1WKMA

The product bound form of the mn(ii)loaded methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title EPR and X-ray crystallographic characterization of the product-bound form of the MnII-loaded methionyl aminopeptidase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wkmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wkmA01
2DPDA 3VODA 3SZPA 1LDDA 1OYIA 1MDMB 1OYYA 4OMZA 4KN4X 1C24A 1WI9A 4A0YA 1USSA 3U1DA 4YIIA 3RVAA 2D45A 2Z9OA 1WQ2A 3ZMVA 4XSXF 1HW5A 3E3VA 4EJUA 5JHUA 2BHBA 2CSOA 1H0MA 2MLGA 3CB6A 2Q94A 1XGOA 1G3WA 2DK5A 1QQIA 2CG4A 3TB5A 3CO7C 4QR8A 3FX3A 5L3CA 1B59A 3F21A 3IG4A 2PN6A 1KU2A 2BHAA 3IU7A 1YS7A 3VOEA 1MZBA 5TRDA 1BI1A 4HXXA 2FNPA 3GYHX 3W6KB 5D6EA 1XGSA 4L0ZB 3LSTA 2GU4A 4KNYA 2KIFA 2JRTA 3KZYA 4MEYF 1ZAOA 3IRQA 3PKCA 1S6LA 3SFZA 3F8CA 3IU9A 1QXWA 2D2WA 1YYVA 2Y0MA 5H6QA 4Z2YA 4FUKA 2Q96A 1QNTA 2FA5A 4KMUX 3I64A 4IF4A 2RV8A 4I2OA 3WGHA 4IRGA 1K79A 1FYKA 5AIPA 5BPIA 3REOA 2UWMA 1O7FA 2HYFA 3R60A 4LJZF 1QGPA 4YG2F 2RN7A 2DTRA 4G7OF 5HDGA 2RQPA 3HOTA 2FMYA 5DCFA 5J8CA 3ZN1A 1CF7B 2DBBA 4ZWOA 1YTYA 3GEZA 3F8MA 5L3DA 4ZYEA 1T39A 5LRRA 3TAVA 2HKXA 3ZMDA 2COMA 4ENMA 3WODF 3TOBA 2PMHA 3R0AA 1W5TA 3GVAA 1G3YA 2P5LC 4FX0A 2KKOA 1JE8A 1PDNC 1JHFA 5E1XA 1BN5A 1IUYA 3LWFA 4IHSA 4IF7A 1LDKB 2EWNA 2P5VA 2Y48A 4G7ZF 1W7PA 3L7WA 1BI2A 3BIPA 1TQPA 3PKBA 4S05A 4KM3A 2H6CA 2Z3YA 2RC4A 1L0OC 4KN7X 2BBYA 1KP0A 4UXNA 1QZYA 4I02A 4M73A 1GXPA 2NAZA 4WK8F 3K0LA 4DQ2A 4IKUA 3R0JA 2BWUA 2FBIA 1OMIA 4LB5A 4TV7A 2MATA 2ETHA 3L2CA 3GFLA 1R1VA 3M1EA 1FP1D 1Z05A 2MC3A 3KLNA 3PKEA 1DUXC 4O5VA 3K2ZA 4JBAA 3V4GA 4HX8A 1T98A 1USTA 3HSRA 1P92A 4JK1X 2VN2A 4ZYHA 5H20A 3F23A 4S2TP 4FKCA 4A6WA 3KETA 2VBZA 1SD4A 1YLFA 2XRNA 5F64A 1W2MA 3KP7A 3MWMA 1U78A 2P8TA 3I5UA 1ZRFA 2DFIA 1R1UA 3HOSA 5E20A 1MJBA 3D5LA 1YIOA 2OQRA 1YJ3A 4UVAA 1I5ZA 3HSEA 3CUQB 2J5OA 3G73A 4KIBA 3FZVA 3V7RA 2IT0A 5CDLA 2QENA 4I0AA 2P7CB 2WTEA 3GFMA 5JI6A 1JHHA 4U70A 3V7CA 2EVOA 4EM2A 3DPLC 3E5QA 1J75A 4B8XA 1IN7A 1V3FA 3ECOA 3NQOA 4BH9A 3FF5A 1YO5C 3CDHA 4HAMA 1R5GA 3TKYA 3PQJA 2BEOA 3L7GA 1LVAA 1AOYA 4U0YA 4M9SA 4BYYA 1T38A 1WY2A 4XLPF 2JSCA 2LNBA 1R5HA 1ZG3A 3I54A 4EGYA 3C1DA 5FFXA 2LF8A 2M87A 2VONA 3F3XA 1XB4A 4RB0A 1WL6A 3Q5FA 2Q0OA 4U6JA 1VTNC 3E6BA 5JVTA 3JSOA 3OOPA 4Q5SF 1Z1DA 2XVCA 3WE2A 3WTUC 1I27A 2MH2A 1XCBA 3JAMK 1TBXA 3TO7A 5L3FA 2GAUA 4A5MA 1F4KA 1RIOH 4PGGA 2P99A 4ETSA 3EETA 4S00A 2F5FA 4A12A 3V8JA 2F5CA 1JAWA 5DCMA 2RVCA 2HYGD 1FC3A 3BJOA 5LEJA 1K78A 1ZREA 4P5OA 5FLXZ 5K5OA 3E5XA 1C21A 4KT5C 3R61A 2XGXA 3QP5A 3GZ5A 3E6DA 2OA4A 4S01A 2EV6A 4S04A 2PG4A 2QM3A 4HX7A 2JZYA 3WG9A 2XAGA 4A6DA 1R36A 5CVRA 3IKTA 2DPUA 4FLLA 4HBLA 1HKTA 3PQKA 2HGCA 4P9FA 1XMAA 2GQQA 1BI3A 1WSUA 4M6XA 3CTZA 2LKPA 4ENKA 2EVCA 2VBWA 3ERED 3DQVC 3HHHA 4FT8A 4HZFA 5F6FA 3J7AO 2QBYB 4IRIA 3MFKA 2EK5A 5AIQA 5LLQA 5J6XA 1DDNA 3BP8A 1SD5A 2NNYA 2A3SA 1C0WA 2GZ5A 2ZFWA 3SZTA 3FMRA 5IT3A 4XLNF 2PLYA 3IRRA 1IN8A 2AS5F 3T1BA 1MDMA 4N0BA 4KYWA 3ROUA 2QYOA 3TGNA 2EVMA 2FEZA 5BPDA 3NEUA 1T2KA 3EYYA 2QZ8A 2YU3A 2ACJA 2H6BA 3V8LA 4RB1A 3FMSA 2P7VB 3QOPA 1OKRA 6PAXA 2BWXA 4Z7MA 4N9HA 5FCFA 1V4RA 4BXUA 4P9UA 5D5XB 1FNNA 3QRFF 1CHMA 1T0FA 3D27A 5J8FA 2GG3A 1B4AA 4JQFA 4U71A 3ZMSA 5LHHA 3WTVC 4EJVA 2O0YA 2C6YA 2YX4A 2Z33A 1LDJA 4YIFA 1KYWA 1O3RA 2NS0A 4PNCA 3HTSB 1R58A 4RB3C 4ESBA 3FXRA 4KIFA 1QZZA 4HF2A 3BJ6A 2L01A 1MKMA 1ULYA 2UZKA 2ADUA 1ZYRF 4JUQA 4GXOA 4ZH4F 4KMFA 5BOXA 4IECA 1SMYF 2ZNYA 3BZ6A 1SFUA 1EH8A 3GFJA 1SFEA 1XGNA 3J81Z 2L3DA 4IRHA 2GA2A 5HOOA 1XNZA 4LMYA 1WWXA 4U75A 1QO0D 5L3EA 5ICGA 2K86A 5LGTA 2DI3A 3ZP5A 2HZTA 2A61A 4Y17A 4ESFA 2ZNZA 2EA2A 4U0VA 2K7LA 2HTSA 1KU3A 3KLOA 1IAWA 5IT9K 2IA1A 1R7JA 4PCQA 3WGIA 4KIGA 4M6YA 2A5YB 2HS5A 4UVCA 3JAMZ 2BGCA 2BN7A 4A6EA 3IHUA 3V7SA 3ML6A 2GU5A 1E2XA 1S29A 2XAJA 4RAZA 2IJLA 2V3ZA 4RZYA 1OYWA 1W7PB 4KUMA 2OU2A 2LSOA 1ZG5A 4GYGA 1TQMA 4U6EA 3TQNA 4L9JA 2W24A 4B09A 1ZGAA 4CZZA 3CLOA 3K1MA 1RNLA 4R8HA 1D8JA 3RIRA 3ECHA 1EH6A 1W7PD 3RI4A 3RTRA 2VOPA 2OQGA 4I01A 5KVRA 2FU4A 4BAYA 3CO6C 1HKSA 2BWSA 4RGUA 3Q9SA 2V3YA 1Q1HA 2IP2A 5FGMA 3WE3A 3TO6A 2NRAC 3DV8A 1KQ8A 2MBFA 2CYYA 4AD9A 4RS8A 4ZWPA 1J7KA 1MATA 3J81K 3F8FA 1QPMA 2V1DA 2VXZA 5A2QK 2O6GE 1IZ1A 4I09A 2P5KA 5LHGA 2Q95A 1ZLJA 2LDUA 2IW2A 5LEKA 1U3EM 2IPQX 4OIRF 1O3QA 1TQIA 1PUEE 3IU8A 1YS6A 2GZWA 4OOIA 5LBQA 3V8KA 4BQAA 3GWZA 2GU7A 5CNXA 1D8KA 2FSWA 2YX7A 3WTXC 2F2EA 1TTYA 4KDPA 1N51A 4HLXA 3BDDA 2E1NA 1UB9A 5DUIA 2DLLA 1YG2A 4H0EA 4MEXF 4IU6A 2FQ3A 2Y75A 2VE9A 2V3XA 4NQWA 3MZYA 5LRSA 4XSZF 4CICA 3ABTA 2VODA 3HRSA 5EEGA 2A69F 1IW7F 2XKOA 2J5PA 2EFWA 1FBQA 1SFXA 4Y13A 4L18B 5LGNA 5DDGA 1FY7A 3O3KA 2P6TA 1HW1A 4IKRA 2FRHA 1FZPB 1RUOA 1J59A 2B3LA 1SAXA 3DEUA 3KEQA 4M71A 3P9KA 3ZQ7A 3TDZC 3RYPA 2ISZA 5DCMB 4R1HA 2KJCA 5ICEA 2ESHA 2HQNA 2R3SA 2YSRA 1LJ9A 2CGPA 4RGSA 3S6BA 4IPAA 5AONA 3G3ZA 3LQRA 2OZ6A 1UHMA 2CWEA 3CTAA 2Q93A 4MNUA 1W5SA 1ZH5A 2YPRA 3HTUA 1XSVA 3C18A 2ZCWA 2B0LA 2H09A 2W84A 1BM9A 5CLSA 3SXYA 2KRFA 4WX9A 4ON0A 4UV9A 3F6OA 3L00A 3GUDA 1I6XA 1STZA 4MGRA 4U6CA 