4IO9F 4BXUA 1F4KA 3GTOJ 1XPXA 2F5EA 1BW5A 3HTSB 3K70C 1R1TA 4S05A 4BDZA 3CMYA 5JFRA 1O0XA 1TWAJ 2DFFA 3CCMI 3CCYA 5KVRA 2VOOA 3AG4H 4D7NA 1RESA 2FOKA 5CPRB 2X1DA 3DEUA 1FIPA 1Q1VA 1ZG3A 3BWGA 4AYBA 2KIMA 5CJ9A 3FXJA 2Q96A 2HTJA 2E1MB 3CQZJ 2JA6J 1YG2A 2CS3A 4QLCU 4R1HA 2RKHA 1O57A 1PP7U 3RORA 5FD6A 3LSKA 3LA2A 2IS1A 5B1AH 4EGEA 3JRIA 3N4MA 2COMA 3IG4A 1C22A 2CJJA 3OL4A 4PV4A 4BE0A 4HZFA 2Q2EA 1TWCJ 1HA8A 1C23A 3BITA 2LG4A 1UJ8A 3VDXA 3CMAI 2HDWA 3DWLE 1S9HA 3Q5FA 2DPDA 2QENA 2ZMEA 4E7IA 2BXYA 2GA2A 5HLTA 1QXZA 2G0EA 1QO0D 3I58A 2CH0A 4CCLA 4Z6YA 1XGNA 4PJLA 1IGNA 3FHZA 1HW1A 2MH9A 2IA1A 3JRBA 2XROA 1HDPA 2VT3A 5C4JJ 1BR4A 4CYCB 1Y0UA 2XF7A 2DMNA 4XLPF 1IXSB 1C21A 1JI8A 1V54H 1I6HJ 3ESWB 1VQ4I 2RNGA 2ZXWH 2D1HA 2RNJA 3E7LA 3ZQCA 2FXAA 3LFKA 2BZTA 3D5LA 3ROUA 3I64A 3PKEA 2OV7A 4G8XA 2YU9J 1AHDP 5L3GA 4ENJA 1U9OA 5M3MJ 4MTEA 3H35A 2A05A 5CDEA 4E7LA 4WK8F 2HKXA 2EVCA 3CF2A 1SAXA 3K1MA 1IUFA 1TW3A 3H9QA 2E1MC 2JN6A 4BGDA 3J81Z 2W7NA 1O3SA 5BMZA 1FNNA 1R6RA 4CSWA 2Q8KA 3FXRA 3J80Z 5FCFA 4XN0A 4U0YA 3CCLI 2OTLI 1YYVA 4RGRA 3CCSI 2L7KA 1S7AA 1EKEA 3PKCA 1QGPA 3T1BA 5F0FA 1VTNC 4D7MA 2VC1A 1OCPA 3OYBA 1T08B 4L5EA 1T8IA 1JTXA 2CWEA 4IHSA 1JXSA 3AG1H 2ZNZA 4ANJA 2GWRA 4P5OA 4CXFA 5TGTA 4JX5A 1AU7A 3VFZA 5LHHA 5LEJA 2DTZA 3HGYA 4OINF 1SC7A 1VI0A 1TL8A 2V1XA 1O3QA 1ERDA 3L2VA 4I0BA 2M0CA 2BYVE 3LAJA 2OJED 1J59A 4QTRA 2BWYA 5D5WB 3GUDA 5HLGA 4JBAA 4LITA 4DJAA 2V7FA 2W24A 4GYIA 4IOCF 2LNBA 3BPVA 1J2XA 4IKRA 5JHFA 1EH7A 3FXLA 4UUTA 3TBIA 3BPXA 1YLFA 1FJLA 1ORKA 4LLLA 1N51A 1GDTA 3S8PA 3HC7A 2K27A 2LREA 3I59B 2QKLB 4FETA 4HX4A 4JX4A 3H3VK 4UUVA 2ZXIA 3K4JA 4G7ZF 3JAMZ 3FXMA 3ZQIA 4ZJZA 1HOMA 2MGQA 3U1KA 2XHKA 3VODA 5LHGA 2FX0A 1YRNB 1EH6A 3IH4A 2KIUA 3SFIA 1S6LA 4L9VA 