1WKMA

The product bound form of the mn(ii)loaded methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title EPR and X-ray crystallographic characterization of the product-bound form of the MnII-loaded methionyl aminopeptidase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wkmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wkmA01
3LFKA 2RV8A 2HDCA 1R23A 3U1DA 1ZG3A 1IXRC 4HV5A 3ZMZA 3MR1A 1F9NA 2D45A 3HRMA 2FU4A 4CICA 4KMFA 4ESJA 5A2QK 1B4AA 5ICGA 3DFGA 4A0ZA 2FBKA 5BOXA 1SMTA 2ACJA 2GG2A 1XCVA 3BJOA 3QAHA 2QWWA 2EK5A 5LEKA 2GA2A 4YFKF 4A6EA 1S7OA 4HLYA 2A69F 3FXRA 1SMYF 3G73A 3FWEA 1PDNC 4AWXB 5E1WA 4EM2A 1T39A 5HLIA 1F1ZA 2Q92A 2KRFA 1KU9A 3F8CA 5CVJA 5AONA 5CVUA 4JBAA 1D5VA 5CNXA 5FLXK 1FPQA 1MD0A 3H92A 2EWNA 3BDDA 3HOSA 2Z3YA 3L00A 4PNCA 1PUEE 2KJCA 5CYVA 4FLIA 2TDXA 3LQQA 5K1YA 3CDHA 5CE6A 1FWZA 3KZZA 1A16A 5FD6A 5D6FA 3V4GA 3HSFA 1TQPA 1LJ9A 4Z7MA 4U0VA 1MDMA 2ZBKA 3HRSA 1CGPA 1R1UA 2M30A 3BIPA 1JE8A 2Z5UA 1TQMA 2NNYA 1RUNA 5J8CA 1R00A 2ZO4A 3PQKA 4IF7A 2Z33A 2FMLA 4IKSA 4ZYGA 1G3WA 4BXUA 4ZYDA 3PKCA 1UHMA 2VXZA 1YW9A 2IW5A 1JGSA 2VBXA 4UVBA 1W7PB 2X0LA 5CDLA 3WTZA 4OINF 5ICCA 5L3EA 5LRSA 4G6QA 4QWQA 2XV4S 2XAFA 2DU9A 1C23A 2HZTA 3KCCA 3CTZA 2P7VB 4FX0A 1C21A 2PEXA 3WGGA 4JQFA 1HW5A 3U9GA 4L0YB 2HFHA 1QPMA 2OAZA 4LLGF 3F23A 4GXOA 3SHFA 2EFWA 5FO5A 2IPQX 3ZN1A 5D4RA 2QQAA 4WWCA 3DV8A 3GFJA 2EV0A 1JAWA 3MATA 2GG8A 4FO7A 2P5LC 2AS5F 3HUGA 5ILUA 1SFEA 4LFUA 1J75A 4JUQA 5FD5A 3N97A 1B59A 2KJBA 4OOIA 4YFNF 4IKRA 2GTXA 4IVNA 3T5XA 1E2XA 2E1NA 1KU3A 4G8XA 4FLJA 4EM0B 1U6GA 1HKSA 4IPAA 3BROA 1IN8A 1TNTA 2Z9OA 4U6WA 1ULYA 4CDGA 3E6CC 3R61A 2XKOA 3Q6DA 5BS6A 2EFQA 2GG0A 4CZZA 5E20A 4U6CA 2HKXA 4L9JA 3O3KA 3TAVA 2R7DA 5DD8A 1REPC 2OA4A 3EUHA 3QRFF 4WX9A 5DUIA 1R7JA 2UWMA 5H20A 3MAJA 1YS7A 5EEGA 3IKTA 4MEYF 5L3GA 4GYIA 2IJLA 4IXAA 2BWTA 1ZYRF 1USSA 3QPTA 2GGBA 3H3ZA 4HQMA 1YLFA 3L9FA 1XGOA 2WTEA 4R79A 3E5QA 1S29A 3TOBA 3EETA 5L3BA 2A61A 1EH6A 3NRVA 3L24A 2CSOA 2NAZA 4LGWA 3ZMVA 1YO5C 1XSXA 2J5PA 3GXOA 2Y0MA 2MLKA 1S8NA 2XAHA 3KP3A 2QENA 1WI9A 4HXXA 3GLXA 1HBXG 2VT3A 3CUQC 2RGVA 2QZ8A 2CG4A 3GEZA 2FBIA 3L2CA 1WY2A 4OIPF 4EJTA 1CHMA 1ZRCA 1XGSA 3RTRA 1U8RA 2BHBA 1SD5A 4ASNA 2BE5F 3VB2A 4GO1A 5F6FA 3WODF 1C0WA 4P96A 1KA8A 1D3YA 3F22A 1AWCA 2LNBA 2W57A 3I58A 1U5TB 2IA1A 4HF0A 2EV5A 3CUOA 3S6BA 3KEQA 1BI3A 4CXFA 3WTSC 1TLHB 1EH8A 1W7VA 4KA4A 4LK0F 2GGCA 1SD4A 2M8EA 3MZHA 3IKVA 4N9IA 4MEXF 1I1SA 3R4KA 1UHWA 1H9GA 4G7ZF 3I59B 2ISYA 3B73A 3HHHA 2VE8A 1KYZA 5LLQA 5E8IA 1T2KA 2EV6A 5BPDA 1C27A 4P9UA 1W5TA 1KQ0A 2YSRA 3K1MA 3K1NA 2HR3A 2BYVE 4U73A 3ZP5A 4PV4A 3BOQA 1XCBA 3EDPA 2J5OA 5JVTA 3R0JA 2A6EF 1BM9A 2KKOA 2QM3A 2C6YA 3BP8A 2BWXA 5D8LB 4M9XA 4UVAA 5F64A 2HKOA 2Q8KA 4AVPA 1FBUA 2IA0A 2RQPA 3RJPA 2FBHA 2V1UA 5FB2A 3F8FA 1BI2A 4EJOA 3E3VA 3F21A 3CO6C 2FNAA 3IWFA 3MQ0A 2IP2A 2HOEA 1S6LA 1FY7A 2CWEA 1C22A 2L3DA 1Z91A 4ESBA 1BJAA 3RPUA 4TV7A 3GZ6A 4Q47A 3ISPA 3HSRA 1O3SA 3K1PA 1DPUA 2B3KA 2EB7A 2R3SA 3L09A 1YW7A 2A68F 1XMAA 2HYGD 3TQNA 2H27A 3GW2A 4KN7X 2HWVA 1U3EM 4HAMA 2BHCA 3WTTC 1QXYA 3L7GA 1OMIA 2GIVA 5HS7A 2YPRA 3PKEA 2BEOA 1FT9A 3TO6A 1P4XA 1WL9A 1QNTA 2MA3A 2BWUA 1XGMA 4KUMA 3F8BA 1V3FA 4S2RP 4RB3C 2RN7A 2PG4A 5L3FA 2NRAC 2RVCA 2BBYA 5E17F 2OZUA 3T1BA 5DCMB 1H0MA 2M1BA 3E97A 1FYLA 3P7NA 3HSEA 1T98A 2P5VA 2P9AA 3KE2A 3FMRA 3F6VA 3QP6A 1ZRFA 3FMSA 1R1TA 3GX4X 4HV6A 2W25A 3LA2A 2IRFG 1Z05A 1YFHA 2OU2A 2W84A 4HF2A 4ZZDA 4GCVA 4RB2C 2P4WA 1T6SA 2L4AA 4BQAA 2CO5A 3R0AA 1MJBA 1QZYA 4L9VA 4L5IA 4ENKA 4Q4ZF 5E5BA 3QP5A 4LLLA 4HDUA 1MKMA 5FFZA 3LAJA 1EH7A 1K79A 2L4MA 4WXDA 3J81K 3ERED 5D8KB 3RKWA 1O0XA 3WE2A 3JAMZ 4ZYEA 1U78A 2QQBA 2PQ8A 1FYKA 1P92A 2BHDA 1JHFA 2DBBA 4S05A 4FX4A 4BYYA 3GVAA 4RGZ1 5HVQC 3COAC 5LHGA 4S04A 3GZ5A 2XVCA 2BWWA 1LVAA 1FSEA 1G3TA 3EYYA 1Q1HA 4OIOF 2V3ZA 3WGHA 4FUKA 1ZLKA 2IA2A 4ZYHA 1LDKB 2XAQA 3K9TA 3I71A 5LGUA 1DP7P 2K27A 4OU0A 1ODDA 1FZPB 2BH3A 4A6VA 3HRUA 1F4KA 1ZLJA 