4LLGF 1FPQA 1TW2A 4RZZA 3RKXA 2XUBA 1C27A 4LK0F 3FMQA 4L9VA 4G7HF 1K7AA 3CUQC 3JSPA 1I1GA 5CDEA 4I98B 3FHZA 4IXAA 3MR1A 2BH3A 4UV8A 3HUGA 2GG5A 3MZHA 2STTA 2XV4S 2K02A 4YFNF 4ASNA 3AAFA 4HX4A 2P9AA 4FLIA 4LFUA 1HXDA 4U1BA 4RGXA 1G6NA 1BOAA 1TNSA 3IWFA 1ZHFA 4LLNA 2F5EA 3GZ6A 1IF1A 4CXFA 2BE5F 2CW0F 4EJWA 2L02A 3JW4A 2OD5A 2RDPA 3HIFA 4CHUA 2FXAA 4PZJA 2XAHA 5FCHA 3MAJA 2RNJA 3NRVA 2VT2A 2BWVA 2GXBA 4AVPA 4EMSA 2RKHA 2BWWA 1WBQA 1O7LA 4M72A 4HDVA 2QQBA 2PMUA 1KGSA 1HBXG 1EV7A 4WXCA 3I71A 2JT1A 1DPUA 3COAC 3WTTC 4GGGA 4WF2A 2YR2A 2Q92A 2W85A 1DPRA 3GXOA 3F6VA 5HS9A 3H3ZA 4WXDA 1LEAA 1UHWA 3L24A 5ICCA 3BOQA 1M35A 1J9IA 1G4DA 4G9YA 4GO1A 1H9TA 5FO5A 1F1ZA 2IW5A 3H3UA 3Q9VA 2OKNA 3HHGA 4OINF 3O6BB 5CYVA 2W25A 5TJJA 2EA4A 4HA8A 5H6RA 2EV5A 5CVIA 3N4MA 3HRMA 2JTVA 1FX7A 3WTSC 2ZBKA 2VBYA 3I0TA 1PP7U 2RGVA 4U7DA 4M9XA 1PV9A 1P4WA 2NQ6A 1BC8C 1XSDA 4MTDA 5ILUA 2Z99A 3P9CA 3U2RA 5D4SA 4L5JA 5L3BA 1U6GA 1UFMA 3BY6A 5FLXK 4UUVA 5FFZA 1TLHB 3T8RA 2QLZA 2IA0A 3BJAA 2M8EA 2WV0A 2BWYA 4PDKA 2K4JA 5JFRA 3C3WA 3DF8A 2O61A 1YW8A 1ZN2A 1T6SA 4EJTA 5CVUA 4G8XA 3MX6A 3DKWA 4A5NA 1FWZA 2P4WA 3RORA 1BC7C 4N9IA 1FP2A 2UXNA 3F22A 1WRJA 3EDPA 4I0BA 5LHIA 2HOEA 5HLHA 3E6MA 2L54A 2DQRA 2H27A 2BV6A 5CE6A 2OBPA 4RAYA 1R00A 1J0RA 3VFZA 1ODDA 4Q47A 2V79A 1SD7A 2GG8A 1ZARA 2IRFG 4IKSA 2M5WA 4B28A 1ZGJA 1REPC 1JXSA 3RDIA 1U2WA 2V1XA 2WWYA 1Z6TA 1QBJA 2W57A 2MH9A 4L0YB 1CGPA 2XROA 2V1UA 1R22A 3LAPA 2EFPA 2PI0A 3GX4X 2EV0A 3P7NA 3HRTA 5D6FA 4U0WA 3B02A 3RPQA 4M9ZA 3WU1B 2BWTA 3RJPA 2A6EF 2Q2EA 3E5UA 4P96A 2HQRA 3BIQA 5FD5A 1Z6RA 1YW7A 4LB6B 5E8IA 2PEXA 1XMKA 4BNCA 3HRUA 2ZO4A 5D5UB 1FYMA 3M9AA 4CO8A 2MD5A 3E97A 4LGWA 4O3MA 3F8NA 1Y0UA 3QAHA 4K2EA 4KA4A 1KA8A 3KCCA 1L3LA 1UCRA 3CUOA 3M7GA 3ZMZA 2ZKZA 4YFKF 5IT9Z 3K69A 3N97A 3J80K 5KK1A 1G3SA 4ZZLA 4L5IA 4HV5A 2VC1A 5E1WA 3RPUA 3T5XA 4AWXB 4HF0A 3ZMTA 2FMLA 1YQAA 1DP7P 2ZMEB 3EQLF 1K6OA 1ZRCA 1KQ0A 1I1SA 1P2FA 5DV5A 1RZ4A 4A6VA 3BWGA 3F72A 1ZRDA 4XBFA 4HYEA 5CVJA 5HLIA 3MCZA 5D5VB 3SHFA 1S8NA 2VOOA 1IXCA 2HWVA 1TNTA 3HSFA 3KFWX 5DYMA 2E7XA 1G3TA 1LNWA 2VE8A 2X4HA 2PBIA 2EFQA 2G6PA 1MGTA 2G7UA 3PKAA 2V9VA 3RYRA 2G9WA 5DD4A 4KFCA 1AWCA 1BI0A 4F7ZA 4EM0B 2XAQA 3LAJA 1RI7A 1D3YA 3I4PA 4OOKA 4M74A 3I59A 2Z5UA 4A0XA 4FLKA 3KP6A 3ISPA 1HKQA 4ZYGA 2EJRA 2XHKA 3TOAA 3K1NA 1NHAA 3KE2A 4LG0A 1LQ1A 4IJAA 5HDKA 2FBKA 4HLYA 1ZLKA 1U5TA 5HDNA 3CUQA 2BYVE 1MD0A 5ERIA 1O57A 3EUHA 5DEQA 3IC7A 3KP3A 4NB5A 1FOKA 1HSTA 1MJAA 2JPCA 3FM3A 2A68F 5HS7A 4AIJA 1U5TB 4A0ZA 5CVVA 5E5BA 3L9FA 3W6JB 2O8XA 2EFOA 1SMTA 2K4BA 2Q8KA 5BQTA 1R23A 3FM5A 2O03A 1IRGA 3HYIA 5BMZA 1FBUA 1JGSA 3DFGA 3K1PA 2BB7A 3QU6A 3KZZA 1XGMA 3EYIA 3B73A 5D5WB 1J5YA 2PJPA 3ELKA 3ULQB 3J80Z 2PQ8A 5DD8A 2KIMA 2L4AA 1F9NA 5FD6A 3D0SA 2TDXA 1YVMA 2XIGA 4HW0A 2R7DA 5K5QA 4L9NA 1BIBA 1PP8F 2HTJA 1KYZA 3LA3A 4YFXF 3KEOA 2VC0A 4ZNGA 5L3GA 4G6DA 4QWQA 1BIAA 2XKPA 2HKOA 3S2WA 2V6CA 4Q4ZF 2QBYA 1QXZA 4UNOA 2DK8A 2X0LA 1TW3A 1GVJA 2GXGA 4WCGA 1GHCA 1O3TA 2GGBA 3FWEA 1FYLA 3LFKA 4R60A 5ILSA 1WN1A 2GU6A 2NNNA 2ZMEA 3LQQA 4MTEA 2BHCA 4S2RP 1P4XA 2GG9A 3QP6A 2GIVA 2ELHA 2R7FA 4MQ9F 1J2XA 5A2QZ 2QUFA 1U5TC 5ICFA 3DP7A 4QLCU 1FSEA 4LLLA 1MJ9A 5K1YA 3QPHA 4HV6A 4IDYA 2MA3A 3ZPLA 1FSHA 2EB7A 1WKMA 2EFNA 4FO7A 3F8BA 1XDUA 2VBXA 1EH7A 3CJNA 4RB2C 1HW2A 3BPXA 2CQKA 3JTGA 2HOWA 3PKDA 3BROA 3QU3A 5JR3A 1R1TA 4ENNA 1LB2A 2E1CA 4I7HA 2FE3A 2QVOA 2B3KA 3O2PE 4FX4A 4OU0A 1GXQA 3FXUA 2FF4A 5HVQC 4LG0B 2DT5A 1A04A 3U9GA 2GG2A 2P98A 2MLKA 3WGGA 1ON2A 4U6WA 4CYDA 5F1RA 1XDSA 2QQAA 2KJBA 2HFHA 2O3FA 4EGEA 3M8EA 1OR7A 2FNAA 4HOBA 1QXYA 2H94A 4Y15A 3GFIA 2KIUA 3GLXA 4O6JA 2BHDA 4D0PA 1LEBA 5LGUA 1BBYA 3ABUA 2GG7A 2M45A 4PV4A 2UXXA 4LD5A 1OPCA 1WL9A 1IXSB 4ZZDA 2FOKA 2WC2A 1BJAA 3TO9A 3DPTA 3PFIA 3I53A 1E17A 3MATA 5CJ9A 1FBSA 2ZJ2A 4UHTA 1O3SA 2JPBA 1IN4A 2P6SA 1W4MA 3WTYC 4U88A 3RKWA 1O0XA 1WLRA 4HDUA 2DAOA 4ZYDA 4U76A 2LF7A 2QWWA 4BHCA 4R79A 5D8LB 3ZN0A 1B9NA 2GG0A 3E6CC 3P9IA 2GA1A 1KU7A 5CDVA 3MEXA 2DQLA 2L4MA 5E1ZB 5ILVA 2IVMA 4MHGA 4U69A 2IA2A 2DU9A 2QQ9A 4OIPF 4OMYA 2M1BA 4E70A 5BS6A 3L09A 3WTZA 3VB2A 3K9TA 4L9TA 4OIQF 3Q6DA 4AIHA 1K78B 4RGZ1 5HLGA 5E17F 1P6RA 3WTWC 2STWA 1C22A 2XASA 2HDCA 4U7BA 2ESNA 3IWZA 5D4RA 3BPVA 4LK1F 4PGHA 4EJOA 4MATA 4FLJA 4EGZA 3FXQA 4XRFA 4IKTA 2CFXA 3GO5A 4FHTA 4ESJA 1S7AA 2B3HA 2GGCA 3I58A 1YFHA 4IVNA 4DNCA 4ENJA 4WWCA 4G6QA 3WU0A 3GW2A 4Q48A 5DUKA 2GTXA 4HQEA 5HS8A 2FBHA 1IXRC 5K5RA 4WXHA 2E7WA 2A07F 4HQMA 1KU9A 3T8TA 5ED4A 2D1HA 4BHBA 4EVIA 1S3JA 1Z7UA 3CB5A 2HEOA 3QPTA 3DXJF 3R4KA 1U8RA 4EV0A 1B1BA 1HSJA 1ON1A 4NHJA 3ZMUA 1IN6A 2NYXA 4FO8A 1XN7A 1P4AA 3KP2A 3TDUC 1CF7A 1B9MA 2OZUA 1HQCA 1Z91A 4GCVA 4IHTA 1XD7A 4P55A 3SQNA 4AIKA 3GF2A 3LA2A 4ZWUA 3VEPA 3R6SA 1H9GA 2A6HF 2G7HA 4A2UA 1W7VA 4KICA 2CO5A 1ONVA 3M8FA 3I59B 2D1VA 1XSXA 4RGRA 5EEHA 5CIKA 2VT3A 1IN5A 3T0YA 5E18F 1IRFA 1A16A 4G94A 2XAFA 1FLIA 1Z9CA 1YW9A 3H92A 4UVBA 2ZXJA 1D5VA 1C23A 4GYIA 4CGZA 2NQ7A 4U73A 2PFBA 4HF1A 3C7JA 2OAZA 4EQQA 1X3UA 3JTHA 2F5DA 3BITA 4U6ZA 1RUNA 4EM1A 4BHPA 1ZG1A 2GWRA 3MQ0A 3OV8A 2ISYA 1XCVA 3RKYA 1F5TA 1Y1NA 3IKVA 2M30A 2DW4A 1FT9A 5E8GA 2ZSGA 1KQ9A 1SD6A 1S7OA 3LA7A 3KP4A 5FB2A 2DO7A 1B6AA 3IL2A 2HR3A 2K27A 3KP5A 4OIOF 2AXLA 5D8KB 4MQVA 4CDGA