1K78B 4LFUA 2Y0SN 4KIGA 2XPUA 2HOSA 3E3VA 3PNTA 2Q93A 3OL3A 1SANA 4FX0A 1KGSA 2R93J 2Y2ZA 5H20A 1KU3A 1BI1A 4IKUA 1RPWA 3EUAA 2KRCA 4A0ZA 3RZDJ 2FBHA 3HGGA 1Z0XA 2DOAA 1B4AA 4XRSG 2XSDC 4I02A 4RB1A 5J3LA 3RTRA 1IF1A 2XGXA 3CDHA 2BHDA 4A69C 9ANTA 4M74A 3BR3A 4LG3A 4HX7A 1X2NA 5M5YJ 4A6EA 2BY0A 2HOTA 2DA3A 3VYUB 3HOWJ 2QCOA 3AG3H 2HQRA 3VSLA 3S6BA 1DU0A 1R9TJ 1U6GA 4A3JJ 1Q1HA 2MBFA 4A6VA 3V8KA 1Y1NA 1FMWA 1SD4A 2OQGA 2OUMA 2DT6A 4EJUA 5D5VB 2VIXA 3IAS2 4OIRF 4EEFG 1HCRA 2P4WA 2VUMJ 2VOPA 4L0YB 1V5EA 4U6EA 4BUPA 2XRNA 4RLFA 3PNVA 1UHWA 3DF8A 3A1YA 3NQOA 4CICA 5HVQC 1RETA 3BR6A 3H5RA 2ZNYA 3GTQJ 2BB7A 2DA7A 3LSHA 4ZWUA 3I4MJ 3L2RA 1JJ8C
chains in the Genus database with same CATH topology
1I6XA 3P9CA 4HOBA 1QBJA 2K86A 1G3WA 1IN6A 1GXQA 5FD5A 2PMHA 2RV8A 1HKQA 4FT8A 1W7PB 1ZRFA 2ESNA 4S04A 2P6SA 4ZNGA 4L0ZB 3JW4A 4Q5SF 1FPQA 4HV6A 2UXNA 3T8RA 3F22A 2EV6A 1LEBA 3NRVA 1H9GA 2WV0A 5CVIA 1CHMA 1QXYA 3FXQA 3WGHA 2G7UA 3IC7A 2BGCA 1IZ1A 3BROA 4R79A 2YX4A 2RDPA 3V7CA 1X3UA 3QPHA 4PNCA 3B73A 4FX4A 4O3MA 1SD7A 1W2MA 3KP3A 4RS8A 1UCRA 2JPBA 2MATA 1D5VA 4MEXF 2BWSA 1WI9A 4L9TA 4U70A 4HLXA 3I0TA 1ZGJA 2BEOA 2P99A 2BH3A 2F5CA 4B28A 4ZZLA 1O3TA 3WODF 5JI6A 4L9NA 1AOYA 3TGNA 1G3TA 1MKMA 1ON2A 1W5SA 2B3LA 1JE8A 1HQCA 1UB9A 2R3SA 1BBYA 3M9AA 2DI3A 4LB6B 4WWCA 3H3UA 4WXHA 1ZG5A 3C7JA 4RB3C 4ZWOA 2W57A 3HYIA 1R5HA 3KP4A 5L3EA 1FP1D 1FP2A 5CYVA 1I1SA 4OOIA 2P98A 4HBLA 2DO7A 2JPCA 1ULYA 5K5QA 4U71A 1OYWA 2XIGA 2VE8A 1ODDA 2NQ6A 4IKSA 1Z05A 1YW7A 5H6RA 1W7VA 3HTUA 3PFIA 4MQ9F 1HW2A 4KT5C 5ICGA 5D6FA 4I0AA 4OOKA 2VBZA 3HSFA 1FY7A 1A16A 2NNYA 2GG7A 4IVNA 1MATA 4L9JA 2EFWA 1R22A 2STWA 2ZMEB 4EQQA 3GXOA 3T8TA 2X4HA 1LJ9A 3Q9VA 3CTAA 2JT1A 1SMTA 2DTRA 5DD8A 3TKYA 2BWTA 2BWXA 3CO6C 