2ZMEB 3DF8A 2DW4A 2LF8A 4AIKA 2STTA 3C7JA 5EEHA 2V9VA 2EVMA 1XSVA 1UFMA 2A5YB 3WE3A 2G6PA 2QVOA 5HDGA 4KIGA 3TDUC 4RS8A 3RORA 3JSPA 2XAGA 2E7XA 1HKTA 2R7FA 3O2PE 4YIIA 4HOBA 2PBIA 5DD4A 1I27A 1R5GA 5TJJA 3E6BA 2JT1A 4M9ZA 5HLHA 2G9WA 3RPQA 1FX7A 1Z7UA 3I59A 2ETHA 4NHJA 2DQRA 2L02A 1MDMB 3Q9VA 1SFXA 3HYIA 4O5VA 3ZMDA 1BC7C 5LRRA 2DK8A 3TGNA 3ABUA 4FO8A 2DPDA 1UB9A 2DAOA 4HX8A 3KEOA 1XD7A 2VC1A 4IECA 4WF2A 2ESNA 1WRJA 1RI7A 4L9NA 5IT3A 2K7LA 4M6XA 4EJWA 3DKWA 1BI1A 2MH2A 3CUQA 1LB2A 3IHUA 3V7SA 5JFRA 2GXBA 4B8XA 4U69A 1B9NA 4R1HA 2DO7A 3ML6A 2AXLA 2BHAA 1A04A 4YFXF 1O7FA 4I0AA 3ZMTA 4EV0A 3Q5FA 5HS8A 1O57A 1R58A 3M8FA 4IU6A 2JRTA 3E5UA 3K0LA 2PFBA 1HXDA 4L0ZB 1WLRA 3BITA 2ISZA 1P4AA 4NQWA 2JZYA 1QO0D 1LDDA 3TO7A 3RI4A 1L0OC 2L01A 2UXNA 2OQRA 1LEAA 4U7BA 2GG3A 4HF1A 2G7UA 1O3TA 4PCQA 1QGPA 2CGPA 3P9KA 5LHHA 4P9FA 2EA2A 5CVRA 3BJ6A 4XLNF 2XRNA 4B28A 5D5XB 2FRHA 1G3YA 2K86A 4P5OA 5DYMA 4A6WA 3BY6A 4D0PA 3DPLC 4ESFA 4G7HF 4LG0B 3ECHA 4A12A 3I53A 4MQ9F 1W7PA 1RZ4A 4Q5SF 1R5HA 1QXWA 1MJ9A 4L5JA 3M1EA 1JHHA 2A3SA 2ZNZA 1KU7A 3PKBA 3I64A 1E17A 4EMSA 3GYHX 4MQVA 2O61A 3KP5A 2D2WA 2MD5A 5BMZA 1C24A 4IKTA 2LF7A 1T38A 1CF7B 2CW0F 2P8TA 1SD7A 2O0YA 5K5QA 2EA4A 3WGIA 1O7LA 2BWVA 3FM3A 3OOPA 3JTGA 2IT0A 3IG4A 3I54A 1CF7A 3E6MA 3FM5A 1BBYA 1RUOA 4KMUX 3GFIA 1FLIA 5HS9A 5FCFA 1ZH5A 1WSUA 4IJAA 1XNZA 2NS0A 2EFPA 4O3MA 4UV8A 1WQ2A 3ECOA 2UZKA 2LSOA 1USTA 2CFXA 2GG7A 2VN2A 5AIQA 4XBFA 4GGGA 1O3QA 3MCZA 1YYVA 2GQQA 3BWGA 1KYWA 2XGXA 1YQAA 3ULQB 1STZA 1LEBA 2EFNA 4UUVA 1H9TA 4IRIA 4FKCA 3R60A 2ZFWA 4YG2F 4N9HA 5TRDA 3J80K 4ON0A 1W5SA 4K2EA 2OD5A 1LQ1A 1ZRDA 1IXCA 3K2ZA 2ZKZA 4QLCU 1OYWA 4HA8A 2ZXJA 2FMYA 2HS5A 2XAJA 3L7WA 2GU7A 4KT5C 2QLZA 3D0SA 3QU6A 4FT8A 2LKPA 3RKYA 3M8EA 4EQQA 1WN1A 2DQLA 2RKHA 5LBQA 1IUYA 3QPHA 3MWMA 4BNCA 1W2MA 2WV0A 3SZPA 2QBYA 1IN5A 3IL2A 1I6XA 1F5TA 2QYOA 1VTNC 5HDNA 4U1BA 3G3ZA 3IRQA 1IN6A 2NQ7A 3W6JB 3VEPA 5DDGA 4KNYA 1R36A 1K7AA 1GVJA 2Q93A 3CB6A 1IXSB 3P9IA 4ZWOA 1DUXC 1YS6A 4M73A 4M74A 5E1XA 2H94A 5LGTA 5CVIA 5IT9Z 1ON1A 4U0WA 1G6NA 1TNSA 4BHCA 4RGXA 2O6GE 4UV9A 4OIRF 1FOKA 2BWSA 2Y75A 3I0TA 3REOA 1IAWA 5CIKA 4RGSA 1QBJA 5CLSA 3PQJA 5BPIA 1ON2A 4ENJA 3BPVA 3VFZA 2ESHA 4DQ2A 4RZZA 1OYYA 1HW2A 2MLGA 1J2XA 1WWXA 1WKMA 5K5OA 5HOOA 4Q48A 3H3UA 4KIBA 4Y17A 4O6JA 4ZZLA 4PGHA 1W4MA 4A5MA 4A6DA 5DUKA 5FCHA 1MJAA 4LB5A 5L3DA 1T0FA 1WL6A 2Q96A 4KFCA 1TW3A 2H6BA 4IKUA 4G6DA 2COMA 3NQOA 3GFLA 1B9MA 3R6SA 1YIOA 1FNNA 1FSHA 5DEQA 1GHCA 3TDZC 2GG9A 4KN4X 3SXYA 1KQ8A 4XSXF 4LK1F 4KM3A 4I01A 1G3SA 2JPCA 3P9CA 2K02A 3ROUA 5BQTA 1O3RA 5FLXZ 3KP2A 2EFOA 3FF5A 3KFWX 5HDKA 2XIGA 2BB7A 3TB5A 1JXSA 2XHKA 2YU3A 5D4SA 1FBQA 4U6EA 2EJRA 3VOEA 3NEUA 4PDKA 1QQIA 3N4MA 3T8TA 1K6OA 1IW7F 4ENNA 3IU9A 4A2UA 1SAXA 3E6DA 2Q0OA 3KP4A 1KGSA 1R22A 1QXZA 3BPXA 3V7CA 3LWFA 5ILVA 3RDIA 4L9TA 3LA7A 4ZNGA 2FSWA 5D5UB 1U5TC 4YIFA 4Y15A 4MGRA 5FGMA 2K4BA 3O6BB 2O8XA 2FEZA 3CTAA 3DXJF 4LMYA 2V3YA 1L3LA 1P4WA 1W7PD 5ICEA 3KLOA 1BI0A 1P2FA 1J9IA 4XSZF 3WTWC 3GFMA 3RIRA 2BWYA 2CQKA 1OYIA 1S7AA 1KP0A 1HQCA 3CUQB 1LDJA 4AD9A 4LJZF 1PP8F 1XGNA 3IRRA 1BC8C 2BV6A 2DTRA 1B1BA 1ZG1A 1J5YA 3KLNA 1OKRA 2B0LA 1YJ3A 4I2OA 2PN6A 1K78B 2ZCWA 4NB5A 4MTEA 3W6KB 2A6HF 2FOKA 4OMYA 1R1VA 4OMZA 2XKPA 5J8FA 5JHUA 3D5LA 1EV7A 4HX7A 2O3FA 3HHGA 2KIMA 3ZPLA 1IRFA 3F72A 1TBXA 2GU4A 4LLNA 4U7DA 4HZFA 4IF4A 4MNUA 1IZ1A 2V1XA 2XROA 1I5ZA 3GF2A 5H6QA 2DLLA 2FE3A 4LG0A 2GZ5A 2MBFA 1J7KA 2K4JA 3SQNA 2W85A 3DEUA 4HQEA 3J81Z 3QU3A 2JTVA 5CJ9A 2BN7A 3HRTA 2HTSA 4F7ZA 2ZNYA 1HSJA 1KQ9A 4ZWPA 2MATA 1HKQA 3PFIA 2V79A 2RNJA 1ZREA 5CDEA 1P6RA 1YVMA 5H6RA 1UCRA 3CB5A 2V1DA 1SFUA 3WTVC 2DK5A 2ELHA 1FC3A 4ETSA 2CYYA 1IRGA 3WG9A 2F5EA 1RIOH 5LGNA 3M7GA 1XSDA 4MTDA 2GA1A 4U70A 2JPBA 5KK1A 2VE9A 4U6JA 4EGEA 4WXCA 3QOPA 1XDSA 1OPCA 1ZHFA 4KDPA 3RYRA 3KP7A 3ZMUA 5K5RA 1XN7A 3PKDA 2YX4A 2PMUA 4FHTA 2FXAA 3JTHA 4ZH4F 5IT9K 2KIFA 1DDNA 2WWYA 2VT2A 3SFZA 1V4RA 3HTUA 3F6OA 3MZYA 2M45A 4WCGA 