chains in the Genus database with same CATH superfamily
2ZJRF 2DPDA 1KZHA 2MYSA 1FEXA 3VODA 1LVKA 4UB8C 4DZJA 1FOXA 4A3KJ 3SZPA 4ANJA 1JT6A 3AG1H 4H4KC 1W0UA 1TWGJ 1LDDA 1OYIA 1MDMB 1OYYA 4OMZA 4KN4X 1C24A 1WI9A 1N75A 3I3LA 4A0YA 1USSA 3U1DA 5IP9J 2ZMEC 3LSMA 1V5GA 4YIIA 3RVAA 5DS9A 2D45A 2Z9OA 3OMYA 4NQWB 1WQ2A 4BJ5C 4PFPA 3HEFA 5JHFA 4LG3A 1WJDA 3ZMVA 4XSXF 1HW5A 3E3VA 4EJUA 5JHUA 2BHBA 2CSOA 2ZB9A 2I8DA 3HC7A 2CQQA 2LY1A 2MLGA 2XGDA 3CDIA 1H0MA 1IGNA 1YRNB 1XGOA 1LKXA 2Q94A 3CB6A 3E1SA 3S32A 3GLLA 1JKPC 1G3WA 2DK5A 5GTHC 3NWSA 1MBJA 1QQIA 5FRMA 1R9TJ 2CG4A 2DT7B 4F93B 1X1DA 3TB5A 1JUSA 3LSHA 3OIOA 3VDXA 3CO7C 1T08B 4QR8A 3FX3A 1TWAJ 1RR8C 1NG6A 1TL8A 5L3CA 5IY5H 1UELB 3I4NJ 1MNMC 1B59A 3F21A 3IG4A 1G8XA 2PN6A 1MNDA 1KU2A 1OJLA 2BHAA 2MFZA 3IU7A 1YS7A 2DOEA 4OAZA 3BG6A 3VOEA 4BDYA 1MZBA 5TRDA 2VKVA 1BI1A 2LK2A 4HXXA 3H5NA 2FNPA 1XX5A 3GYHX 1W1WE 3W6KB 3F0CA 1JTXA 3L2QA 2XPUA 3CP2A 2CUEA 5EZGA 2NXNB 2O9LA 5D6EA 4IHVA 2BY2A 1E0EA 1XGSA 2DYSH 1XPXA 4L0ZB 3LSTA 2GU4A 5EZHA 1K4SA 3OYIA 4V2GA 4KNYA 2KIFA 9ANTA 2JRTA 2E1OA 4C3IJ 3KZYA 4CUGA 2CQ7A 4MEYF 1ZAOA 3IRQA 5M3MJ 4B3XA 3PKCA 4FETA 1S6LA 1K83J 3SFZA 3F8CA 3IU9A 1BR4A 3HKZA 5B5EC 1QXWA 1R49A 2D2WA 3I56I 1YYVA 2Y0MA 4NC6A 5H6QA 4Z2YA 5EF6A 4FUKA 2Q96A 1QNTA 3HZJA 2FA5A 4KMUX 3LSIA 2V26A 3I64A 4IF4A 1W36D 3CZ6A 1WJAA 2FX0A 3DTEA 2RV8A 4NC8A 3IP4B 4I2OA 4KISA 3ZXSA 4M3BA 3PIPF 3WGHA 2E36A 3KEYA 4MO7A 3DTKA 1HDPA 4IRGA 4QPOA 2E1MB 1K79A 1FYKA 2DODA 5AIPA 1LFUP 5BPIA 2WY8Q 3REOA 1OCTC 2UWMA 3L2WA 3CMEI 1O7FA 3G1OA 4B1RA 2GXAA 2HYFA 1WVRA 3R60A 4LJZF 1QGPA 4YG2F 2LD5A 5CPRB 4BJTA 2RN7A 3BCAA 3TP3A 2DTRA 3SDBA 2JA6J 4G7OF 3J7AY 3OYBA 3CMYA 5HDGA 2RQPA 4CCLA 3HOTA 4C2UA 2FMYA 4XRMA 1FIAA 5DCFA 5J8CA 3ZN1A 3K4CA 1B8IA 1CF7B 2DBBA 4AVZA 1D1BA 4ZWOA 4UUTA 1YTYA 3GEZA 3F8MA 4E7SA 2RQQA 3FXJA 4ZDLA 2LBFB 1SVMA 5L3DA 2DXIA 5F04A 4ZYEA 3MVPA 1F36A 1OCRH 1T39A 1GUUA 5LRRA 3TAVA 2HKXA 3ZMDA 2COMA 1YX3A 2L7MP 4L5EA 1M1EB 4ENMA 3WODF 3TOBA 2R7ZJ 2GOMA 2PMHA 3R0AA 2EH3A 1W5TA 3GVAA 1WZ2A 2DA7A 1G3YA 2XF6A 2P5LC 4FX0A 1NK2P 4N4OB 2KKOA 3PFYA 4XM3A 1Q1VA 2E60A 1JE8A 4D5FA 2GBYA 1B72B 1PDNC 1JHFA 5E1XA 1BN5A 1BW6A 2ZJPF 1IUYA 3LWFA 4IHSA 4IF7A 1ENHA 1LDKB 3BTIA 2EWNA 2E71A 4E7LA 4RLQA 2P5VA 2OCCH 2ELJA 2GOXB 1VF9A 2Y48A 3RQ4A 4G7ZF 1ZKGA 1W7PA 3GCMA 1GVDA 5KAIC 3L7WA 1BI2A 2KPMA 3BIPA 3HOZJ 1TQPA 3PKBA 3DCFA 4S05A 4KM3A 3W3CA 3V42A 4YELA 2H6CA 2Z3YA 2RC4A 1L0OC 3M3YJ 4KN7X 1G2HA 5K7ZA 1VQOI 2BBYA 1KP0A 4E7JA 4UXNA 3M8JA 1QZYA 4I02A 4M73A 3VYUB 2VKHA 3Q0UA 2NAZA 4XR6A 3L2VA 1GXPA 4WK8F 3OOUA 2BVMA 3K0LA 3X2QH 4DQ2A 1XG1A 3OY9A 4IKUA 3OR2C 1MBGA 3R0JA 2BWUA 2R0QC 2ZXIA 2FBIA 3CC7I 2KDOA 5CQGA 1OMIA 2BVLA 4PJNA 2QSGX 3DTIA 4LB5A 4TV7A 2MATA 2ETHA 3L2CA 3GFLA 1R1VA 2FUG2 3M1EA 3HOUJ 4ZDOA 3RKQA 1FP1D 1Z05A 2QEXI 2P81A 2MC3A 3KLNA 3PKEA 2JUCA 3BTLA 3E0JB 1DUXC 4A3LJ 1ETKA 4O5VA 4DZPA 1TT5B 3K2ZA 4JBAA 3ZCOA 1HA8A 1EKEA 1OCCH 2DJIA 3V4GA 4ZTJA 4HX8A 2WADA 1T98A 1USTA 3HSRA 1P92A 4JK1X 1Y6IA 2CW8A 3QYBA 2VN2A 3HM5A 3NAUA 1FMWA 2X48A 4RAFA 1Y8QB 5H20A 4ZYHA 3F23A 1AKHB 4S2TP 4I76A 4FKCA 4A6WA 4BQNA 3KETA 3CF5F 3AL0B 1WJBA 1SEUA 4IHXA 1AA7A 1OCPA 2VBZA 2IEKA 3SYTA 3I9V2 5EDNA 1SD4A 4RA2A 2CQNA 2M4KA 1YLFA 2XRNA 3WHCA 2W82A 5F64A 5F08A 1W2MA 1FJLA 2OF7A 3M07A 1A5JA 3KP7A 3MWMA 3FBNB 1ZTRA 1U78A 2P8TA 2K9MA 3IAM2 2EIMH 3I5UA 4F92B 1ZRFA 2DFIA 3J7YJ 3DBLB 1R1UA 2R7OA 3HOSA 5M3FJ 3S1MJ 5E20A 3BQZA 1MJBA 3VPRA 3D5LA 1YIOA 2OQRA 3CMAI 1MSFC 1LFBA 1ZK8A 1I5ZA 4UVAA 1YJ3A 3HSEA 3CUQB 4MFEA 2J5OA 3G73A 4KIBA 3S1QJ 1J09A 3FK6A 3FZVA 1XTAA 2E1MC 3V7RA 2DMTA 2IT0A 3EUHC 5CDLA 2QENA 4I0AA 1ZGWA 2P7CB 1T95A 2WTEA 3GFMA 5JI6A 1JHHA 3HB9A 4U70A 1QRYA 4DYCA 3V7CA 3CCLI 2EVOA 2XSJC 3CCSI 2EPFA 4EM2A 4CCNA 3DPLC 1MMDA 2L5QA 2K9SA 2DFEA 3E5QA 1J75A 1VQMI 4B8XA 1IN7A 1H8AC 1V3FA 4MFDA 3LMMA 3ECOA 1JT0A 2MG4A 1MW7A 3NQOA 4BH9A 3FF5A 3MKWB 2R5YB 3OYMA 1YO5C 4FTHA 1YI2I 3CDHA 4HAMA 1R5GA 2LY2A 3TKYA 4E7IA 3PQJA 2BEOA 3L7GA 1LVAA 1AOYA 4U0YA 4M9SA 5GADJ 4BYYA 4FQGA 3CJRB 1T38A 2GLOA 1WY2A 1ETWA 4XLPF 2AO9A 3G1LA 2JSCA 3FKIJ 2L9NA 5IP7J 2LMDA 2DDAA 2LNBA 4GRIA 4XKWA 1R5HA 1PJRA 1ZG3A 2YS9A 1ACIA 3I54A 2WAEA 4EGYA 3C1DA 2M7AA 2X1EA 5FFXA 2LF8A 4XORA 2M87A 3NARA 2A05A 1I6HJ 2VONA 3SEQA 4A3MJ 3MN2A 3F3XA 1XB4A 1A35A 4RB0A 1UAAA 4AUXA 1WL6A 3PL8A 4ZC3A 4M6VA 2ECBA 3Q5FA 2YU9J 5K7HA 1AKHA 4F52A 4U6JA 1VTNC 2IGMA 1U9OA 3HL2A 2MABA 3MKLA 5EG0B 3JRBA 3E6BA 5JVTA 3JSOA 3OOPA 3A0HC 4Q5SF 3GMEA 1Z1DA 2XVCA 3WE2A 5EYRA 4IEJA 4XKBA 3WTUC 3QOEA 2XDVA 1I27A 2MH2A 1XCBA 2QQ8A 1MBFA 3OWTA 4PFOA 3TO7A 1TBXA 3JAMK 5L3FA 1AU7A 2GAUA 4A5MA 5C44J 2EZHA 1F4KA 1RIOH 4PGGA 4I99C 2P99A 4BBRJ 3FXKA 4ETSA 3HXLA 3Q3SA 1RKWA 4BE2A 1IC8A 3EETA 4S00A 1X1BA 4RM3A 3FHNA 2F5FA 4A12A 3V8JA 2KZVA 4F91B 2Y0SN 2F5CA 1WJCA 1JAWA 5DCMA 2RVCA 2HYGD 1FC3A 3BJOA 2EBIA 5LEJA 