3CB6A 2LSOA 1IRFA 4M73A 1CGPA 3ISPA 4LMYA 2Q95A 4EM0B 1XN7A 1R36A 2ZSGA 2H6CA 2G6PA 3JSOA 4CDGA 1C0WA 1D8KA 3WTZA 5K5RA 3K1NA 4HYEA 3MAJA 3HSRA 5E20A 3WTSC 1AWCA 4KFCA 1O7LA 4FLLA 5HDGA 5HS8A 3FZVA 1E2XA 4KYWA 2L3DA 5K5OA 4U6WA 2LDUA 3T5XA 2FU4A 2O6GE 1EV7A 1QNTA 1LDDA 2VBXA 3KP2A 4KUMA 1WL9A 1B6AA 2HYFA 1H9TA 4YIIA 5CNXA 3W6KB 4UVAA 3KZZA 5HLHA 1T39A 2W25A 4EM2A 2BWUA 2XV4S 4K2EA 5ILSA 3HRTA 1FBSA 3ZQ7A 1HKSA 1QXWA 3KEOA 1P4WA 4FO8A 5BPIA 3VOEA 4KN4X 3Q9SA 3RYPA 1BOAA 1Z6TA 3R0JA 2GU7A 3F21A 1RNLA 2QYOA 2Z33A 4IPAA 2RQPA 4AWXB 2ZCWA 3O2PE 3F6OA 2HOEA 3GFLA 4HA8A 4HDUA 1USSA 3RJPA 2PG4A 3ELKA 3IRRA 5E5BA 3M8FA 3TAVA 2V1DA 4AIJA 1FBUA 1KU2A 3OOPA 3EYIA 5DCFA 2HS5A 2H6BA 1ONVA 5F1RA 3PQKA 2P5VA 4KIFA 4ESJA 3IWFA 4U73A 1KQ8A 2P5KA 2PBIA 2OAZA 2YSRA 1K79A 3C3WA 1J7KA 1MJBA 2MD5A 5BOXA 3WTWC 4HQEA 2VN2A 3IU9A 2GQQA 1T0FA 2VBWA 3F8MA 1FSEA 2DK8A 3ERED 4IHTA 3R4KA 5F6FA 3REOA 3PQJA 2R7FA 3HUGA 2DK5A 4ZYHA 5LHIA 4FO7A 2VBYA 2BBYA 2L4AA 4FHTA 4FLJA 2KJBA 3QOPA 4RGZ1 2IW2A 3HOSA 2XUBA 3ZMVA 1U2WA 5E1ZB 1J75A 3IWZA 5IT3A 3IL2A 1SFEA 2V3XA 1QZYA 4WXCA 2YPRA 4ESFA 2V3YA 2AXLA 3KZYA 2PI0A 2GU4A 3GYHX 1LVAA 4ESBA 5FO5A 3RYRA 1R5GA 1STZA 1WBQA 1FZPB 1C24A 1IAWA 3GLXA 2FNPA 3TQNA 2O61A 4AVPA 2PMUA 2GG5A 2PLYA 4IXAA 4A12A 1S8NA 5L3DA 3RKWA 2HZTA 1P4AA 1LB2A 1WRJA 3RPQA 3F8BA 2HEOA 1T98A 1IW7F 4KDPA 4U7DA 3BZ6A 4EV0A 1HSTA 1Z91A 5HLIA 3JSPA 1TNTA 4PZJA 1KQ0A 3MCZA 1IUYA 3WE2A 5EEHA 1BI3A 3KEQA 3H92A 2OZ6A 1R23A 3PKBA 1J9IA 5FLXK 3K0LA 4BHCA 3E6DA 5BPDA 1YJ3A 1WL6A 3MATA 3SFZA 2P8TA 4JUQA 4MATA 2LF8A 5FFXA 1YFHA 4M6XA 3MQ0A 3LAPA 4HF2A 2Y75A 4GXOA 4N9IA 2VT2A 3WGGA 5ED4A 3ABUA 3L24A 2MA3A 4UXNA 1BIBA 4RZYA 4FLIA 2E1NA 3FWEA 2GIVA 1KYWA 3BY6A 2QQBA 1OYYA 3PKAA 3HHGA 2IT0A 