1I1GA 2W24A 3FXQA 6PAXA 3FXUA 5E8GA 3WTUC 3C3WA 2P99A 2HTJA 2EVOA 1FYMA 2P98A 4OIQF 5DCMA 4Y13A 5D5VB 4R60A 5D5WB 2O03A 4EJVA 4I0BA 5ED4A 4A5NA 3GUDA 4EJUA 2ZSGA 5ERIA 4AIHA 1U2WA 4RB1A 4U71A 2ZJ2A 4G7OF 4G9YA 2JSCA 4S01A 5DCFA 4BHBA 5ILSA 1D8JA 2P6TA 2P6SA 4M72A 2HQNA 3T8RA 3DP7A 2OZ6A 1MATA 2OQGA 3LAPA 3FX3A 2M5WA 5LHIA 3Q9SA 4KIFA 4HYEA 4UVCA 3BJAA 4L18B 4HX4A 3CO7C 4A0XA 2H6CA 1XMKA 2GG5A 3HTSB 1XDUA 1PP7U 3WU0A 3RKXA 4ZWUA 2RDPA 2VC0A 5FFXA 4G94A 2UXXA 2F2EA 3CJNA 3IWZA 4IRHA 5KVRA 2V6CA 4FLKA 2VBZA 3RYPA 3DQVC 4HLXA 4XRFA 4CYDA 1ZGJA 2YR2A 2H09A 2E1CA 2EVCA 4CO8A 2VODA 3SZTA 1S3JA 2HQRA 3S2WA 3ZN0A 2Y48A 4I7HA 4UXNA 2MC3A 1IF1A 1IN7A 2ZMEA 4KICA 4A0YA 1J0RA 3ABTA 5CDVA 2GU6A 4DNCA 3V7RA 3M9AA 3KP6A 1ZG5A 1Y1NA 1FP2A 3MEXA 2P7CB 1N51A 4EGZA 4BAYA 3V8JA 1FBSA 3EQLF 2Z99A 4UHTA 4M71A 2DT5A 3TKYA 3F8NA 3FZVA 3HOTA 2GWRA 1MGTA 4BHPA 4LB6B 4U76A 2MH9A 4ENMA 2DPUA 2PJPA 3E5XA 4EM1A 1Z6RA 2GU5A 3I4PA 1HSTA 4QR8A 3AAFA 2QQ9A 4R8HA 2LDUA 1B6AA 2HGCA 5A2QZ 3C18A 4I09A 4H0EA 2PMHA 2V3XA 2XUBA 1DPRA 3JW4A 2KIUA 4WK8F 1Z9CA 2RC4A 1Z6TA 2VOOA 5E18F 4P55A 3FMQA 1ZARA 2PLYA 1TQIA 3I5UA 5J6XA 1ONVA 3IU7A 3MX6A 3V8LA 1M35A 2STWA 2Q95A 4IRGA 1FP1D 4WXHA 3GWZA 2IVMA 2FF4A 2L54A 3K69A 1IN4A 2NYXA 5JI6A 2GAUA 4HBLA 5L3CA 1SD6A 2DFIA 2PI0A 1TW2A 2B3LA 1MZBA 1KU2A 2X4HA 2YX7A 4RAYA 4HW0A 4RZYA 4EGYA 2F5CA 2M87A 4PZJA 4U0YA 3C1DA 4RAZA 4LD5A 4RB0A 3WTYC 4FLLA 1GXQA 3GO5A 5JR3A 2F5FA 4BH9A 2E7WA 4HDVA 3OV8A 2ADUA 5DV5A 4CGZA 4I02A 3LA3A 2G7HA 3T0YA 1XB4A 4S00A 1K78A 3JSOA 1BOAA 3DPTA 4GYGA 2OBPA 4M6YA 3PKAA 2HEOA 4U88A 1LNWA 4KYWA 1HW1A 3FHZA 2QUFA 4IDYA 1GXPA 3BZ6A 4B09A 4M9SA 3CLOA 2Q94A 2NQ6A 4U75A 3J7AO 2Q2EA 2D1VA 3LSTA 4OOKA 4E70A 1D8KA 2GXGA 1QZZA 1U5TA 3ZQ7A 4U6ZA 2VONA 3J80Z 1ZN2A 2OKNA 4IHSA 2FNPA 3ELKA 3EYIA 2WC2A 2DI3A 5F1RA 1Y0UA 2XASA 3ZMSA 1BIBA 2NNNA 1G4DA 4RGUA 4UNOA 3IC7A 5D6EA 2HYFA 3TOAA 3V8KA 1WBQA 1X3UA 4PGGA 3F3XA 3KZYA 1ZGAA 2D1HA 4IHTA 3WU1B 1J59A 2BGCA 2A07F 3IU8A 2VBWA 4RGRA 2VBYA 3MFKA 4N0BA 3LQRA 3BIQA 5CVVA 3TO9A 4S2TP 1RNLA 1NHAA 3HIFA 4EVIA 1Z1DA 2FQ3A 5ICFA 1BIAA 1BN5A 3KETA 2B3HA 2VOPA 5HLGA 1OR7A 2P5KA 1AOYA 3JAMK 1YW8A 4CHUA 3F8MA 1TTYA 3B02A 2F5DA 4JK1X 4MHGA 2IW2A 2QBYB 3RVAA 5E1ZB 3WTXC 3D27A 5AIPA 4XLPF 3VODA 2FA5A 5LEJA 2GZWA 4Z2YA 1PV9A 4I98B 1ZAOA 1YTYA 4MATA 3U2RA 4AIJA 2HOWA 1YG2A
chains in the Genus database with same CATH superfamily
1APLC 3LFKA 2RV8A 3LMMA 2HDCA 1R23A 3U1DA 1ZG3A 1IXRC 2W7NA 2E71A 4HV5A 3ZMZA 2XGEA 3OL3A 3MR1A 1F9NA 1WJEA 1Y8QB 2RQQA 2D45A 3CESA 3HRMA 2BY2A 2FU4A 4IZZA 4CICA 4KMFA 2X1CA 4ESJA 3CCVI 2FOWA 4HEA2 3S3NA 5A2QK 4RA2A 3ZR8X 3C2GA 2IGMA 1B4AA 2JVGA 3SDGA 5ICGA 3DFGA 4A0ZA 2FBKA 4XRMA 5BOXA 1SMTA 2VJ4A 2EZLA 2ACJA 2GG2A 3L1PA 1XCVA 1SVMA 3BJOA 5FJ8J 3J7AY 3QAHA 1PYVA 3S1RJ 2QWWA 2EK5A 5LEKA 2GA2A 4YFKF 4A6EA 1PJRA 1S7OA 4F55A 2B9SA 3OYMA 4HLYA 3ASOH 2A69F 3FXRA 1TL8A 1JKRC 3AG2H 2V26A 3OYHA 1SMYF 3G73A 2OJED 3FWEA 1X2MA 1PDNC 2R7SA 3TW7A 4AWXB 5E1WA 1W0UA 1FTTA 4EM2A 1T39A 5HLIA 1F1ZA 2Q92A 2KRFA 1KU9A 1V5FA 3F8CA 5CVJA 5AONA 5CVUA 4JBAA 4BJTA 1D5VA 5CNXA 2X6XA 3HOWJ 4AUXA 5FLXK 2VXDA 1D5YA 1FPQA 2CU7A 2E2IJ 2MYSA 1MMSA 2MD0A 1MD0A 4AYBA 3H92A 2EWNA 3BDDA 4XLFA 3HOSA 2Z3YA 3IAS2 4M3GA 2LG4A 4B3XA 3PJRA 2WB1A 2R7QA 3L00A 4PNCA 1Y56A 2LY1A 5DTDA 1PUEE 2KJCA 5CYVA 2HDWA 3MKZA 2LY9A 4FLIA 2TDXA 3LQQA 1MMNA 3CDHA 5K1YA 5C3EJ 1JJ6C 3PUFA 3OYJA 5CE6A 1FWZA 3KZZA 1OCZH 2KFDA 4BS9A 1A16A 2ELKA 5FD6A 5D6FA 1FIPA 3HSFA 3V4GA 1VQ6I 2DDAA 1TQPA 1LJ9A 4Z7MA 4U0VA 4II2A 1VQ4I 1MDMA 5FRNA 2ZBKA 3HRSA 4LIVA 1CGPA 1R1UA 2M30A 4FE4A 5H2FC 3BIPA 3BTIA 1JE8A 2Z5UA 1TQMA 3RZOJ 2NNYA 1RUNA 3IAM2 5J8CA 1R00A 2ZO4A 3PQKA 4AVZA 4IF7A 2RAEA 2Z33A 2HOSA 2FMLA 4IKSA 1OLTA 4ZYGA 2R5ZA 1G3WA 4BXUA 4ZYDA 3PKCA 1UHMA 2VXZA 1YW9A 2IW5A 1JGSA 1WJFA 4F92B 2VBXA 2W4SA 3DPUA 2DODA 4UVBA 4Y33A 5C4XJ 3CMMA 3OYKA 3HOZJ 3G2BA 1W7PB 2X0LA 4BXXJ 4HG2A 2BXZA 3WTZA 3OYCA 5CDLA 4OINF 