1K78A 4AYBA 3ERMA 1ZREA 1I3QJ 4P5OA 5FLXZ 2WV1A 5K5OA 1WH7A 4ZDPA 3VSLA 3E5XA 1C21A 2WA0A 4AM3A 1F43A 2M0CA 2DA1A 3R61A 2R4GA 2XGXA 3QP5A 2XPVA 4KT5C 4A69C 4IZZA 4D7MA 1YJ9I 3GZ5A 1FIPA 3E6DA 4LOCA 5FKLA 2OA4A 2R7QA 5IOZA 4S01A 4DJAA 2EV6A 2PG4A 4S04A 2QM3A 4HX7A 2JZYA 3WG9A 2XAGA 4A6DA 1R36A 3O8HA 5CVRA 3IKTA 2DPUA 4FLLA 5EEAA 1RRJA 4HBLA 1HKTA 3PQKA 2HGCA 4ZJZA 2XSDC 2M9HA 4P9FA 3S93A 1XMAA 1PVEA 2GQQA 1BI3A 1WSUA 4II2A 2I10A 4M6XA 3GTKJ 3CTZA 4JP0A 3HJEA 2LKPA 4XLAA 4ENKA 2EVCA 2VBWA 3ERED 3SZGA 2CV0A 3DQVC 3FBIB 3HHHA 3QYEA 2YUSA 4FT8A 4HZFA 5F6FA 3J7AO 2M4GA 2XPWA 2QBYB 4IRIA 3MFKA 1X1PA 1JTYA 4XN0A 2EK5A 1EJ9A 3JRCA 1MIJA 5AIQA 5LLQA 2WB1N 1D0YA 2BHZA 2FD5A 2EINH 5EG0A 5J6XA 1DDNA 3BP8A 1SD5A 2VQLA 2NNYA 2A3SA 2EIKH 3LNQA 1C0WA 2GZ5A 4F3QA 1SFOJ 1VQLI 4DGWB 2ZFWA 3SZTA 4CH7A 3FMRA 3BZKA 5IT3A 4XLNF 2JQ7A 2PLYA 3IRRA 3FKJA 3HG9A 4CSWA 1IN8A 3OR1C 2AS5F 3T1BA 1MDMA 1FTZA 1R4NB 2DA5A 5FRNA 2R5YA 2X6WA 4N0BA 4KYWA 3ROUA 2LG4A 2QYOA 4Z6YA 3TGNA 3WHBA 2EVMA 1VQKI 2FEZA 5BPDA 1X4PA 1TWHJ 2W1OA 3NEUA 1T2KA 3CCRI 3EYYA 3FIWA 2QZ8A 2YU3A 4XONA 2E2IJ 5FJ8J 4XLFA 2ACJA 2H6BA 2W48A 4XNFA 2CUZA 3V8LA 2GM4A 4RB1A 3FMSA 1RR7A 2P7VB 2VJIA 3QOPA 1A31A 2XGCA 1OKRA 2X1DA 2Y2ZA 3CQZJ 6PAXA 2BWXA 1EA3A 3M1CA 4Z7MA 4N9HA 3OYKA 5FCFA 1UG0A 2ZXWH 3S2DJ 1V4RA 4BXUA 3ASNH 3K10A 4RDUA 4P9UA 5D5XB 1FNNA 3QRFF 1CHMA 3DWLE 1T0FA 3HOYJ 4CYCA 5J8FA 3D27A 2GG3A 1B4AA 1PYVA 4JQFA 4U71A 3ZMSA 5LHHA 3WTVC 4EJVA 2O0YA 1K4TA 2C6YA 2K5CA 2JVGA 2V4JC 2YX4A 4BEHA 2Z33A 4BE0A 5GAHJ 1V5FA 2K9NA 1LDJA 3ABLH 3N05A 4YIFA 1IUFA 1KYWA 1FOWA 1O3RA 1AHDP 4E6KG 2NS0A 1D5YA 2QCOA 3HTSB 3K4MA 4PNCA 1R58A 4RB3C 2HDWA 1SANA 4ESBA 3FXRA 2KISA 4KIFA 2BW3A 1VQ5I 1QZZA 4HF2A 3H0DA 1FTTA 3BJ6A 1Z77A 2L01A 1MKMA 1JGGA 1ULYA 3ZOBA 4A3EJ 2EQRA 3S2HJ 2UZKA 2ADUA 1ZYRF 2XAUA 4JUQA 4IKFA 5C4XJ 4GXOA 3CJTB 4ZH4F 4KMFA 5BOXA 4IECA 1SMYF 4P1WA 2ZNYA 3BZ6A 3DEEA 1SFUA 4PUSA 3OYCA 1EH8A 3GFJA 1VQNI 1SFEA 1XGNA 4YIRX 1VQ7I 3J81Z 2L3DA 4IRHA 2GA2A 3DPUA 5HOOA 3CD6I 3RSNA 1XNZA 4LMYA 1WWXA 2JA7J 4U75A 1QO0D 5L3EA 1GV5A 4A3BJ 5ICGA 2K86A 4UUSA 4FISA 5LGTA 3IUOA 4PJLA 1IO2A 2DI3A 3ZP5A 2HZTA 2A61A 2WB1A 4Y17A 3SEZA 4ESFA 2ZNZA 3MZ8A 2EA2A 4U0VA 2AHQA 2HTSA 2K7LA 1TWCJ 4E7HA 3O8GA 1N78A 3CCUI 1Y56A 4X6AJ 2KT0A 4D1QA 1KU3A 2KP6A 3KLOA 2PJRA 1IAWA 5IT9K 2IA1A 5F27A 1OR7C 5FLMJ 1N25A 1R7JA 2ICWG 1DP3A 4PCQA 1JI8A 2CRGA 2XGEA 2AQEA 3WGIA 4KIGA 4M6YA 2IBDA 2A5YB 1OLTA 3OSFA 2HS5A 4UVCA 3JAMZ 2BGCA 2BN7A 4A6EA 3IHUA 3V7SA 2IS1A 3ML6A 1A36A 2GU5A 1E2XA 2VQGA 2MGQA 1S29A 2XAJA 4RAZA 3BR6A 2IJLA 3JRFA 3CCQI 2DDBA 1BR2A 2V3ZA 4RZYA 1OYWA 4BL0B 1W7PB 4KUMA 4RMNA 2OU2A 2LSOA 3A02A 1ZG5A 4GYGA 1TQMA 4C3HJ 4U6EA 4L9JA 3TQNA 2L9SA 2W24A 4B09A 1ZGAA 4CZZA 3CLOA 2E5NA 1VFCA 3K1MA 1RNLA 5J40A 4R8HA 1ETQA 4MIMA 2W7NA 1D8JA 3C2BA 5KNLA 2F4OB 3RIRA 4BDZA 3S15J 3ECHA 3HDDA 1EH6A 3FK7A 1W7PD 3RI4A 2Y30A 3UNGC 3BR0A 3DEWA 3RTRA 1JJ6C 1E3OC 1WJFA 2L0KA 2Y9YA 2VOPA 2OQGA 1Y1VJ 2DMPA 4S0HB 4I01A 5KVRA 2FU4A 4BAYA 3S14J 3CO6C 3DKXA 1W0TA 3QPSA 1HKSA 2BWSA 4RGUA 3Q9SA 2V3YA 1Q1HA 1GT0C 2IP2A 5FGMA 3BG7A 1JUPA 3ESWB 2CU7A 3WE3A 3TO6A 3H1CA 4J19A 4HSTA 2H8WA 3GTQJ 3CP8A 2R7RA 2NRAC 3DV8A 1KQ8A 2MBFA 2CYYA 4AD9A 4RS8A 4ZWPA 1J7KA 2X85A 1MATA 3CF2A 3J81K 1V5EA 2LFBA 2ECCA 4A3CJ 3P5JA 2TRTA 3DBRB 3F8FA 1QPMA 2V1DA 1MBKA 2VXZA 5A2QK 1S9HA 3ASOH 3MD2A 1ZR4A 2O6GE 2JN6A 1IZ1A 4I09A 3FXLA 2P5KA 5LHGA 2Q95A 1ZLJA 2R92J 2LDUA 2VJ5A 1ETOA 2G0EA 1XS9A 2E2JJ 1LUJB 3W2AA 5LEKA 1U3EM 1MNEA 2IW2A 2IPQX 4OIRF 2X6YA 1O3QA 2OV7A 1U9NA 1TQIA 2QGUA 2TCTA 3OL4A 2EZKA 4XKCA 1PUEE 1JUMA 1JJ8C 3IU8A 1YS6A 2GZWA 2LLKA 4J00A 4OOIA 2HVQA 5LBQA 4BQQA 2JK3A 3V8KA 4HSRA 3BCBA 4BQAA 3GWZA 3A0BC 2GU7A 5CNXA 1D8KA 2FSWA 4RM2A 3MMYB 3MKZA 2W00A 2YX7A 3WTXC 5FKKA 5B1BH 2F2EA 1TTYA 4KDPA 3BR3A 1N51A 4HLXA 3OS1A 3BDDA 2OTLI 4II3A 1UMQA 2E1NA 1UB9A 5DUIA 3PSFA 1YG2A 2DLLA 4H0EA 3S17J 3EPZA 4MEXF 4IU6A 2FQ3A 2Y75A 3IAS2 1RC9A 4UUSB 2VE9A 3HOXJ 2V3XA 2ME6A 4NQWA 3A1YA 3MZYA 5LRSA 4XSZF 2NVUB 4CICA 3ABTA 3ZQQA 2LYCA 4B43A 3TEDA 2VODA 4XK4A 3HRSA 4XN3A 2L9VA 5EEGA 2A69F 2E19A 1IW7F 3ZQGA 2XKOA 4B3AA 2J5PA 1RESA 2EFWA 1VI0A 1FBQA 1SFXA 4Y13A 4L18B 5LGNA 3OYAA 1HDDC 5DDGA 1FY7A 4KJZA 1VQ8I 2B63J 3O3KA 3AL0C 2P6TA 2LKXA 1VNDA 1HW1A 4IKRA 1SAUA 2L2OA 2FRHA 2DFHA 3TL4X 1FZPB 1RUOA 1J59A 2B3LA 4JX5A 1SAXA 3DEUA 3KEQA 4M71A 1QA6A 3EUKL 2JJ7A 2XB5A 3P9KA 3ZQ7A 5DM6F 3TDZC 3RYPA 2ISZA 5DCMB 2QSHX 3SDGA 4R1HA 2KJCA 2HQ5A 5ICEA 2ESHA 2E5ZA 2HQNA 2R3SA 2YSRA 1LJ9A 2CV1A 2CGPA 3CCVI 3CMMA 4RGSA 2VJJA 1FMVA 3S6BA 4IPAA 3LQRA 3G3ZA 5AONA 2OZ6A 1VQ6I 1UHMA 3PNTA 2CWEA 1QHGA 3CTAA 2XF5A 5F0HA 2Q93A 1YJNI 4IOAF 2K3PA 4MNUA 1W5SA 1ZH5A 2YPRA 3HTUA 1NTCA 1XSVA 1OCZH 3C18A 3H9JA 4JYKA 1POGA 2ZCWA 2B0LA 2H09A 2HQAA 2L7FP 2W84A 5E3MA 1BM9A 2ID3A 3OYDA 5CLSA 3SXYA 4HEA2 2KRFA 4WX9A 4ON0A 4GDFA 4UV9A 3F6OA 3L00A 1A6QA 1I50J 2BHYA 2BZTA 3GUDA 4BBSJ 1I6XA 1STZA 4MGRA 1UG2A 3BC8A 3TBIA 4LLGF 1FPQA 4U6CA 1WHUA 1Y1WJ 4D5CA 1TW2A 2IS4A 4RZZA 1QPIA 3WG7H 4PJJA 3RKXA 2XUBA 2DTZA 