4A0XA 4EJOA 2GG9A 1XCVA 3LSTA 5HS7A 4M9ZA 2JTVA 4M6YA 3E5QA 3BP8A 3IHUA 2DBBA 5HDKA 2EFNA 3HIFA 2EJRA 2DQLA 2BN7A 3FM3A 4TV7A 3LA3A 4DNCA 3GWZA 4U0WA 2A3SA 1K6OA 3G73A 5D4SA 2DPUA 4A2UA 3LA7A 4OMYA 2O0YA 1G3SA 4KIBA 3K69A 3BIQA 3BJ6A 1REPC 1J0RA 3C18A 2FNAA 1IN4A 3V8LA 4MTDA 5DV5A 2A5YB 3OV8A 1TQPA 3ZMZA 5AONA 3HRMA 1LQ1A 2RVCA 3TB5A 1YW8A 2PQ8A 5LRRA 4KM3A 1MDMA 3CLOA 1C27A 4RB2C 5LLQA 2MLKA 1W5TA 2Z99A 2ZBKA 5TRDA 3IU8A 5CVRA 1U8RA 2E1CA 2IA2A 5K1YA 4NQWA 4EGYA 5F64A 3HOTA 1XSDA 4OMZA 2NNNA 4EM1A 3F8CA 4IDYA 3KLNA 1FOKA 4U75A 3SXYA 1TQMA 3H3ZA 4P96A 1HXDA 3MEXA 2OKNA 3M7GA 3F6VA 1W4MA 2WC2A 3BDDA 4WCGA 2QM3A 4YFXF 2DQRA 1YVMA 3KETA 3EETA 4A5NA 2WTEA 1O3RA 4Z7MA 1L0OC 4U6JA 2QQAA 1L3LA 3V4GA 5H6QA 3Q6DA 2BWVA 4M71A 4YIFA 1TW2A 4GCVA 3GX4X 5D5XB 1YTYA 1DPUA 2EB7A 3RDIA 4HDVA 2J5PA 1BN5A 4S2TP 4IJAA 4RGSA 2PJPA 3IU7A 4P9FA 4KMUX 2DAOA 3HSEA 2MH2A 2GG0A 5CVUA 2EFQA 4HLYA 5HS9A 1MZBA 3P9KA 2DU9A 1IN8A 3SQNA 2IRFG 3BIPA 1S3JA 4S01A 2UXXA 1SMYF 2DFIA 4OIQF 1IN5A 3C1DA 1T38A 3ZP5A 3DQVC 2Y48A 2RC4A 4FKCA 2CYYA 3FMSA 3MZHA 4ZWPA 2E7XA 4ZZDA 3IRQA 1KYZA 1ZARA 1KQ9A 4UVBA 2Q92A 2GU5A 2KIFA 5E1WA 1CF7A 2GG8A 3DPLC 2O03A 3DXJF 4UV8A 2G9WA 5EEGA 1MJAA 3WTVC 4BAYA 4JK1X 4LLGF 5LEKA 2QQ9A 3EQLF 1XMAA 4FUKA 4IKTA 1XSXA 4A5MA 1UFMA 1ON1A 2HGCA 4RB0A 4UHTA 2ISYA 2O3FA 1T2KA 1R58A 4XSZF 3GEZA 5E18F 5JR3A 5FCHA 4M72A 3J7AO 4LG0A 2VONA 1ZLKA 2H94A 1GHCA 3QAHA 1FYLA 2EA2A 2KJCA 4HX8A 3F8FA 4HW0A 2Z3YA 1DP7P 1F5TA 1G6NA 5BS6A 2WWYA 4EMSA 5L3BA 1USTA 2V1UA 2V9VA 4RAZA 5FLXZ 3R6SA 5E17F 4R8HA 5IT9K 3R60A 3VEPA 4BH9A 4M9XA 4GO1A 3GZ6A 3K2ZA 1FWZA 3MR1A 2ISZA 1ZN2A 3BJAA 2F5DA 5ILVA 1LEAA 1WQ2A 4LD5A 3DP7A 4PGHA 3QPTA 3HRUA 2P9AA 2OU2A 2ADUA 1Z7UA 2A61A 2HYGD 1IXRC 3QP6A 1WN1A 