5ICCA 5L3EA 1XX5A 3X2QH 5LRSA 4G6QA 1XPXA 4QWQA 2IAIA 2XV4S 3VYSB 4HPQA 2XAFA 1MH4A 4MO7A 1W36D 1FOWA 2DU9A 4BACA 3TEDA 1C23A 2HZTA 1ZR4A 3KCCA 2E2HJ 1WHUA 4KITB 3CTZA 3RPUD 1N75A 2P7VB 4FX0A 2L0KA 1C21A 2PEXA 3BR0A 3WGGA 2JN6A 2DMUA 2KISA 1HW5A 4JQFA 3FKJA 1OCPA 4XKWA 4BEHB 2JA7J 5J4YA 4G12A 3U9GA 4L0YB 2HFHA 4PJNA 1QPMA 2OAZA 3UKGA 1VQKI 2V7FA 4LLGF 3F23A 1XS9A 5F27A 1VQ9I 4GXOA 3SHFA 2VIXA 1XMXA 2EFWA 1MSFC 5FO5A 2IPQX 3ZN1A 5D4RA 2QQAA 3SFIA 4DYCA 4WWCA 3L2VA 3DV8A 3GFJA 2EV0A 2NVXJ 1JAWA 3MATA 2GG8A 4FO7A 3A0BC 3ZGKA 4ZC3A 4CA0A 2P5LC 3HUGA 2AS5F 5ILUA 2CW7A 1DGRM 1SFEA 2LK2A 4LFUA 4B3AA 1J75A 4JUQA 2KL4A 5FD5A 3N97A 1B59A 2FUG2 4DJAA 2KJBA 5FKLA 4OOIA 4YFNF 2H1LA 1HA8A 4IKRA 2GTXA 4IVNA 1B8IB 3T5XA 1E2XA 5IP7J 1I6HJ 2E1NA 1KU3A 4G8XA 4ABZA 4X1EA 4FLJA 4EM0B 1U6GA 1ZK8A 1HKSA 4IPAA 3GTJJ 3ESWB 1IG7A 3BROA 3SYTA 1IN8A 2HPIA 1TNTA 1ZQ3P 2Z9OA 4U6WA 1FOXA 1ULYA 4PFOA 4Y3OA 2VKDA 2ID3A 4CDGA 3E6CC 3R61A 2XKOA 3CCLI 3Q6DA 5BS6A 2DJIA 4QPOA 2EFQA 2KRCA 4V19K 2GG0A 4BJ5C 4CZZA 5E20A 4F52A 3RQ4A 4D5CA 1IRZA 4U6CA 4BEHA 5EZHA 3ZQFA 2CQXA 3FXJA 2LBFB 2HKXA 1ERDA 2KZGA 4L9JA 3O3KA 2WY8Q 3TAVA 2R7DA 4PFPA 5DD8A 4QSHA 1REPC 1UMQA 2NVTJ 4D1QA 2DDBA 2OA4A 3EUHA 5FKNA 3QRFF 4WX9A 2KZVA 3BG5A 4N4OB 1LE8A 5DUIA 1R7JA 2UWMA 5H20A 3MAJA 1MBKA 1YS7A 5EEGA 3DLAA 3J7YJ 2I8DA 3IKTA 4MEYF 5L3GA 1E3OC 2VKHA 4GYIA 3S8PA 2IJLA 3H0GJ 2TRTA 4IXAA 2K9QA 1WJDA 2XF7A 2BWTA 2MFZA 2DOFA 2PMZA 1B72A 1ZYRF 1USSA 3QPTA 2GGBA 3CP8A 2YUSA 2ZJPF 5B1BH 3H3ZA 4HQMA 2X1DA 3S16J 2L5QA 1YLFA 3BR2A 3L9FA 4NNJA 1XGOA 2WTEA 3A03A 4R79A 3E5QA 1S29A 3TOBA 3TP0A 2LBFA 1WCMJ 3EETA 1U8BA 2AQEA 5L3BA 1BR2A 1P7IA 2A61A 2Y9ZA 1EH6A 3NRVA 3PUBA 2E2JJ 4W1UA 3L24A 1K4TA 2CSOA 1SC7A 2NAZA 1NTCA 1LUJB 4LGWA 3SEQA 3ZMVA 1YO5C 3GXOA 1XSXA 2J5PA 1FMWA 3BR6A 2Y0MA 1HLVA 3KZIC 2MLKA 3WU2C 1S8NA 2XAHA 3BG3A 3KP3A 3K4JA 1R9TJ 2QENA 1WI9A 4HXXA 3GLXA 1HBXG 2VT3A 2BY0A 2F6CA 3CUQC 1O4XA 2RGVA 2QZ8A 2CG4A 1B72B 4D7NA 3GEZA 3PNVA 2FBIA 3L2CA 1WY2A 4KT6A 4OIPF 3F9KA 3H5RA 1M1EB 1RETA 4EJTA 3BCBA 5GAEJ 3LSJA 1CHMA 1ZRCA 1XGSA 4MFEA 3RTRA 5CQGA 1U8RA 2BHBA 1HC8A 1SD5A 4ASNA 2R7XA 2BE5F 2XB0X 3NARA 5IOZA 3VB2A 1JT6A 4GO1A 5F6FA 1Z77A 3WODF 4Y4RA 3WHBA 2QEXI 3S3MA 2D5VA 2R5ZB 1C0WA 4P96A 1Z7LA 1KA8A 1D3YA 1MMGA 4XLEA 3F22A 1I50J 1Y0NA 1AWCA 1WVRA 2LNBA 2OC6A 2W57A 3I58A 1VNDA 1EA3A 1U5TB 2IA1A 5FLMJ 3BT9A 4I99C 4HF0A 4BJ6C 2R92J 1RKWA 3VWBA 2EV5A 3CUOA 2DMTA 3HL2A 3U21A 3S6BA 4KJZA 5EZGA 2Y0SN 3KEQA 1H8AC 1BI3A 4CXFA 1OJLA 3WTSC 1TLHB 1EH8A 1W7VA 3GTQJ 4KA4A 3QYFA 4LK0F 4CCMA 2GGCA 1SD4A 2M8EA 3I55I 3MZHA 3IKVA 4CCKA 2ZJQF 2VPLA 4N9IA 4MEXF 1I1SA 1FEXA 3R4KA 4JYKA 1UHWA 3S93A 1H9GA 3CP2A 2WAEA 4G7ZF 3I59B 1Z21A 2ISYA 3CCJI 3MKLA 3QPLA 3B73A 3HHHA 2VE8A 1KYZA 2VKEA 5E8IA 5LLQA 1T2KA 2KIQA 2GOXB 2EV6A 2Y0SA 5BPDA 5EYRA 1C27A 4P9UA 3HEFA 1W5TA 3K2AA 1KQ0A 2BVLA 2YSRA 3K1MA 4HNUA 3K1NA 2HR3A 2E1OA 2IS1A 1ENHA 3JCUC 1UG2A 2BYVE 4U73A 3ZP5A 1JUMA 4PV4A 2X9DA 3BOQA 1XCBA 3EDPA 2J5OA 1D1CA 5JVTA 3R0JA 3CCSI 2A6EF 2LVSA 1BM9A 4KISA 2KKOA 2QM3A 2OCEA 2C6YA 4ZYAA 3BP8A 3A1YA 2BWXA 2DCEA 5D8LB 4M9XA 4UVAA 5F64A 1BW6A 2HKOA 2Q8KA 4AVPA 1FBUA 2IA0A 1OCCH 2L9SA 1E3HA 2KP6A 4S0HB 2HVRA 5B3SH 2RQPA 3RJPA 2FBHA 5FB2A 3F8FA 1TWFJ 3CCRI 2V1UA 1BI2A 4HNVA 2LOOA 3E3VA 4EJOA 4M6VA 3F21A 2XAUA 3VSKA 1A5JA 4HSRA 3CO6C 3F0CA 2FNAA 4UY8I 3IWFA 2EQRA 3MQ0A 2IP2A 2V4JC 2HOEA 1S6LA 3W2VA 1FY7A 2O5RA 2CRGA 4BE0A 2CWEA 5HODA 3OSGA 3TBIA 4E7IA 1C22A 2L3DA 1Z91A 4ESBA 3BQYA 2IS4A 2L9NA 1X1PA 1BJAA 4AIDA 1IC8A 1ORKA 3OYIA 3RPUA 1VQNI 3U1KA 4TV7A 3GTMJ 3OYDA 3GZ6A 2DA4A 3G4SI 4Q47A 1K61A 1DU0A 1LKXA 3VYTB 3GTLJ 3ISPA 2JUCA 3HSRA 2MW8A 1O3SA 3K1PA 2R7VA 4XLHA 2EH3A 4BDYA 1DPUA 2B3KA 3TL4X 1MMDA 2KDZA 2EB7A 3BG9A 1ETWA 2R3SA 3L09A 1YW7A 1VZ0A 4YIRX 1ZGWA 1AKHA 2ZFUA 2A68F 5F0CA 5KCMA 1XMAA 2HYGD 3TQNA 2H27A 3GW2A 1R5ID 4KN7X 2JUGA 2HWVA 1U3EM 2CQQA 2R7UA 3V42A 4HAMA 1IO2A 2BHCA 3WTTC 1QXYA 3L7GA 3BTLA 