5M5WJ 1C27A 2X6OA 4LK0F 1R4MB 4HG2A 4Y4RA 3FMQA 4L9VA 4G7HF 1K7AA 2R7WA 1UZCA 3CUQC 2VXDA 5K7FA 3JSPA 1I1GA 5CDEA 5TGTA 3ZQLA 2A5WA 4I98B 3ZQIA 4DYQA 1LE8B 5FROA 3FHZA 2IAIA 3AG4H 4IXAA 1B8IB 3MR1A 2BH3A 4JOMA 5HLTA 2VB6A 3K4KA 4UV8A 3HUGA 2CQXA 3CLQA 3H9GA 2HZDA 2GG5A 3MZHA 2CW7A 5HNFA 2STTA 2XV4S 3JRAA 2K02A 4YFNF 4BU2A 4BY1J 1JKQC 3HBLA 4ASNA 1IDYA 3AAFA 1JKOC 4HX4A 2P9AA 4FLIA 4LFUA 1YX5A 2DCEA 1HXDA 3G6EI 2LP0A 4RGXA 1G6NA 4U1BA 2ZSHB 1BOAA 1TNSA 3IWFA 1ZHFA 2EILH 4LLNA 2F5EA 2VQCA 4Y33A 2KIQA 5GAGJ 1D1CA 3GZ6A 1IF1A 4CXFA 3H5AA 2BE5F 2CW0F 4EJWA 2L02A 3JW4A 4Y52J 3JRIA 2HDDA 4BS9A 2WAQA 2OD5A 1DU6A 1X3ZB 1D1AA 2RDPA 3HIFA 4CHUA 2FXAA 3OL3A 4PZJA 5E3NA 1VQ9I 1X3WB 4BEHB 2XAHA 4G12A 5FCHA 2VJ4A 2KFDA 2KDZA 3MAJA 5J47A 2RNJA 3NRVA 2VT2A 2BWVA 1W5CC 2GXBA 4AVPA 3D1NI 4CYCB 1TZLA 4EMSA 2OCEA 5KCMA 2RKHA 2R5ZA 2BWWA 1WBQA 1O7LA 4M72A 4HDVA 2QQBA 3J7ZI 2ZC2A 2PMUA 1KGSA 4XOTA 3JREA 1HBXG 1S5LC 1EV7A 2ZXHA 4WXCA 3I71A 2JT1A 1DPUA 3COAC 3LSGA 3WTTC 4GGGA 5GP9A 4WF2A 2CMPA 2YR2A 5EGOB 5CKTA 4A3IJ 2LC2A 2Q92A 3AFHA 2W85A 4A3FJ 1TC3C 1DPRA 3GXOA 3OYJA 3F6VA 2NVXJ 5HS9A 3H3ZA 3LFUA 4PSWA 4WXDA 1LEAA 1YJWI 3AG2H 1PUFB 4A93J 1UHWA 3L24A 3HKZN 2H1LA 4C3JJ 5ICCA 5EGOA 3BOQA 1M35A 1J9IA 1G4DA 2M3AA 3PNVA 4G9YA 4GO1A 1YOVB 3VYRB 1H9TA 5FO5A 1F1ZA 2IW5A 3H3UA 3Q9VA 2OKNA 1H89C 3ZGKA 3GBGA 3HHGA 3K4JA 4OINF 3O6BB 4YRVA 3BQYA 5CYVA 2W25A 1A6IA 2DT6A 5TJJA 2EA4A 4HA8A 5H6RA 4EATA 2EV5A 5CVIA 4M3EA 3N4MA 4UY8I 3HRMA 2JTVA 3W2VA 3KX2A 1FX7A 2KRCA 2ZBKA 3WTSC 2VBYA 2HPMA 3PSIA 3I0TA 1PP7U 1X1AA 2LKSA 2RGVA 4HPQA 3ZRGA 4U7DA 4M9XA 1PV9A 1MBHA 1P4WA 2NQ6A 1BC8C 1XSDA 3PO2J 3G71I 4ABZA 2HOAA 4MTDA 5ILUA 2Z99A 4NC7A 3P9CA 3U2RA 1K61A 1ORKA 2K3FA 5D4SA 4L5JA 5JLWA 3CCMI 1SC7A 2PMZN 5L3BA 1U6GA 1UFMA 3BY6A 3H5RA 4UUVA 5FLXK 5FFZA 1TLHB 2X1CA 3T8RA 2QLZA 2N8GA 2BXYA 1ZELA 3CC2I 4X1EA 3KYLA 3HPHA 5E3OA 2IA0A 1U0JA 3BJAA 2M8EA 1T56A 2WV0A 2HOTA 2BWYA 2VPLA 4XRSA 2QF7A 2IS6A 3K4BA 4CCOA 4PDKA 2F4MB 3A03A 3W6VA 2K85A 2K4JA 5JFRA 1B72A 3A2KA 3C3WA 3DF8A 2O61A 1YW8A 1ZN2A 4XLCA 1T6SA 4EJTA 5CVUA 4G8XA 1R6RA 4YEJA 3MX6A 4FASD 1JKRC 3DKWA 3G1MA 4A5NA 1FWZA 1MBEA 3OIPA 4IL6C 2P4WA 2F5VA 3RORA 1BC7C 5C4JJ 4NBQA 4Y7NJ 3D5SC 4N9IA 2KRHA 2BY3A 2IGKA 2V1NA 1FP2A 3GTJJ 2UXNA 1BL0A 2QA4I 3F22A 1WRJA 4MQVA 3EDPA 4I0BA 5LHIA 1ETVA 2HOEA 5HLHA 2XC7A 3E6MA 2L54A 2DQRA 2H27A 3CCYA 2BV6A 1HCRA 3H3VK 5CE6A 2OBPA 4RAYA 3KIOA 1R00A 1J0RA 2ID6A 4HNUA 3VFZA 1ODDA 4Q47A 4M3GA 3RCOA 2V79A 5B66C 1SD7A 2GG8A 4HNVA 1ZARA 2M8GX 4QIWN 2IRFG 4IKSA 2M5WA 4B28A 1ZGJA 1DGWY 1Y39A 4PJ0C 2VASA 1REPC 1JXSA 4AU7A 1V54H 1X58A 3RDIA 1U2WA 3B6AA 2V1XA 2WWYA 1Z67A 1Z6TA 2JMWA 4RLFA 1QBJA 4W97A 4E4HA 2W57A 2I5UA 3LSPA 3H36A 3OS0A 1OFCX 2MH9A 4J01A 3CDLA 3OS2A 3NWTA 4L0YB 1CGPA 2XROA 2V1UA 3BTCA 1R22A 2VI6A 1R5ID 2CFOA 3LAPA 2EFPA 2PI0A 3GX4X 2EV0A 3QPLA 3P7NA 2LOOA 2FQ4A 3HRTA 3QYFA 2KLOA 5D6FA 4U0WA 2RNGA 3L1PA 4C30A 3B02A 1BOBA 3OIQA 4M9ZA 3RPQA 3VSKA 5FLVA 3S1NJ 3WU1B 2BWTA 2LREA 3RJPA 2A6EF 4IO9F 3BR5A 2X6XA 3SFIA 1IRXA 2Q2EA 1QZEA 3E5UA 1YRNA 1X1CA 4P96A 2HQRA 2LH9A 2HVSA 5E3LA 1Y0NA 3BIQA 3DLAA 4XMYA 1Z6RA 5FD5A 2XF7A 1YW7A 4LB6B 5E8IA 1H88C 2PEXA 1SVOA 1XMKA 4BNCA 3HRUA 3HOVJ 2ZFUA 2ZO4A 2K9QA 5GPCA 5D5UB 1FYMA 2CS3A 3M9AA 4CO8A 3BR2A 4PJMA 2QSFX 2MD5A 3E97A 1IV6A 4LGWA 2XRLA 4O3MA 5GAEJ 3F8NA 1Y0UA 3QAHA 4K2EA 2Y69H 3PUBA 4KA4A 2UUZA 2FOWA 1KA8A 3KCCA 1L3LA 1UCRA 3CUOA 3M7GA 3ZMZA 3JCUC 2VLAA 1GLNA 2BY1A 1ERDA 1ETYA 2ZKZA 4YFKF 1PUFA 3LL7A 1TT0A 3K69A 5IT9Z 1S7EA 3N97A 5TISC 2DA4A 3J80K 5KK1A 1G3SA 4ZZLA 1N77A 2JVHA 4L5IA 3FXOA 4HV5A 1HC8A 1SVLA 2VC1A 5GPAA 5E1WA 3RPUA 3T5XA 4AWXB 1LPQA 5J4VA 4HF0A 2MW8A 2FMLA 3ZMTA 5DTDA 3SJMA 1YQAA 3C2HA 1DP7P 2ZMEB 4XIDA 3EQLF 1K6OA 2QKMB 1ZRCA 1KQ0A 1I1SA 1P2FA 5DV5A 2JA2A 1RZ4A 5IYBJ 3OYHA 4A6VA 3BWGA 3F72A 3RQIA 1ZRDA 3G2BA 4XBFA 4HYEA 5CVJA 5HLIA 4IOCF 3MCZA 5D5VB 2WAQN 3SHFA 3K7AJ 2JWTA 1S8NA 3GTLJ 1OCOH 2VOOA 3IH2A 1T8IA 1IXCA 2HWVA 2DFFA 1TNTA 4CCMA 4JX4A 2JUGA 3HSFA 3KFWX 5DYMA 2E7XA 4E7ZA 1HOMA 1G3TA 1LNWA 2VE8A 2JRMA 2X4HA 2PBIA 3A4CA 3BG5A 4BUPA 3LSRA 2EFQA 2G6PA 5GTIC 1MGTA 2BW3B 2G7UA 3PKAA 3KYCB 3BT9A 1HF0A 2V9VA 2E2HJ 3RYRA 1IDZA 4OWRB 4OAYA 1R71A 4XQFA 2G9WA 3OYLA 5DD4A 4KFCA 1AWCA 1BI0A 1YIJI 4A3DJ 5FKOA 4F7ZA 4EM0B 2XAQA 3LAJA 1MMSA 1RI7A 5J1RA 1TWFJ 2R7TA 1D3YA 1WFXA 3I4PA 4OOKA 4M74A 3I59A 2Z5UA 1FOYA 1X2NA 1MSEC 3K2AA 4A0XA 3KP6A 3CCJI 4FLKA 3FISA 2VPRA 3ISPA 3TW7A 1HKQA 2VQHA 4ZYGA 2OPTA 5IYDJ 2EJRA 2XHKA 3TOAA 3I55I 3ZQFA 3QODA 3K1NA 1NHAA 2CUFA 3KE2A 4FE7A 1QU3A 3F9KA 3K4LA 4LG0A 5F1JA 1X2MA 1LQ1A 4IJAA 5HDKA 3G4SI 2FBKA 4HLYA 1ZLKA 5HODA 1SFKA 1U5TA 3H35A 4M3FA 3CUQA 5HDNA 2BYVE 5FKMA 1MD0A 1Z0XA 5ERIA 1O57A 3EUHA 1G59A 4DW6A 5DEQA 3IC7A 3HGYA 1VZ0A 3KP3A 4UB6C 4XLHA 4NB5A 1FOKA 2XB0X 2B7EA 1HSTA 1MJAA 2JPCA 1WJEA 5B1AH 3FM3A 2LY9A 2A68F 5HS7A 4AIJA 1U5TB 4A0ZA 5CVVA 5E5BA 3L9FA 2VIXA 3W6JB 2O8XA 2EFOA 1SMTA 1E3HA 2K4BA 2Q8KA 5BQTA 1R23A 3S16J 3FM5A 2OUMA 2O03A 2NOGA 1GV2A 3ABKH 1IRGA 3HYIA 5BMZA 1FBUA 1JGSA 