3U1DA 1YW9A 3WTUC 4U1BA 4XSXF 2JSCA 2XAHA 4U0VA 3RIRA 2ESHA 4KMFA 1DUXC 4U6ZA 4RGUA 4U88A 2STTA 3P9IA 1SFXA 5FFZA 1WLRA 4BQAA 4ENMA 1ZYRF 4HXXA 2XAGA 2PN6A 4CO8A 1FT9A 1ZAOA 5DD4A 1DPRA 3WTTC 5ICEA 5J8CA 3ZN0A 1JAWA 3SZTA 1SD5A 3RI4A 3QRFF 1LNWA 3E5XA 3L09A 1TNSA 1SD6A 2K4JA 1WWXA 5HOOA 1O7FA 1ZHFA 3CUQA 4WXDA 2A6EF 4ZH4F 2M8EA 2HOWA 1P4XA 3HRSA 1LDKB 3EUHA 1BM9A 1MDMB 2ZO4A 1B9MA 4EGZA 2NAZA 4Y15A 2P5LC 1R1UA 3CUOA 3AAFA 3ZMUA 2ETHA 2EVOA 1RUNA 3P7NA 4U76A 1U3EM 1V3FA 2XAJA 2M1BA 5ICCA 3TO7A 3WTXC 3ZMSA 2ZXJA 4IU6A 5LGUA 3L7GA 1W7PD 3T0YA 2Q94A 3L7WA 3U9GA 3CTZA 4HQMA 2NS0A 2GXGA 2BHBA 2NYXA 4KICA 1I27A 3R61A 2A6HF 1UHMA 2FA5A 4LLNA 3RPUA 2X0LA 4OIOF 4CHUA 3RVAA 2ACJA 1OKRA 4A6WA 2CO5A 4ENKA 2IW5A 5DUIA 1Z1DA 5LBQA 1XDSA 1YO5C 2H09A 1OMIA 4NHJA 3ZMDA 1PDNC 3LQQA 2ZKZA 4A6DA 3E6CC 5CLSA 2B0LA 4UV9A 5DCMA 2K4BA 1G4DA 1P2FA 4H0EA 2OQRA 3KE2A 4KNYA 4AIHA 2M87A 4PDKA 2HTSA 2H27A 1KU9A 4IF4A 3I4PA 3IKVA 3GW2A 4LB5A 2EV0A 1TQIA 3GFJA 1QPMA 6PAXA 1LDJA 1B1BA 4I7HA 4IRHA 2OA4A 2XASA 2V79A 1Z9CA 4KA4A 3QU3A 1FYKA 4EJVA 2P7VB 2HWVA 4PCQA 4OIPF 3M8EA 2DW4A 1ZRDA 4MNUA 4M9SA 1MGTA 4MHGA 2P7CB 3ULQB 2KRFA 1IRGA 1FBQA 2L54A 4G7OF 5CVVA 4Z2YA 1XNZA 1CF7B 2EVMA 3K9TA 3L2CA 4ZYGA 2GXBA 3TO9A 4ENNA 5LGNA 4CGZA 1PP8F 1HSJA 1MJ9A 4ON0A 2GG3A 2E7WA 2FSWA 3E6BA 5CDLA 5E1XA 2GG2A 3QP5A 3CJNA 2A68F 2DT5A 2M30A 3KP5A 3MFKA 1U5TA 3D0SA 4FLKA 1ZRCA 1F1ZA 2GTXA 3V7RA 2FQ3A 5CVJA 4A0YA 4I09A 4BNCA 4LG0B 4NB5A 1H0MA 2C6YA 4WX9A 5CE6A 5ILUA 5D4RA 2L01A 4EJWA 4ETSA 5IT9Z 2YR2A 4IF7A 4YFKF 1XMKA 3LWFA 2MLGA 1U78A 2FMYA 4CYDA 3WU0A 1XSVA 5AIPA 2QBYB 1JHHA 4RAYA 1HBXG 1HKTA 3ECOA 3ABTA 4G7HF 3WU1B 2FF4A 1KP0A 1ZG1A 3E5UA 1A04A 5D8KB 3MWMA 5D6EA 1HW5A 2D45A 5D8LB 3WE3A 4B8XA 4G6QA 2CW0F 