1K83J 1E3PA 1RPWA 1W1WE 1OMIA 2GIVA 2X6YA 5HS7A 4RBOA 5IYBJ 3ZQCA 2YPRA 3PKEA 2IW2A 2IS6A 2ELJA 2BEOA 3HPHA 1FT9A 3TO6A 3JRDA 4FCYA 2NXNB 4QPQA 1P4XA 1WL9A 2M4GA 2R93J 3QODA 4XLCA 1QNTA 4B1RA 2MA3A 2BWUA 2DFHA 3ZXSA 1XGMA 4KUMA 4G6TB 3F8BA 1V3FA 4XONA 4RB3C 4S2RP 4DZJA 2RN7A 2PG4A 4OAZA 5L3FA 2NRAC 2RVCA 4N4NB 2R7WA 2BBYA 4PJ0C 5E17F 2OZUA 1JT0A 3HDDA 3T1BA 4OAYA 5DCMB 1H0MA 4A3FJ 3M1CA 2M1BA 3E97A 2YS9A 1FYLA 4Y52J 3KEYA 3P7NA 2PJRA 3HSEA 1FOYA 2FJ1A 1TP4A 1T98A 2P5VA 2P9AA 1T08B 3FMRA 3KE2A 3F6VA 5M5XJ 3QP6A 1ZRFA 2A6TA 1R1TA 3FMSA 3GX4X 5M3MJ 2O8KA 3JRCA 3AKZA 5E79C 4A3CJ 4HV6A 2W25A 1XG1A 3LA2A 2IRFG 1Z05A 4ITVA 2OU2A 1YFHA 2W84A 4HF2A 1LE8B 4ZZDA 2Y2ZA 1R4NB 4GCVA 3G1MA 4RB2C 2P4WA 4GFBA 1T6SA 2DN0A 2L4AA 5HLTA 2DTZA 4IL6C 4IO9F 2W82A 4BQAA 4CCNA 2CO5A 3ERMA 3OSFA 2MGQA 2XF5A 3O8GA 3R0AA 2TCTA 2DT7B 3H3VK 2M8GX 1MJBA 1QZYA 1DGWY 3BQZA 4L9VA 3S32A 4L5IA 4ENKA 4XQFA 5FKKA 1GDTA 3OYNA 3D1NI 4Q4ZF 5E5BA 3QP5A 4LLLA 4HDUA 1MKMA 3QYEA 5FFZA 3LAJA 3BG6A 1EH7A 1K79A 2L4MA 3WHCA 4WXDA 3J81K 2OTJI 3ERED 5D8KB 3RKWA 1O0XA 4BKXA 3OYLA 3QOEA 1N78A 3WE2A 3CCUI 3LSHA 3H35A 3JAMZ 3MN2A 4ZYEA 1U78A 2QQBA 3EPZA 2CQNA 4XK4A 2ZB9A 2EZKA 2PQ8A 1FYKA 1JUPA 1P92A 1YOVB 1S7EA 2BHDA 1K6YA 1ETKA 2UUZA 1U9NA 2LKSA 1JHFA 2DBBA 4S05A 5LD2C 2KLOA 3JR9A 1TWGJ 3LOCA 4E7LA 4FX4A 3G1OA 2EILH 2Z16A 4BYYA 2XDVA 1X1DA 3GVAA 2HI3A 4B44A 3A01B 4FQGA 2NVUB 4RGZ1 5HVQC 3COAC 3HJEA 2LR8A 1AA7A 5LHGA 4S04A 3GZ5A 3G1LA 2XVCA 3RSNA 2BWWA 1LVAA 1FSEA 1G3TA 3EYYA 1Q1HA 2XF6A 4OIOF 2E60A 2V3ZA 3WGHA 4FUKA 4FTHA 1ZLKA 2CS3A 3HKZN 3PO3J 2AXTC 2IA2A 4ZYHA 1W0TA 1LDKB 2XAQA 3K9TA 3I71A 3S17J 5LGUA 1DP7P 2K27A 2OUMA 5IP6A 4OU0A 1ODDA 1FZPB 2BH3A 4A6VA 3HRUA 3CD6I 4JP0A 3JRFA 1F4KA 4RM3A 1ZLJA 1UG0A 2ZMEB 3DF8A 2DW4A 2LF8A 4AIKA 2STTA 3C7JA 3FXOA 2B7EA 5EEHA 5E3NA 3DEWA 2V9VA 2EVMA 4X0GA 1XSVA 4CYCA 3S1NJ 5IYDJ 1UFMA 2A5YB 2CUZA 3WE3A 2R7TA 2G6PA 4XM3A 2QVOA 3IP4B 2CUJA 5HDGA 4KIGA 4FE7A 3KPHA 3TDUC 2JA2A 3H0DA 2VI6A 4RS8A 4GDFA 3RORA 2PMZN 2IXSA 2GOMA 2DA6A 3JSPA 3CZ6A 2XAGA 3GLLA 2X1EA 1X3ZB 2E7XA 1HKTA 2R7FA 3O2PE 4YIIA 2JWTA 1T0FC 2QCOA 4HOBA 2E36A 3K70D 2PBIA 5DD4A 1I27A 1R5GA 5TJJA 2OF7A 2IEKA 3E6BA 2JT1A 4M9ZA 5HLHA 2G9WA 3RPQA 3JRGA 1A36A 4A69C 1FX7A 1Z7UA 4XNFA 2DA1A 2DOAA 3I59A 3AG4H 3CQZJ 2ETHA 4NHJA 2DQRA 3VDXA 2L02A 1MDMB 2M7BA 3Q9VA 1SFXA 2KMUA 2M0CA 3PIOF 1X4OA 3HYIA 4O5VA 5FKMA 3ZMDA 5LRRA 1BC7C 5F04A 2DK8A 3OMYA 4EEFG 1RKTA 4ANJA 3ABMH 3TGNA 3CCYA 4I76A 5J1UA 3ABUA 1TT5B 1VQPI 2L7MP 1UB9A 2DPDA 1LFBA 2DAOA 4HX8A 4FO8A 3KEOA 2LY2A 4BGDA 1XD7A 3BTCA 4IKFA 3HKZA 2O7OA 2VC1A 3BR1A 2Y9YA 4IECA 2W1OA 4WF2A 2ESNA 1WRJA 3QYBA 4C3HJ 1YJ9I 1RI7A 1V5EA 4L9NA 5IT3A 2H8WA 2KRHA 2K7LA 4M6XA 4EJWA 3D5RC 3DKWA 1BI1A 1BW5A 5CQEA 3RCOA 2MH2A 3CUQA 1LB2A 2JSPA 3DBHB 3IHUA 3V7SA 5JFRA 2GXBA 4B8XA 3OYEA 5GP9A 1I3AA 4U69A 3J7ZI 1GLNA 1B9NA 4R1HA 3L2QA 1V54H 1GVDA 3CC7I 2DO7A 3S14J 3ML6A 2AXLA 2BHAA 3OL4A 2XPWA 1A04A 4YFXF 1O7FA 3AFHA 3DWLE 1IDZA 5IY5H 2DXIA 3Q3SA 4I0AA 1UELB 3EUKL 3ZMTA 3HXLA 4EV0A 3Q5FA 1P7JA 5HS8A 1O57A 1R58A 1WI3A 2K9SA 4B47A 3M8FA 2BHYA 4GRIA 2VB6A 2JRTA 3E5UA 3K0LA 3S1MJ 4IU6A 1TT0A 3H5AA 2PFBA 1HXDA 2JQ7A 2DMPA 4L0ZB 1WLRA 3BITA 2K5CA 2ISZA 1P4AA 4NQWA 2JZYA 1QO0D 1LDDA 3TO7A 1L0OC 3RI4A 2L01A 2UXNA 2OQRA 1LEAA 4U7BA 2GG3A 4HF1A 2G7UA 1O3TA 4IOAF 1X4PA 4PCQA 1QGPA 2CGPA 2BZTA 1R71A 3P9KA 4DBQA 5LHHA 3LNQA 2BY1A 4P9FA 2EA2A 4PSXA 3BJ6A 2LC2A 2XRNA 5CVRA 4XLNF 2LFBA 4RDUA 4IHWA 1QU3A 4B28A 2FQ4A 5D5XB 5FRMA 3W3CA 1VI0A 2FRHA 3EUHC 1G3YA 1HDPA 2K86A 4P5OA 4XMYA 3FHNA 5DYMA 2QA4I 3W2WA 1YHQI 3LL7A 4BL0B 4A6WA 3BY6A 4D0PA 3DPLC 4ESFA 4G7HF 4LG0B 3K4LA 3Q0UA 3ECHA 4A12A 3SZGA 1N77A 3FBIB 3LSRA 1WJCA 4W97A 3I53A 4MQ9F 4A3BJ 1SVLA 1RZ4A 1W7PA 1QPIA 4Q5SF 4ZDPA 1R5HA 1D0ZA 4F91B 4DBRA 3L2UA 3CDIA 5K7FA 1MJ9A 1QXWA 3JRIA 4L5JA 3M1EA 1JHHA 3OYFA 4ZTFA 4B4CA 2A3SA 2ZNZA 4AU7A 1KU7A 1NK2P 4ZDOA 3PKBA 5DS9A 3I64A 1E17A 4EMSA 1JTYA 3GYHX 4MQVA 