3DFGA 3K1PA 3W2WA 1D0ZA 3I4MJ 2BB7A 3QU6A 3KZZA 3AG3H 1XGMA 2MD0A 2O8KA 3LOCA 4PSXA 3EYIA 3B73A 3UR3C 5D5WB 2LVSA 1J5YA 2PJPA 3BG9A 3ELKA 3ULQB 3J80Z 2HI3A 3DU6A 2PQ8A 5DD8A 2X51A 4F55A 2KIMA 2P0WA 2VUMJ 1MMAA 4Y3OA 2L4AA 1F9NA 5FD6A 1WCMJ 3VWBA 3D0SA 3DU5A 2TDXA 2LTPA 4BGDA 1YVMA 2GIZA 2XIGA 3IH4A 4HW0A 1E3PA 2R7DA 5K5QA 4L9NA 1BIBA 1PP8F 3KYDB 1IG7A 2HTJA 2M2EA 3PIOF 1HLVA 4DOZA 1KYZA 2DN0A 2IGNA 3LA3A 4YFXF 4V19K 3KEOA 5IYCJ 2VC0A 1OQYA 3Q0WA 4ZNGA 5L3GA 4G6DA 2OC6A 4QWQA 1BIAA 2XKPA 2IGOA 2HKOA 3S2WA 2D5VA 3DLLF 2V6CA 4Q4ZF 4RAGA 4IX7A 3ZQHA 3K6GA 2QBYA 1QXZA 2L9RA 2LR8A 4UNOA 2DK8A 2X0LA 1TW3A 1GVJA 2GXGA 4WCGA 1U8BA 1GHCA 3OYGA 2O5RA 1O3TA 2GGBA 3FWEA 1FYLA 4HRIA 4A3GJ 3LFKA 4R60A 5ILSA 1WN1A 2GU6A 2AQFA 2NNNA 1LE8A 2ZMEA 3DBHB 3LQQA 4MTEA 2BHCA 3BG3A 4S2RP 4G6TB 1WI3A 1P4XA 2GG9A 3QP6A 4CZCA 2GIVA 2ELHA 2O7OA 2R7FA 4MQ9F 1J2XA 5A2QZ 2QUFA 1U5TC 4CA0A 3A01A 5ICFA 2V9PA 3L2UA 4XICA 2CJJA 3DP7A 4QLCU 1MMNA 3TMOA 1K6YA 1FSEA 2DA3A 2CUJA 4LLLA 1MJ9A 2R7SA 3BLYA 5K1YA 1RPWA 3QPHA 4HV6A 1Z3YA 4IDYA 3GZNB 5JVGF 2MA3A 3HPGA 3ZPLA 1FSHA 4M3DA 1MMGA 2EB7A 1WKMA 2V9KA 1DQUA 2EFNA 5IOYA 2Q2EB 2HPIA 4FO7A 3F8BA 1XDUA 3ZQCA 2VBXA 2DA2A 4BKXA 3MKYB 1EH7A 3CJQB 3CJNA 3VYTB 4RB2C 2L7ZA 1HW2A 3BPXA 2CQKA 4B4CA 1Z7LA 1ITYA 3JTGA 4BXXJ 5IPAA 2HOWA 1NH3A 3GTPJ 2KMUA 2HVRA 4E7KA 1DGRM 3PJRA 3PKDA 4C9YA 3JRHA 3BROA 4BY7J 3QU3A 5JR3A 1R1TA 1QVTA 2HNHA 2Y31A 4DBRA 4ENNA 1X19A 1LB2A 4QSHA 2E1CA 2IS2A 5KAFC 4I7HA 3WU2C 2FE3A 2QVOA 2DMNA 2KZGA 2B3KA 5BNGA 3O2PE 3ZR8X 4OU0A 4FX4A 1GXQA 1XMXA 2DMUA 4XOPA 2ME0A 2FF4A 2PMZA 3FXUA 5HVQC 2DT5A 4LG0B 1A04A 3U9GA 1WPKA 2GG2A 2P98A 2MLKA 3WGGA 1ON2A 2WY7Q 1TP4A 4CYDA 4U6WA 5F1RA 3K4NA 3RPUD 4BQOA 1XDSA 1NG7A 2VKDA 4XL9A 1UHSA 2QQAA 2KJBA 4DBQA 2HFHA 2O3FA 4EGEA 1W36C 3M8EA 1OR7A 2FNAA 4HOBA 1QXYA 2H94A 5F0FA 5H2FC 4JX6A 5KHDA 3GTGJ 1D0XA 3ONQA 4Y15A 3GFIA 2V7FA 2KIUA 2VL8A 2JA8J 3GLXA 4O6JA 2BHDA 1ETXA 4D0PA 1KONA 1LEBA 5LGUA 1BBYA 4LIUA 5CQEA 3ABUA 1WH5A 4GFBA 2GG7A 2M45A 4PV4A 2UXXA 4LD5A 5HNHA 4I6ZA 1OPCA 4U87A 4LITA 1IXSB 1WL9A 2NVTJ 2L7KA 4BJ6C 5LFAA 2WBMA 4ZZDA 1X4OA 3TW6A 1WJ5A 2FOKA 2DOAA 1BJAA 2WC2A 1P7IA 3LSKA 5M5YJ 3TO9A 3DPTA 2WAFA 3PFIA 3I53A 1E17A 1GDTA 3MATA 3S3OA 5CJ9A 4B44A 1S72I 1FBSA 2ZJ2A 4UHTA 1O3SA 2JPBA 3PO3J 5E79C 2E35A 1IN4A 3KZIC 2OJED 2P6SA 1W4MA 3WTYC 2VKEA 4U88A 2RREA 3RKWA 3CCEI 1O0XA 3E7LA 1WLRA 3PNYA 3UKGA 4HDUA 2DAOA 3OYFA 4ZYDA 4U76A 2LF7A 2QWWA 2COBA 4BHCA 4R79A 1Z21A 4X0GA 5D8LB 3S8PA 4CCJA 3ZN0A 1B9NA 4QPQA 2GG0A 2M0MA 3E6CC 3DKYA 2R7VA 3P9IA 2F6CA 4ZTFA 2ELKA 2GA1A 1KU7A 3L2RA 2EZIA 2DYRH 3MEXA 2Q1ZB 5CDVA 4CCKA 3LSJA 3S3NA 2DQLA 1VQ4I 2L4MA 2QKLB 5E1ZB 1I39A 5ILVA 2IVMA 4MHGA 4U69A 2IA2A 2DU9A 2QQ9A 4OIPF 4OMYA 1P7JA 2M1BA 4E70A 5BS6A 4C2MJ 5FKNA 3L09A 3WTZA 2NS7A 3VB2A 1OISA 3EUAA 2M34A 3K9TA 1CQTA 4L9TA 2HXOA 4OIQF 3Q6DA 4A3JJ 4AIHA 1K78B 1YE9A 3QQAA 3C2GA 2H1KA 4RGZ1 2R93J 4BACA 5HLGA 5E17F 1P6RA 3WTWC 2STWA 5F0CA 1IJWC 1C22A 2XASA 2HDCA 4U7BA 5J3LA 2ESNA 2E34A 3IWZA 1I3AA 2NS8A 4KT6A 5D4RA 2Z2SB 4HNTA 3BPVA 2PX9A 4LK1F 4MLOA 4PGHA 2EIJH 2B9SA 3Q0VA 4EJOA 3RZDJ 4MATA 3HUGB 4FLJA 5C3EJ 4EGZA 3FXQA 4XRFA 4IKTA 2CFXA 2MC4A 3GO5A 4FHTA 4ESJA 1ZQ3P 1S7AA 2B3HA 4BE1A 2GGCA 2R7XA 1Z3XA 2F48A 3BTJA 3I58A 1YFHA 4IVNA 4DNCA 4ENJA 3GTOJ 4WWCA 1QVUA 2Z16A 4XKVA 3TP0A 1UJ8A 4G6QA 3WU0A 3GW2A 4Q48A 2M7BA 5DUKA 2GTXA 3IH3A 5HS8A 3A01B 4HQEA 2IXSA 3B6CA 2FBHA 1V55H 2HYJA 1IXRC 5EJCA 3KPHA 5K5RA 4EEFG 4WXHA 2EZLA 2E7WA 2A07F 4HQMA 1XC5A 1RKTA 1KU9A 2F4IA 1DU0A 4C2TA 3GTMJ 3T8TA 2DOFA 5ED4A 2D1HA 1MH3A 4D7NA 4BHBA 4B47A 4EVIA 3JRDA 3BR1A 3PM1A 2JA5J 1S3JA 4N4NB 1Z7UA 3IV5A 3CB5A 4PK4A 2HEOA 3QPTA 4AYBN 3DXJF 2R7UA 2LRDA 3R4KA 1YITI 1U8RA 2MSYA 4EV0A 3BZCA 1B1BA 4KITB 2RAEA 1HSJA 1ON1A 2K40A 2ZJQF 4XLEA 4NHJA 3ZMUA 1YHQI 1IN6A 5J4YA 2CV2A 2NYXA 4FO8A 4LIVA 3HOWJ 1XN7A 1P4AA 2Y0SA 3KP2A 3TDUC 1CF7A 1B9MA 5IP6A 2OZUA 1HQCA 1Z91A 4GCVA 4IHTA 3S3MA 2BXZA 1XD7A 4P55A 3SQNA 3U21A 4AIKA 3GF2A 3LA2A 4ZWUA 3QWLA 4AC0A 4NUBA 3VEPA 5DM7F 3R6SA 1H9GA 4ZYAA 4IHWA 5J1YA 2A6HF 2AXTC 2G7HA 4A2UA 1MH4A 4KICA 1W7VA 5M5XJ 2CO5A 2HU9A 2DJNA 3JRGA 2NVYJ 1ONVA 3M8FA 4RBOA 3I59B 2D1VA 1XSXA 2Y9ZA 5JLXA 3VYSB 4FCYA 4RGRA 2V6EA 4IHYA 5EEHA 3ABMH 2KL4A 5CIKA 2BY0A 2VT3A 2H8RA 1IN5A 2UV1A 1EF4A 3T0YA 1Y8RB 5E18F 1IRFA 1A16A 2HXIA 1VQPI 4G94A 1BR1A 2XAFA 5J1UA 1FLIA 3OSGA 3K70D 4NDLA 1Z9CA 4BXFA 1YW9A 3H92A 3JR9A 4UVBA 2ZXJA 1D5VA 2X9DA 3AKZA 5LD2C 2PJRB 3RZOJ 2CH0A 1C23A 4GYIA 4CGZA 2NQ7A 1RETA 1IRZA 4U73A 2PFBA 2HOSA 4HF1A 1NK3P 1BW5A 3C7JA 4XRSG 2DA6A 2OAZA 2JSPA 3S1RJ 1LFPA 4EQQA 1X3UA 4IQJA 3JTHA 2F5DA 3BITA 2A6TA 1WGXA 2W4SA 4U6ZA 1RUNA 1O4XA 4DIQA 1ZR2A 3U1KA 5B3SH 4EM1A 3FXMA 3FDYA 3PUFA 1P9QC 4B48A 4BHPA 1APLC 3CC4I 1ZG1A 3H0GJ 3H9QA 1QHHD 2GWRA 4QTRA 2KHMA 3MQ0A 3OV8A 3M4OJ 2ISYA 1XCVA 2Z1DA 4ITVA 2K9LA 2LBFA 3RKYA 1F5TA 1Y1NA 4NNJA 2NOJB 1BA5A 3IKVA 1BJZA 2M30A 2DW4A 2KQRA 4IQ4A 1FT9A 4FE4A 1IV8A 2R5ZB 3D5RC 2ZSIB 3K70C 5E8GA 4V2FA 4DYRA 2ZSGA 2BOLA 1KQ9A 1SD6A 3CESA 1S7OA 2DMQA 3LA7A 3OYEA 4D9JA 2OTJI 2NVQJ 3KP4A 1T33A 5FB2A 3OYNA 2DO7A 1B6AA 4W1UA 3IL2A 1T0FC 2HR3A 2K27A 3KP5A 4AIDA 4OIOF 2AXLA 5D8KB 2FJ1A 2Q0OA 3HGGA 4CDGA