1M35A 1GVJA 2V6CA 5D5UB 4ZYDA 4I01A 1PV9A 2HQNA 4LK0F 4U7BA 1EH8A 2JZYA 3KLOA 3F72A 5DDGA 5A2QK 1JGSA 1E17A 1FC3A 4O6JA 4MGRA 1D3YA 2M5WA 3CB5A 1RI7A 2FRHA 2CSOA 2D2WA 2A07F 2BHCA 3TOAA 1R7JA 1XGOA 1XGSA 3O6BB 1FLIA 5CDVA 1SFUA 1P92A 2G7HA 2BV6A 2NRAC 3FXUA 3MX6A 3CUQB 1G3YA 1QQIA 2FBKA 2V3ZA 3ZMTA 4G94A 3O3KA 1F9NA 3WGIA 4BHBA 1XD7A 3EDPA 1YS7A 2XKOA 4LGWA 2IP2A 2UZKA 4CZZA 4XLNF 2Z5UA 4R60A 2ZFWA 3K1PA 1ZREA 3TOBA 2O8XA 3WG9A 1BC8C 4I98B 2EFPA 3QU6A 2VODA 2XAQA 4Y17A 5LRSA 3TO6A 2IVMA 3SZPA 1BIAA 1KU7A 1I5ZA 4AIKA 2QLZA 3I53A 2P6TA 2M45A 5DEQA 5E8IA 4G6DA 1TTYA 1P6RA 4Y13A 2BHAA 2F2EA 5KK1A 3CUQC 1RIOH 2EA4A 2CG4A 1YQAA 4G9YA 3SHFA 3R0AA 2QWWA 1I1GA 2KKOA 3ZPLA 1BC7C 2QUFA 2XAFA 5JVTA 1R00A 2OZUA 4QWQA 4XRFA 4OU0A 5DCMB 1FSHA 4HV5A 1RUOA 5TJJA 1DDNA 4YFNF 4D0PA 3JTHA 1BI2A 2QVOA 2GAUA 2FMLA 4DQ2A 1K7AA 4HF0A 2UWMA 1IN7A 1R1VA 2AS5F 1OYIA 4RZZA 3N97A 4N0BA 2QZ8A 5HDNA 3FF5A 1WY2A 2MC3A 4L5IA 3GVAA 4U6CA 4EVIA 3J81K 1YS6A 1BJAA 2LKPA 2TDXA 4RGXA 3J80K 3RKYA 2EFOA 4QR8A 2FEZA 2GGBA 1B59A 2GZ5A 2L4MA 4IRGA 5CIKA 2XKPA 1IXCA 2NQ7A 1ZGAA 2QBYA 1TLHB 4BYYA 4L18B 1RZ4A 2XVCA 3GF2A 2ELHA 3L9FA 4AD9A 3FX3A 1B9NA 2VXZA 4XBFA 4Q48A 3I59A 4UNOA 4Q47A 4MEYF 3WTYC 4EJTA 3GFIA 2Q0OA 4GGGA 1U5TB 2HR3A 3DPTA 2B3HA 1S29A 3E6MA 1K78A 2EWNA 4UVCA 3E97A 3JAMK 4Q4ZF 3V8JA 2EV5A 2BWWA 3TDZC 2RN7A 4E70A 2IJLA 2LF7A 3PKDA 4IRIA 3I71A 3CO7C 1PUEE 3S2WA 3U2RA 5FB2A 3FM5A 1YIOA 3D27A 3RKXA 3F3XA 2K7LA 4ASNA 2Z9OA 3DV8A 5E8GA 3DFGA 2HKOA 5L3CA 4JQFA 1WKMA 1XB4A 1XDUA 3M1EA 1Z6RA 3LQRA 4GYGA 2PFBA 4F7ZA 4MQVA 5L3FA 4S2RP 3NEUA 3MZYA 1XCBA 5J6XA 2A69F 2CQKA 2DLLA 3TDUC 3F8NA 2CFXA 2R7DA 2Y0MA 2D1VA 1ZLJA 2RGVA 2YU3A 3GFMA 4P9UA 1U5TC 2VE9A 2CGPA 4U69A 3IKTA 1OR7A 2PEXA 5JHUA 1KA8A 