2O61A 2UV1A 3KP5A 2D2WA 2MD5A 3PNYA 5BMZA 1C24A 2PJRB 4IKTA 2ID6A 2EINH 5IYCJ 2LF7A 1T38A 3OIQA 1CF7B 2CW0F 4IHYA 5KNLA 2R7ZJ 5TISC 2P8TA 1OFCX 1SD7A 2O0YA 5FROA 3HG9A 4CCJA 4H4KC 5K5QA 1JI8A 3OS1A 2EA4A 3H9GA 3A02A 3WGIA 2XRLA 2MSYA 5J1YA 4JX6A 1MNDA 1LVKA 1O7LA 2BWVA 3FM3A 2EIJH 3OOPA 3JTGA 2IT0A 3IG4A 4M3FA 3I54A 1CF7A 3E6MA 1FJLA 3IH4A 3FM5A 1BBYA 1RUOA 3ONQA 2DYSH 1HOMA 4KMUX 3GFIA 3TP3A 5HS9A 1FLIA 5FCFA 1ZH5A 4FETA 1WSUA 1FTZA 2K3FA 4IJAA 4PSWA 1XNZA 2NS0A 2M34A 2EFPA 4HSTA 4O3MA 4UV8A 1WQ2A 3ECOA 1MMAA 2NS8A 3UNGC 1POGA 3BLYA 3CC4I 4C2UA 1YJNI 2UZKA 3ABLH 2LSOA 1USTA 2CFXA 2GG7A 1RR8C 2VN2A 5HNHA 4LITA 5AIQA 2IGKA 4XBFA 1Z3YA 4M3DA 5F08A 2B63J 4GGGA 1O3QA 3MCZA 1YYVA 2GQQA 3BWGA 3PO2J 1KYWA 2XGXA 3MKWB 1YQAA 3ULQB 1WFXA 1STZA 3ZQLA 1LEBA 2FX0A 3HC7A 1TC3C 2EFNA 4BQNA 4UUVA 4RAGA 1H9TA 4IRIA 2QSGX 5M5WJ 2K85A 4FKCA 3R60A 2WAFA 2ZFWA 4YG2F 4N9HA 5TRDA 3PL8A 3J80K 4ON0A 1W5SA 4CCLA 4K2EA 2OD5A 1LQ1A 1ZRDA 1IXCA 1TWCJ 3K2ZA 3S2DJ 1RC9A 2ZKZA 4E7KA 1TWHJ 4QLCU 1OYWA 4HA8A 4C9YA 4QTRA 2VJ5A 4J00A 2ZXJA 2FMYA 2HS5A 2XAJA 3L7WA 2GU7A 4KT5C 2QLZA 3D0SA 4Z6YA 3QU6A 3IH3A 2K9LA 2R7RA 4FT8A 2K40A 2LKPA 3RKYA 3RVAA 2V9KA 3FBNB 3NWTA 3H5NA 3M8EA 4EQQA 1WN1A 2DQLA 2RKHA 2RREA 5LBQA 1IUYA 2AQFA 3QPHA 1YX5A 1H88C 2JA8J 4NC6A 1Z67A 3MWMA 4BNCA 2QSHX 1W2MA 4PUSA 2WV0A 3OIPA 3OYGA 1NG7A 2H1KA 3SZPA 2R5YB 2QBYA 1IN5A 2HPMA 3IL2A 3TW6A 1I6XA 4MIMA 4UUTA 1F5TA 2QYOA 3HOXJ 1E0EA 1D1BA 1VTNC 1WH7A 4MFDA 5HDNA 4U1BA 3G3ZA 3IRQA 1IN6A 2NQ7A 2AHQA 4CSWA 3W6JB 3VEPA 3M8JA 3ZRGA 4DW6A 5DDGA 1VQMI 2E35A 3B6AA 4KNYA 1R36A 3WG7H 1K7AA 4PK4A 2Q1ZB 5GAGJ 1GVJA 4BUPA 1IUFA 3ZQIA 2Q93A 4QIWN 2LKXA 3CB6A 4XN0A 1IXSB 3P9IA 4ZWOA 1X1CA 1DUXC 3BCAA 1YS6A 2Y30A 4M73A 5LFAA 4M74A 5E1XA 2H8RA 4BE1A 2H94A 5LGTA 5B66C 5CVIA 5IT9Z 1ON1A 4U0WA 1IV6A 1G6NA 1TNSA 4BHCA 4RGXA 2O6GE 4UV9A 1Y1WJ 3K4MA 1OCTC 4OIRF 1MBFA 3MD2A 1FOKA 2BWSA 2WB1N 3I56I 2Y75A 1D0YA 3KX2A 4IEJA 2NVYJ 3I0TA 4YRVA 1Y6IA 3REOA 2OPTA 1IAWA 5CIKA 3FXMA 4AYBN 4RGSA 3I4NJ 2K9NA 2F5VA 5J1RA 1QBJA 5CLSA 3KYDB 3PQJA 3PM1A 5BPIA 2HZDA 3GBGA 2L9RA 1ON2A 3QWLA 4ENJA 3BPVA 1T8IA 3VFZA 4PJJA 2EIMH 2ESHA 4NUBA 1FIAA 2HVQA 2CMPA 2MG4A 4DQ2A 2XSDC 3M4OJ 4RZZA 1EKEA 1OYYA 5BNGA 1HW2A 2MLGA 3LFUA 1VQ7I 1J2XA 4CH7A 1WH5A 2V9PA 2Z2SB 3A4CA 1WWXA 1WKMA 4PJMA 3VYRB 5K5OA 5HOOA 4Q48A 2OV7A 1RESA 3H3UA 1XC5A 4KIBA 4Y17A 4O6JA 2KPMA 4FASD 4ZZLA 4PGHA 1W4MA 4A5MA 5GPAA 4A6DA 2L7ZA 4IX7A 5DUKA 3AL0C 2E5NA 5FCHA 3HUGB 1MJAA 3P5JA 1P9QC 4NDLA 2ZSIB 4LB5A 5L3DA 1T0FA 2QF7A 1WL6A 1OQYA 2Q96A 5EEAA 4KFCA 2F48A 1TW3A 4A3LJ 3OYBA 3CMEI 2H6BA 1U9OA 1BR1A 4IKUA 1GV2A 2BXYA 2R5YA 2DA3A 2O9LA 3K7AJ 3QQAA 1D1AA 4BY7J 4G6DA 4E7HA 4IOCF 5JLXA 2COMA 4BU2A 2HOAA 3NQOA 3DTEA 1WPKA 1B9MA 2E19A 3GFLA 4LOCA 3R6SA 1JKOC 2ZJRF 3AL0B 1YIOA 5F1JA 1FNNA 1T95A 3AG1H 5DEQA 1FSHA 1GHCA 3M07A 4XKBA 4EATA 3OR1C 4E7ZA 4DGWB 3TDZC 2GG9A 4BY1J 2XPVA 4KN4X 4C30A 2ECCA 3SXYA 4XSXF 1KQ8A 4P1WA 4LK1F 4KM3A 2DMQA 3K10A 4I01A 1G3SA 2X51A 1S72I 1QA6A 2JPCA 3P9CA 2K02A 3CF2A 4X6AJ 3ROUA 3OS2A 1T56A 5BQTA 1O3RA 4FISA 5FLXZ 2CJJA 3KP2A 3LSPA 2EFOA 5TGTA 3FF5A 2KDOA 3KFWX 5HDKA 2XIGA 3NWSA 4UUSA 2BB7A 3OS0A 3TB5A 5M5YJ 1JXSA 2XHKA 2YU3A 5D4SA 4ZDLA 4XOPA 1BL0A 1FBQA 1J09A 2EJRA 3HOVJ 3GMEA 4U6EA 2P0WA 3VOEA 3NEUA 4PDKA 1QQIA 5J47A 3N4MA 3HOUJ 3T8TA 1K6OA 1IW7F 3CCQI 4ENNA 2E1MB 4A3KJ 5K7HA 2I5UA 1S5LC 4B48A 1AHDP 3IU9A 2M4KA 4A2UA 2M9HA 1SAXA 3E6DA 2Q0OA 3A0HC 3KP4A 5EG0A 1KGSA 1R22A 1NH3A 1UHSA 2XSJC 2DMNA 4RLQA 3CCEI 3BPXA 1QXZA 3V7CA 3LWFA 5ILVA 3RDIA 4L9TA 4J01A 3LA7A 4ZNGA 5EF6A 2FSWA 1AKHB 5D5UB 1X19A 1U5TC 3HZJA 3LSKA 1UAAA 4YIFA 4Y15A 2FD5A 3CJQB 3HGGA 1ZKGA 4MGRA 3BZCA 5FGMA 3RQIA 3FDYA 2A05A 2K4BA 3JRHA 3GTOJ 1JUSA 3O6BB 3C2HA 4V2FA 2HOTA 4DZPA 2O8XA 2R0QC 2FEZA 1R4MB 3CTAA 3DXJF 5IPAA 5KAIC 4LMYA 4DYRA 2V3YA 2HQAA 1L3LA 1P4WA 1W7PD 1R6RA 5ICEA 3KLOA 4XOTA 5KAFC 1BI0A 1MNEA 1P2FA 1J9IA 1JKPC 4XSZF 3WTWC 3GFMA 3RIRA 2BWYA 