chains in the Genus database with same CATH topology
2DPDA 3VODA 3SZPA 1LDDA 1OYIA 1MDMB 1OYYA 4OMZA 4KN4X 1C24A 1WI9A 4A0YA 1USSA 3U1DA 4YIIA 3RVAA 2D45A 2Z9OA 1WQ2A 3ZMVA 4XSXF 1HW5A 3E3VA 4EJUA 5JHUA 2BHBA 2CSOA 1H0MA 2MLGA 3CB6A 2Q94A 1XGOA 1G3WA 2DK5A 1QQIA 2CG4A 3TB5A 3CO7C 4QR8A 3FX3A 5L3CA 1B59A 3F21A 3IG4A 2PN6A 1KU2A 2BHAA 3IU7A 1YS7A 3VOEA 1MZBA 5TRDA 1BI1A 4HXXA 2FNPA 3GYHX 3W6KB 5D6EA 1XGSA 4L0ZB 3LSTA 2GU4A 4KNYA 2KIFA 2JRTA 3KZYA 4MEYF 1ZAOA 3IRQA 3PKCA 1S6LA 3SFZA 3F8CA 3IU9A 1QXWA 2D2WA 1YYVA 2Y0MA 5H6QA 4Z2YA 4FUKA 2Q96A 1QNTA 2FA5A 4KMUX 3I64A 4IF4A 2RV8A 4I2OA 3WGHA 4IRGA 1K79A 1FYKA 5AIPA 5BPIA 3REOA 2UWMA 1O7FA 2HYFA 3R60A 4LJZF 1QGPA 4YG2F 2RN7A 2DTRA 4G7OF 5HDGA 2RQPA 3HOTA 2FMYA 5DCFA 5J8CA 3ZN1A 1CF7B 2DBBA 4ZWOA 1YTYA 3GEZA 3F8MA 5L3DA 4ZYEA 1T39A 5LRRA 3TAVA 2HKXA 3ZMDA 2COMA 4ENMA 3WODF 3TOBA 2PMHA 3R0AA 1W5TA 3GVAA 1G3YA 2P5LC 4FX0A 2KKOA 1JE8A 1PDNC 1JHFA 5E1XA 1BN5A 1IUYA 3LWFA 4IHSA 4IF7A 1LDKB 2EWNA 2P5VA 2Y48A 4G7ZF 1W7PA 3L7WA 1BI2A 3BIPA 1TQPA 3PKBA 4S05A 4KM3A 2H6CA 2Z3YA 2RC4A 1L0OC 4KN7X 2BBYA 1KP0A 4UXNA 1QZYA 4I02A 4M73A 1GXPA 2NAZA 4WK8F 3K0LA 4DQ2A 4IKUA 3R0JA 2BWUA 2FBIA 1OMIA 4LB5A 4TV7A 2MATA 2ETHA 3L2CA 3GFLA 1R1VA 3M1EA 1FP1D 1Z05A 2MC3A 3KLNA 3PKEA 1DUXC 4O5VA 3K2ZA 4JBAA 3V4GA 4HX8A 1T98A 1USTA 3HSRA 1P92A 4JK1X 2VN2A 4ZYHA 5H20A 3F23A 4S2TP 4FKCA 4A6WA 3KETA 2VBZA 1SD4A 1YLFA 2XRNA 5F64A 1W2MA 3KP7A 3MWMA 1U78A 2P8TA 3I5UA 1ZRFA 2DFIA 1R1UA 3HOSA 5E20A 1MJBA 3D5LA 1YIOA 2OQRA 1YJ3A 4UVAA 1I5ZA 3HSEA 3CUQB 2J5OA 3G73A 4KIBA 3FZVA 3V7RA 2IT0A 5CDLA 2QENA 4I0AA 2P7CB 2WTEA 3GFMA 5JI6A 1JHHA 4U70A 3V7CA 2EVOA 4EM2A 3DPLC 3E5QA 1J75A 4B8XA 1IN7A 1V3FA 3ECOA 3NQOA 4BH9A 3FF5A 1YO5C 3CDHA 4HAMA 1R5GA 3TKYA 3PQJA 2BEOA 3L7GA 1LVAA 1AOYA 4U0YA 4M9SA 4BYYA 1T38A 1WY2A 4XLPF 2JSCA 2LNBA 1R5HA 1ZG3A 3I54A 4EGYA 3C1DA 5FFXA 2LF8A 2M87A 2VONA 3F3XA 1XB4A 4RB0A 1WL6A 3Q5FA 2Q0OA 4U6JA 1VTNC 3E6BA 5JVTA 3JSOA 3OOPA 4Q5SF 1Z1DA 2XVCA 3WE2A 3WTUC 1I27A 2MH2A 1XCBA 3JAMK 1TBXA 3TO7A 5L3FA 2GAUA 4A5MA 1F4KA 1RIOH 4PGGA 2P99A 4ETSA 3EETA 4S00A 2F5FA 4A12A 3V8JA 2F5CA 1JAWA 5DCMA 2RVCA 2HYGD 1FC3A 3BJOA 5LEJA 1K78A 1ZREA 4P5OA 5FLXZ 5K5OA 3E5XA 1C21A 4KT5C 3R61A 2XGXA 3QP5A 3GZ5A 3E6DA 2OA4A 4S01A 2EV6A 4S04A 2PG4A 2QM3A 4HX7A 2JZYA 3WG9A 2XAGA 4A6DA 1R36A 5CVRA 3IKTA 2DPUA 4FLLA 4HBLA 1HKTA 3PQKA 2HGCA 4P9FA 1XMAA 2GQQA 1BI3A 1WSUA 4M6XA 3CTZA 2LKPA 4ENKA 2EVCA 2VBWA 3ERED 3DQVC 3HHHA 4FT8A 4HZFA 5F6FA 3J7AO 2QBYB 4IRIA 3MFKA 2EK5A 5AIQA 5LLQA 5J6XA 1DDNA 3BP8A 1SD5A 2NNYA 2A3SA 1C0WA 2GZ5A 2ZFWA 3SZTA 3FMRA 5IT3A 4XLNF 2PLYA 3IRRA 1IN8A 2AS5F 3T1BA 1MDMA 4N0BA 4KYWA 3ROUA 2QYOA 3TGNA 2EVMA 2FEZA 5BPDA 3NEUA 1T2KA 3EYYA 2QZ8A 2YU3A 2ACJA 2H6BA 3V8LA 4RB1A 3FMSA 2P7VB 3QOPA 1OKRA 6PAXA 2BWXA 4Z7MA 4N9HA 5FCFA 1V4RA 4BXUA 4P9UA 5D5XB 1FNNA 3QRFF 1CHMA 1T0FA 3D27A 5J8FA 2GG3A 1B4AA 4JQFA 4U71A 3ZMSA 5LHHA 3WTVC 4EJVA 2O0YA 2C6YA 2YX4A 2Z33A 1LDJA 4YIFA 1KYWA 1O3RA 2NS0A 4PNCA 3HTSB 1R58A 4RB3C 4ESBA 3FXRA 4KIFA 1QZZA 4HF2A 3BJ6A 2L01A 1MKMA 1ULYA 2UZKA 2ADUA 1ZYRF 4JUQA 4GXOA 4ZH4F 4KMFA 5BOXA 4IECA 1SMYF 2ZNYA 3BZ6A 1SFUA 1EH8A 3GFJA 1SFEA 1XGNA 3J81Z 2L3DA 4IRHA 2GA2A 5HOOA 1XNZA 4LMYA 1WWXA 4U75A 1QO0D 5L3EA 5ICGA 2K86A 5LGTA 2DI3A 3ZP5A 2HZTA 2A61A 4Y17A 4ESFA 2ZNZA 2EA2A 4U0VA 2K7LA 2HTSA 1KU3A 3KLOA 1IAWA 5IT9K 2IA1A 1R7JA 4PCQA 3WGIA 4KIGA 4M6YA 2A5YB 2HS5A 4UVCA 3JAMZ 2BGCA 2BN7A 4A6EA 3IHUA 3V7SA 3ML6A 2GU5A 1E2XA 1S29A 2XAJA 4RAZA 2IJLA 2V3ZA 4RZYA 1OYWA 1W7PB 4KUMA 2OU2A 2LSOA 1ZG5A 4GYGA 1TQMA 4U6EA 3TQNA 4L9JA 2W24A 4B09A 1ZGAA 4CZZA 3CLOA 3K1MA 1RNLA 4R8HA 1D8JA 3RIRA 3ECHA 1EH6A 1W7PD 3RI4A 3RTRA 2VOPA 2OQGA 4I01A 5KVRA 2FU4A 4BAYA 3CO6C 1HKSA 2BWSA 4RGUA 3Q9SA 2V3YA 1Q1HA 2IP2A 5FGMA 3WE3A 3TO6A 2NRAC 3DV8A 1KQ8A 2MBFA 2CYYA 4AD9A 4RS8A 4ZWPA 1J7KA 1MATA 3J81K 3F8FA 1QPMA 2V1DA 2VXZA 5A2QK 2O6GE 1IZ1A 4I09A 2P5KA 5LHGA 2Q95A 1ZLJA 2LDUA 2IW2A 5LEKA 1U3EM 2IPQX 4OIRF 1O3QA 1TQIA 1PUEE 3IU8A 1YS6A 2GZWA 4OOIA 5LBQA 3V8KA 4BQAA 3GWZA 2GU7A 5CNXA 1D8KA 2FSWA 2YX7A 3WTXC 2F2EA 1TTYA 4KDPA 1N51A 4HLXA 3BDDA 2E1NA 1UB9A 5DUIA 2DLLA 1YG2A 4H0EA 4MEXF 4IU6A 2FQ3A 2Y75A 2VE9A 2V3XA 4NQWA 3MZYA 5LRSA 4XSZF 4CICA 3ABTA 2VODA 3HRSA 5EEGA 2A69F 1IW7F 2XKOA 2J5PA 2EFWA 1FBQA 1SFXA 4Y13A 4L18B 5LGNA 5DDGA 1FY7A 3O3KA 2P6TA 1HW1A 4IKRA 2FRHA 1FZPB 1RUOA 1J59A 2B3LA 1SAXA 3DEUA 3KEQA 4M71A 3P9KA 3ZQ7A 3TDZC 3RYPA 2ISZA 5DCMB 4R1HA 2KJCA 5ICEA 2ESHA 2HQNA 2R3SA 2YSRA 1LJ9A 2CGPA 4RGSA 3S6BA 4IPAA 5AONA 3G3ZA 3LQRA 2OZ6A 1UHMA 2CWEA 3CTAA 2Q93A 4MNUA 1W5SA 1ZH5A 2YPRA 3HTUA 1XSVA 3C18A 2ZCWA 2B0LA 2H09A 2W84A 1BM9A 5CLSA 3SXYA 2KRFA 4WX9A 4ON0A 4UV9A 3F6OA 3L00A 3GUDA 1I6XA 1STZA 4MGRA 4U6CA 4LLGF 1FPQA 1TW2A 4RZZA 3RKXA 2XUBA 1C27A 4LK0F 3FMQA 4L9VA 4G7HF 1K7AA 3CUQC 3JSPA 1I1GA 5CDEA 4I98B 3FHZA 4IXAA 3MR1A 2BH3A 4UV8A 3HUGA 2GG5A 