3V7SA 2W85A 3BJOA 3HHHA 1W7PA 5A2QZ 4P55A 4LK1F 3B02A 1TBXA 2OBPA 4O5VA 5DUKA 1QZZA 4L5JA 3GO5A 5DYMA 1NHAA 1T6SA 3EYYA 2FBIA 1WSUA 4HF1A 3KP7A 3BOQA 5BQTA 3FMQA 2L02A 3GZ5A 3ML6A 2IPQX 1S7OA 5AIQA 2HFHA 1JHFA 5FGMA 4BHPA 2JRTA 4ZYEA 5ERIA 2ZJ2A 3KFWX 3VB2A 3JTGA 2OD5A 2GU6A 3COAC 3G3ZA 5J8FA 2IA0A 4I2OA 3L00A 4KN7X 3ECHA 2K02A 1MD0A 1V4RA 1BI0A 2HDCA 3KCCA 1FYMA 3ZN1A 1FX7A 1D8JA 4LJZF 2GA1A 4B09A 4HAMA 2VC0A 3KP6A 2GZWA 2J5OA 3DKWA 2W84A 2GGCA 1OPCA 1XGMA 4PGGA 2BE5F 3I54A 4IECA 4N9HA 5LGTA 2EK5A 2B3KA 1ZH5A 5ICFA 3F23A 2F5FA 2YX7A 4WF2A 3W6JB 4YG2F 3I5UA 1GXPA 2FE3A 3FMRA 1J5YA 4BXUA 1F4KA 2F5EA 3HTSB 1R1TA 4S05A 5JFRA 1O0XA 5KVRA 2VOOA 2FOKA 1ZG3A 3DEUA 3BWGA 2KIMA 5CJ9A 2Q96A 2HTJA 1YG2A 4QLCU 4R1HA 2RKHA 1O57A 1PP7U 3RORA 5FD6A 3LA2A 4EGEA 3N4MA 2COMA 3IG4A 1C22A 4PV4A 4HZFA 2Q2EA 1C23A 3BITA 3Q5FA 2DPDA 2QENA 2ZMEA 2GA2A 1QXZA 1QO0D 3I58A 1XGNA 3FHZA 1HW1A 2MH9A 2IA1A 2XROA 2VT3A 1Y0UA 4XLPF 1IXSB 1C21A 2D1HA 2RNJA 2FXAA 3LFKA 3D5LA 3ROUA 3I64A 3PKEA 4G8XA 5L3GA 4ENJA 4MTEA 5CDEA 4WK8F 2HKXA 2EVCA 1SAXA 3K1MA 3J81Z 1TW3A 1O3SA 5BMZA 1FNNA 3J80Z 2Q8KA 3FXRA 5FCFA 4U0YA 1YYVA 4RGRA 1S7AA 3PKCA 1QGPA 3T1BA 1VTNC 2VC1A 2CWEA 4IHSA 1JXSA 2ZNZA 4CXFA 2GWRA 4P5OA 3VFZA 5LHHA 5LEJA 4OINF 2V1XA 1O3QA 4I0BA 2BYVE 3LAJA 1J59A 2BWYA 5D5WB 3GUDA 5HLGA 4JBAA 2W24A 4GYIA 4IKRA 4S00A 2LNBA 3BPVA 1J2XA 1EH7A 3BPXA 1YLFA 4LLLA 1N51A 2K27A 3I59B 4HX4A 4UUVA 4G7ZF 3JAMZ 2XHKA 3VODA 5LHGA 1EH6A 2KIUA 1S6LA 4L9VA 1K78B 4LFUA 4KIGA 3E3VA 2Q93A 4FX0A 1KGSA 5H20A 1KU3A 1BI1A 4IKUA 4A0ZA 2FBHA 1B4AA 4I02A 4RB1A 3RTRA 1IF1A 2XGXA 3CDHA 2BHDA 4M74A 4HX7A 4A6EA 2HQRA 3S6BA 1U6GA 1Q1HA 2MBFA 4A6VA 3V8KA 1Y1NA 1SD4A 2OQGA 5D5VB 4EJUA 4OIRF 2P4WA 2VOPA 4L0YB 4U6EA 2XRNA 1UHWA