2CQKA 4CCOA 3GTKJ 1TZLA 5C44J 3FXLA 1OYIA 5EGOA 3IUOA 2AO9A 1S7AA 1KP0A 3DBLB 3K4NA 2L9VA 5HNFA 1DP3A 1HQCA 3CUQB 3SDBA 1LDJA 1R49A 4AD9A 4LJZF 3FXKA 2LD5A 1PP8F 1Z3XA 2CW8A 4IQJA 4NC7A 1XGNA 3IRRA 1BC8C 2BV6A 2DTRA 1B1BA 1W36C 1ZG1A 5J4VA 1J5YA 4RMNA 3KLNA 1OKRA 3DU5A 2B0LA 4E7SA 2GIZA 1YJ3A 4I2OA 2PN6A 2ICWG 4C2MJ 1DU6A 1G59A 1K78B 2A5WA 3KIOA 3MVPA 2ZCWA 4NB5A 3UR3C 4MTEA 1A35A 1G8XA 3W6KB 2A6HF 2FOKA 2WAQN 4OMYA 1R1VA 4OMZA 2XKPA 2XGCA 3E7LA 1X3WB 5J8FA 5JHUA 3K6GA 5FLVA 3RKQA 3D5LA 1EV7A 4A3DJ 4HX7A 3JRBA 2O3FA 3HHGA 2NS7A 1AU7A 1FMVA 2KIMA 3ZPLA 1IRFA 3F72A 2L7FP 1TBXA 2GU4A 4LLNA 2E34A 2KHMA 4U7DA 1S9HA 1ZR2A 2GXAA 4HZFA 4IF4A 4MNUA 1IZ1A 3CF5F 2V1XA 5F0FA 4D7MA 2XROA 2M2EA 1I5ZA 1JKQC 2R4GA 3GF2A 1VQOI 4XKVA 5H6QA 2QGUA 2DLLA 3FK6A 1VF9A 1OISA 4YELA 2FE3A 3S15J 3FIWA 4LG0A 1MBGA 4M3BA 2GZ5A 2MBFA 3H9QA 3ZOBA 1J7KA 2K4JA 2VJIA 2HQ5A 3SQNA 2LREA 5E3LA 5GTIC 1YIJI 2W85A 3DEUA 4IHXA 4HQEA 2LTPA 3QU3A 3J81Z 1A6IA 2JTVA 2KT0A 2QKMB 3GTPJ 5CJ9A 2BN7A 3HRTA 2E1MC 2HTSA 4BBRJ 4F7ZA 1SAUA 2F4IA 2ZC2A 2ZNYA 2JK3A 2GM4A 1YRNB 1HSJA 4NBQA 4UB8C 1KQ9A 2VLAA 2MATA 4ZWPA 1MW7A 2WADA 1HKQA 3PFIA 1JJ8C 3OY9A 2DA2A 2V79A 1KONA 1X2NA 2RNJA 1ZREA 5CDEA 3E1SA 1P6RA 1YVMA 3BR3A 5H6RA 1UCRA 3CB5A 2V1DA 1SFUA 3DBRB 3CJTB 3MKYB 2M7AA 3LSGA 3WTVC 2DK5A 2ZSHB 2CH0A 2ELHA 1SFKA 1FC3A 4XICA 4XIDA 4C3JJ 4BDZA 3HPGA 3Q0VA 4DIQA 2CYYA 4ETSA 1IRGA 1RR7A 4IQ4A 4IHVA 2KQRA 3WG9A 2WBMA 2F5EA 2JVHA 3E0JB 1RIOH 5LGNA 2NOJB 3M7GA 3CLQA 3MMYB 3GCMA 1MBJA 1XTAA 1JTXA 1XSDA 4MTDA 2GA1A 3CDLA 2JPBA 3I9V2 1A31A 4U70A 5KK1A 3O8HA 2VE9A 4U6JA 1X1AA 4EGEA 3HBLA 4WXCA 3QOPA 1XDSA 1OPCA 1ZHFA 4KDPA 3RYRA 1BR4A 3KP7A 3ZMUA 3CJRB 5K5RA 1XN7A 4II3A 3BG7A 3PKDA 1KZHA 1GV5A 2X6WA 2YX4A 3K70C 2PMUA 4E4HA 3PSIA 4FHTA 1ZTRA 2FXAA 3JTHA 4ZH4F 5IT9K 1YITI 2KIFA 3K4CA 1DDNA 4CUGA 2WWYA 2ZXHA 2VT2A 3SFZA 2YU9J 3DTKA 5EJCA 4E7JA 2Q2EB 1V4RA 2VPRA 3HTUA 2DFEA 1LFUP 3F6OA 3I3LA 3MZYA 2M45A 4WCGA 1F36A 1I1GA 2W24A 3FXQA 4LIUA 3DU6A 1JGGA 4L5EA 6PAXA 3FXUA 5E8GA 4HNTA 3WTUC 5K7ZA 3C3WA 2P99A 2HTJA 2EVOA 1QHHD 3OWTA 2WA0A 5F0HA 2PX9A 1FYMA 2P98A 4ZJZA 1IGNA 4OIQF 5DCMA 4XN3A 4Y13A 1H89C 1MSEC 5D5VB 4R60A 5D5WB 2O03A 3QPSA 4EJVA 1IDYA 4I0BA 1YE9A 4DOZA 4U87A 5ED4A 4A5NA 3GUDA 4V2GA 1QRYA 4EJUA 4RAFA 2ZSGA 5ERIA 4AIHA 1U2WA 4RB1A 4U71A 4BE2A 1A6QA 2ZJ2A 1ACIA 4NQWB 4G9YA 4G7OF 2JSCA 4S01A 1OR7C 5DCFA 1TWAJ 4BHBA 5E3OA 5ILSA 2X85A 1D8JA 2P6TA 2P6SA 4M72A 4F93B 2HQNA 5FKOA 3T8RA 3MZ8A 1BOBA 2OZ6A 2HXOA 3DP7A 1RRJA 4XORA 1X1BA 2MC4A 1MATA 2LH9A 2OQGA 3LAPA 1WGXA 3FX3A 2HDDA 2COBA 2M5WA 5LHIA 2I10A 3Q9SA 2BVMA 4KIFA 3ZQQA 1K4SA 1ETVA 4HYEA 1QVUA 3IH2A 2K9MA 3VSLA 4UVCA 3BJAA 5GPCA 1YJWI 4L18B 4HX4A 3CO7C 1VQLI 2QKLB 4A0XA 2H6CA 1XMKA 2GG5A 2NOGA 1YI2I 3HTSB 5C4JJ 1WJAA 1T33A 1XDUA 1UZCA 1PP7U 3WU0A 3RKXA 2DT6A 4ZWUA 2RDPA 4OWRB 2VC0A 5FFXA 2CV0A 4G94A 2UXXA 2F2EA 3CJNA 3IWZA 4IRHA 4AM3A 1F43A 2VJJA 1ETXA 1YRNA 5B5EC 9ANTA 3D5SC 5KVRA 3DEEA 3ZCOA 2V6CA 2VQHA 4FLKA 3BR5A 2VBZA 3RYPA 3NAUA 3DQVC 4HLXA 4XRFA 4CYDA 1ZGJA 2YR2A 2H09A 2E1CA 2EVCA 3FK7A 5GAHJ 4CO8A 1N25A 1Y8RB 2VODA 3SZTA 2WAQA 3KYCB 4BXFA 5JVGF 3CCMI 1S3JA 2HQRA 3S2WA 2XC7A 3VPRA 2CFOA 3ZN0A 2E5ZA 2Y48A 4I7HA 4UXNA 1HCRA 4C3IJ 2MC3A 1IF1A 2ZMEC 1IN7A 2ZMEA 4KICA 4A0YA 2EPFA 1J0RA 2BW3B 1Y39A 4RLFA 3HGYA 2X48A 3ABTA 5CDVA 1SANA 2GU6A 2JRMA 4DNCA 2QQ8A 3V7RA 3M9AA 1PVEA 3KP6A 3Q0WA 4XR6A 1ZG5A 3ZQHA 3BTJA 1VFCA 1Y1NA 3G6EI 1FP2A 3MEXA 2P7CB 3I4MJ 1N51A 1EF4A 4EGZA 4BBSJ 3EUAA 4BAYA 1FBSA 2IBDA 3V8JA 3EQLF 2Z99A 4UHTA 2JMWA 4M71A 2DT5A 3TKYA 2V6EA 3F8NA 4JOMA 3FZVA 2MABA 3PNTA 3HOTA 1MGTA 2GWRA 4BHPA 4BQQA 3W2AA 4LB6B 5CPRB 1B8IA 2ZXIA 4U76A 2MH9A 4ENMA 3H9JA 2DPUA 2CUEA 3BC8A 2PJPA 5JHFA 3E5XA 3OYAA 4HRIA 2IGNA 2RNGA 4EM1A 1Z6RA 1OCRH 2GU5A 3I4PA 1HSTA 4A3MJ 4QR8A 2DOEA 2QQ9A 3AAFA 1WJBA 4R8HA 2CV2A 1I3QJ 2LDUA 2LRDA 1B6AA 3K4BA 4D9JA 1QVTA 2G0EA 2HGCA 5A2QZ 3C18A 2LYCA 4I09A 4H0EA 1I39A 2EZIA 2PMHA 