3MZHA 2STTA 2XV4S 2K02A 4YFNF 4ASNA 3AAFA 4HX4A 2P9AA 4FLIA 4LFUA 1HXDA 4U1BA 4RGXA 1G6NA 1BOAA 1TNSA 3IWFA 1ZHFA 4LLNA 2F5EA 3GZ6A 1IF1A 4CXFA 2BE5F 2CW0F 4EJWA 2L02A 3JW4A 2OD5A 2RDPA 3HIFA 4CHUA 2FXAA 4PZJA 2XAHA 5FCHA 3MAJA 2RNJA 3NRVA 2VT2A 2BWVA 2GXBA 4AVPA 4EMSA 2RKHA 2BWWA 1WBQA 1O7LA 4M72A 4HDVA 2QQBA 2PMUA 1KGSA 1HBXG 1EV7A 4WXCA 3I71A 2JT1A 1DPUA 3COAC 3WTTC 4GGGA 4WF2A 2YR2A 2Q92A 2W85A 1DPRA 3GXOA 3F6VA 5HS9A 3H3ZA 4WXDA 1LEAA 1UHWA 3L24A 5ICCA 3BOQA 1M35A 1J9IA 1G4DA 4G9YA 4GO1A 1H9TA 5FO5A 1F1ZA 2IW5A 3H3UA 3Q9VA 2OKNA 3HHGA 4OINF 3O6BB 5CYVA 2W25A 5TJJA 2EA4A 4HA8A 5H6RA 2EV5A 5CVIA 3N4MA 3HRMA 2JTVA 1FX7A 3WTSC 2ZBKA 2VBYA 3I0TA 1PP7U 2RGVA 4U7DA 4M9XA 1PV9A 1P4WA 2NQ6A 1BC8C 1XSDA 4MTDA 5ILUA 2Z99A 3P9CA 3U2RA 5D4SA 4L5JA 5L3BA 1U6GA 1UFMA 3BY6A 5FLXK 4UUVA 5FFZA 1TLHB 3T8RA 2QLZA 2IA0A 3BJAA 2M8EA 2WV0A 2BWYA 4PDKA 2K4JA 5JFRA 3C3WA 3DF8A 2O61A 1YW8A 1ZN2A 1T6SA 4EJTA 5CVUA 4G8XA 3MX6A 3DKWA 4A5NA 1FWZA 2P4WA 3RORA 1BC7C 4N9IA 1FP2A 2UXNA 3F22A 1WRJA 3EDPA 4I0BA 5LHIA 2HOEA 5HLHA 3E6MA 2L54A 2DQRA 2H27A 2BV6A 5CE6A 2OBPA 4RAYA 1R00A 1J0RA 3VFZA 1ODDA 4Q47A 2V79A 1SD7A 2GG8A 1ZARA 2IRFG 4IKSA 2M5WA 4B28A 1ZGJA 1REPC 1JXSA 3RDIA 1U2WA 2V1XA 2WWYA 1Z6TA 1QBJA 2W57A 2MH9A 4L0YB 1CGPA 2XROA 2V1UA 1R22A 3LAPA 2EFPA 2PI0A 3GX4X 2EV0A 3P7NA 3HRTA 5D6FA 4U0WA 3B02A 3RPQA 4M9ZA 3WU1B 2BWTA 3RJPA 2A6EF 2Q2EA 3E5UA 4P96A 2HQRA 3BIQA 5FD5A 1Z6RA 1YW7A 4LB6B 5E8IA 2PEXA 1XMKA 4BNCA 3HRUA 2ZO4A 5D5UB 1FYMA 3M9AA 4CO8A 2MD5A 3E97A 4LGWA 4O3MA 3F8NA 1Y0UA 3QAHA 4K2EA 4KA4A 1KA8A 3KCCA 1L3LA 1UCRA 3CUOA 3M7GA 3ZMZA 2ZKZA 4YFKF 5IT9Z 3K69A 3N97A 3J80K 5KK1A 1G3SA 4ZZLA 4L5IA 4HV5A 2VC1A 5E1WA 3RPUA 3T5XA 4AWXB 4HF0A 3ZMTA 2FMLA 1YQAA 1DP7P 2ZMEB 3EQLF 1K6OA 1ZRCA 1KQ0A 1I1SA 1P2FA 5DV5A 1RZ4A 4A6VA 3BWGA 3F72A 1ZRDA 4XBFA 4HYEA 5CVJA 5HLIA 3MCZA 5D5VB 3SHFA 1S8NA 2VOOA 1IXCA 2HWVA 1TNTA 3HSFA 3KFWX 5DYMA 2E7XA 1G3TA 1LNWA 2VE8A 2X4HA 2PBIA 2EFQA 2G6PA 1MGTA 2G7UA 3PKAA 2V9VA 3RYRA 2G9WA 5DD4A 4KFCA 1AWCA 1BI0A 4F7ZA 4EM0B 2XAQA 3LAJA 1RI7A 1D3YA 3I4PA 4OOKA 4M74A 3I59A 2Z5UA 4A0XA 4FLKA 3KP6A 3ISPA 1HKQA 4ZYGA 2EJRA 2XHKA 3TOAA 3K1NA 1NHAA 3KE2A 4LG0A 1LQ1A 4IJAA 5HDKA 2FBKA 4HLYA 1ZLKA 1U5TA 5HDNA 3CUQA 2BYVE 1MD0A 5ERIA 1O57A 3EUHA 5DEQA 3IC7A 3KP3A 4NB5A 1FOKA 1HSTA 1MJAA 2JPCA 3FM3A 2A68F 5HS7A 4AIJA 1U5TB 4A0ZA 5CVVA 5E5BA 3L9FA 3W6JB 2O8XA 2EFOA 1SMTA 2K4BA 2Q8KA 5BQTA 1R23A 3FM5A 2O03A 1IRGA 3HYIA 5BMZA 1FBUA 1JGSA 3DFGA 3K1PA 2BB7A 3QU6A 3KZZA 1XGMA 3EYIA 3B73A 5D5WB 1J5YA 2PJPA 3ELKA 3ULQB 3J80Z 2PQ8A 5DD8A 2KIMA 2L4AA 1F9NA 5FD6A 3D0SA 2TDXA 1YVMA 2XIGA 4HW0A 2R7DA 5K5QA 4L9NA 1BIBA 1PP8F 2HTJA 1KYZA 3LA3A 4YFXF 3KEOA 2VC0A 4ZNGA 5L3GA 4G6DA 4QWQA 1BIAA 2XKPA 2HKOA 3S2WA 2V6CA 4Q4ZF 2QBYA 1QXZA 4UNOA 2DK8A 2X0LA 1TW3A 1GVJA 2GXGA 4WCGA 1GHCA 1O3TA 2GGBA 3FWEA 1FYLA 3LFKA 4R60A 5ILSA 1WN1A 2GU6A 2NNNA 2ZMEA 3LQQA 4MTEA 2BHCA 4S2RP 1P4XA 2GG9A 3QP6A 2GIVA 2ELHA 2R7FA 4MQ9F 1J2XA 5A2QZ 2QUFA 1U5TC 5ICFA 3DP7A 4QLCU 1FSEA 4LLLA 1MJ9A 5K1YA 3QPHA 4HV6A 4IDYA 2MA3A 3ZPLA 1FSHA 2EB7A 1WKMA 2EFNA 4FO7A 3F8BA 1XDUA 2VBXA 1EH7A 3CJNA 4RB2C 1HW2A 3BPXA 2CQKA 3JTGA 2HOWA 3PKDA 3BROA 3QU3A 5JR3A 1R1TA 4ENNA 1LB2A 2E1CA 4I7HA 2FE3A 2QVOA 2B3KA 3O2PE 4FX4A 4OU0A 1GXQA 3FXUA 2FF4A 5HVQC 4LG0B 2DT5A 1A04A 3U9GA 2GG2A 2P98A 2MLKA 3WGGA 1ON2A 4U6WA 4CYDA 5F1RA 1XDSA 2QQAA 2KJBA 2HFHA 2O3FA 4EGEA 3M8EA 1OR7A 2FNAA 4HOBA 1QXYA 2H94A 4Y15A 3GFIA 2KIUA 3GLXA 4O6JA 2BHDA 4D0PA 1LEBA 5LGUA 1BBYA 3ABUA 2GG7A 2M45A 4PV4A 2UXXA 4LD5A 1OPCA 1WL9A 1IXSB 4ZZDA 2FOKA 2WC2A 1BJAA 3TO9A 3DPTA 3PFIA 3I53A 1E17A 3MATA 5CJ9A 1FBSA 2ZJ2A 4UHTA 1O3SA 2JPBA 1IN4A 2P6SA 1W4MA 3WTYC 4U88A 3RKWA 1O0XA 1WLRA 4HDUA 2DAOA 4ZYDA 4U76A 2LF7A 2QWWA 4BHCA 4R79A 5D8LB 3ZN0A 1B9NA 2GG0A 3E6CC 3P9IA 2GA1A 1KU7A 5CDVA 3MEXA 2DQLA 2L4MA 5E1ZB 5ILVA 2IVMA 4MHGA 4U69A 2IA2A 2DU9A 2QQ9A 4OIPF 4OMYA 2M1BA 4E70A 5BS6A 3L09A 3WTZA 3VB2A 3K9TA 4L9TA 4OIQF 3Q6DA 4AIHA 1K78B 4RGZ1 5HLGA 5E17F 1P6RA 3WTWC 2STWA 1C22A 2XASA 2HDCA 4U7BA 2ESNA 3IWZA 5D4RA 3BPVA 4LK1F 4PGHA 4EJOA 4MATA 4FLJA 4EGZA 3FXQA 4XRFA 4IKTA 2CFXA 3GO5A 4FHTA 4ESJA 1S7AA 2B3HA 2GGCA 3I58A 1YFHA 4IVNA 4DNCA 4ENJA 4WWCA 4G6QA 3WU0A 3GW2A 4Q48A 5DUKA 2GTXA 4HQEA 5HS8A 2FBHA 1IXRC 5K5RA 4WXHA 2E7WA 2A07F 4HQMA 1KU9A 3T8TA 5ED4A 2D1HA 4BHBA 4EVIA 1S3JA 1Z7UA 3CB5A 2HEOA 3QPTA 3DXJF 3R4KA 1U8RA 4EV0A 1B1BA 1HSJA 1ON1A 4NHJA 3ZMUA 1IN6A 2NYXA 4FO8A 1XN7A 1P4AA 3KP2A 3TDUC 1CF7A 1B9MA 2OZUA 1HQCA 1Z91A 4GCVA 4IHTA 1XD7A 4P55A 3SQNA 4AIKA 3GF2A 3LA2A 4ZWUA 3VEPA 3R6SA 1H9GA 2A6HF 2G7HA 4A2UA 1W7VA 4KICA 2CO5A 1ONVA 3M8FA 3I59B 2D1VA 1XSXA 4RGRA 5EEHA 5CIKA 2VT3A 1IN5A 3T0YA 5E18F 1IRFA 1A16A 4G94A 2XAFA 1FLIA 1Z9CA 1YW9A 3H92A 4UVBA 2ZXJA 1D5VA 1C23A 4GYIA 4CGZA 2NQ7A 4U73A 2PFBA 4HF1A 3C7JA 2OAZA 4EQQA 1X3UA 3JTHA 2F5DA 3BITA 4U6ZA 1RUNA 4EM1A 4BHPA 1ZG1A 2GWRA 3MQ0A 3OV8A 2ISYA 1XCVA 3RKYA 1F5TA 1Y1NA 3IKVA 2M30A 2DW4A 1FT9A 5E8GA 2ZSGA 1KQ9A 1SD6A 1S7OA 3LA7A 3KP4A 5FB2A 2DO7A 1B6AA 3IL2A 2HR3A