4F3QA 2V3XA 2XUBA 1DPRA 2VL8A 3JW4A 2KIUA 3RZDJ 3HM5A 4WK8F 1SFOJ 3G71I 3ASNH 1Z9CA 2RC4A 1Z6TA 1LFPA 2VOOA 5E18F 1HDDC 4A93J 4P55A 2CQ7A 3FMQA 1ZARA 2PLYA 1BJZA 1TQIA 3I5UA 5J6XA 1ONVA 3IU7A 3MX6A 3V8LA 1M35A 2BY3A 5J40A 2STWA 2JA5J 1QZEA 1ITYA 2Q95A 4IRGA 4J19A 3C2BA 4ZTJA 5GADJ 1FP1D 4WXHA 3GWZA 2IVMA 2VQCA 2HNHA 2FF4A 4UUSB 2VKVA 1G2HA 2L54A 3A01A 3PFYA 3K69A 2VUMJ 2K3PA 1IN4A 2NYXA 5JI6A 1MH3A 2GAUA 4HBLA 5L3CA 1SD6A 2DFIA 2HVSA 3GZNB 2PI0A 1TW2A 2XPUA 2F4MB 2B3LA 3JRAA 1MZBA 3DLLF 1KU2A 2X4HA 3CMYA 2YX7A 4E6KG 1Y1VJ 1X58A 3B6CA 4JX5A 4RAYA 2LMDA 3OOUA 4HW0A 3M3YJ 4EGYA 4RZYA 2F5CA 2M87A 2NVQJ 4PZJA 4U0YA 3C1DA 3PSFA 2DA5A 3L2WA 4RAZA 3H1CA 4LD5A 4RB0A 3OR2C 4D5FA 3WTYC 4FLLA 1GXQA 3GO5A 5JR3A 4A3JJ 2F5FA 4BH9A 2ME0A 2IS2A 4DYQA 2JJ7A 2E7WA 1VQ5I 4HDVA 3OV8A 2ADUA 3LSMA 5DV5A 1CQTA 4CGZA 4I02A 3LA3A 1PUFA 2G7HA 3T0YA 2Y69H 1SVOA 1XB4A 4S00A 1K78A 1ETYA 3ABKH 2OTLI 3JSOA 4B43A 1BOAA 4A3EJ 3VYUB 3DPTA 2GBYA 2WY7Q 3PIPF 1LPQA 4GYGA 2OBPA 4M6YA 3FISA 4MLOA 3PKAA 2HEOA 3N05A 4U88A 1LNWA 2DYRH 4KYWA 1HW1A 3FHZA 1Q1VA 2QUFA 5CKTA 3KYLA 1GXPA 4IDYA 3BZ6A 4B09A 1NG6A 4JX4A 3CLOA 4M9SA 2M0MA 2Q94A 2NQ6A 4U75A 1BA5A 5GTHC 2Y31A 1IV8A 2Q2EA 2D1VA 3LSTA 4LG3A 4I6ZA 3J7AO 3IV5A 4A3GJ 4OOKA 4E70A 1D8KA 2GXGA 1QZZA 1MIJA 1U5TA 3ZQ7A 1VQ8I 4U6ZA 2VONA 2W48A 3J80Z 1ZN2A 2OKNA 4IHSA 2FNPA 2BOLA 3ELKA 1HF0A 2BW3A 3EYIA 2WC2A 2DI3A 4XRSG 1IJWC 5F1RA 2XASA 1Y0UA 3ZMSA 2VASA 1BIBA 2NNNA 1G4DA 5JLWA 4RGUA 2GLOA 3AG3H 3IC7A 5D6EA 4UNOA 2V1NA 3OIOA 2EBIA 3ZQGA 2HYFA 3TOAA 1OCOH 2WV1A 3DCFA 5IP9J 3A2KA 3V8KA 1WBQA 3LSIA 3SEZA 1X3UA 1QHGA 2CUFA 2LP0A 2XGDA 1D0XA 2HXIA 3DTIA 4PGGA 4Y7NJ 3H36A 3BZKA 3F3XA 3KZYA 4XRSA 1WZ2A 3SJMA 2F4OB 1ZGAA 2VQGA 2D1HA 2JA6J 4IHTA 3WU1B 1J59A 4BQOA 1ZELA 2BGCA 2A07F 3S1QJ 3HOYJ 1ETQA 2DFFA 1EJ9A 1V55H 3IU8A 3S3OA 2VBWA 4RGRA 2VBYA 2Z1DA 3S2HJ 3MFKA 3JREA 1U0JA 4RM2A 4N0BA 2R7OA 2DJNA 3LQRA 5M3FJ 1V5GA 2M3AA 3BIQA 1MBEA 4XLAA 2DA7A 5CVVA 3TO9A 1PUFB 1GT0C 1ETOA 2XB5A 4S2TP 1GUUA 2BHZA 1MBHA 1RNLA 5B1AH 2N8GA 5E3MA 4XL9A 1SEUA 2LLKA 1NK3P 1NHAA 2X6OA 2ME6A 3HIFA 3CC2I 4EVIA 4C2TA 3TMOA 2HU9A 1Z1DA 2FQ3A 5ICFA 1BIAA 4CYCB 1BN5A 3KETA 5J3LA 3CMAI 1Z0XA 2B3HA 2VOPA 2EIKH 5HLGA 1OR7A 1W5CC 1MNMC 2EZHA 4UB6C 5KHDA 2P5KA 1AOYA 3JAMK 4M3EA 1YW8A 2CV1A 3F8MA 4NC8A 4A3IJ 1TTYA 2HYJA 3B02A 4CHUA 4YEJA 3FKIJ 1YX3A 2F5DA 4JK1X 4MHGA 3DKYA 2ECBA 5E1ZB 5EDNA 3WTXC 5EGOB 1IRXA 2QBYB 3D27A 5AIPA 4XLPF 3VODA 2FA5A 5LEJA 3W6VA 5EG0B 2GZWA 4Z2YA 2VQLA 3K4KA 1PV9A 4I98B 1ZAOA 4CZCA 1YTYA 5IOYA 2L2OA 2OCCH 3HB9A 4PJLA 4AC0A 5DM6F 3GTGJ 4MATA 1WJ5A 5DM7F 2ZXWH 3L2RA 3U2RA 4XKCA 4AIJA 2P81A 2IGOA 2HOWA 2QSFX 1DQUA 2L7KA 1UJ8A 2W00A 1YG2A 3DKXA
chains in the Genus database with same CATH topology
3LFKA 2RV8A 2HDCA 1R23A 3U1DA 1ZG3A 1IXRC 4HV5A 3ZMZA 3MR1A 1F9NA 2D45A 3HRMA 2FU4A 4CICA 4KMFA 4ESJA 5A2QK 1B4AA 5ICGA 3DFGA 4A0ZA 2FBKA 5BOXA 1SMTA 2ACJA 2GG2A 1XCVA 3BJOA 3QAHA 2QWWA 2EK5A 5LEKA 2GA2A 4YFKF 4A6EA 1S7OA 4HLYA 2A69F 3FXRA 1SMYF 3G73A 3FWEA 1PDNC 4AWXB 5E1WA 4EM2A 1T39A 5HLIA 1F1ZA 2Q92A 2KRFA 1KU9A 3F8CA 5CVJA 5AONA 5CVUA 4JBAA 1D5VA 5CNXA 5FLXK 1FPQA 1MD0A 3H92A 2EWNA 3BDDA 3HOSA 2Z3YA 3L00A 4PNCA 1PUEE 2KJCA 5CYVA 4FLIA 2TDXA 3LQQA 5K1YA 3CDHA 5CE6A 1FWZA 3KZZA 1A16A 5FD6A 5D6FA 3V4GA 3HSFA 1TQPA 1LJ9A 4Z7MA 4U0VA 1MDMA 2ZBKA 3HRSA 1CGPA 1R1UA 2M30A 3BIPA 1JE8A 2Z5UA 1TQMA 2NNYA 1RUNA 5J8CA 1R00A 2ZO4A 3PQKA 4IF7A 2Z33A 2FMLA 4IKSA 4ZYGA 1G3WA 4BXUA 4ZYDA 3PKCA 1UHMA 2VXZA 1YW9A 2IW5A 1JGSA 2VBXA 4UVBA 1W7PB 2X0LA 5CDLA 3WTZA 4OINF 5ICCA 5L3EA 5LRSA 4G6QA 4QWQA 2XV4S 2XAFA 2DU9A 1C23A 2HZTA 3KCCA 3CTZA 2P7VB 4FX0A 1C21A 2PEXA 3WGGA 4JQFA 1HW5A 3U9GA 4L0YB 2HFHA 1QPMA 2OAZA 4LLGF 3F23A 4GXOA 3SHFA 2EFWA 5FO5A 2IPQX 3ZN1A 5D4RA 2QQAA 4WWCA 3DV8A 3GFJA 2EV0A 1JAWA 3MATA 2GG8A 4FO7A 2P5LC 2AS5F 3HUGA 5ILUA 1SFEA 4LFUA 1J75A 4JUQA 5FD5A 3N97A 1B59A 2KJBA 4OOIA 4YFNF 4IKRA 2GTXA 4IVNA 3T5XA 1E2XA 2E1NA 1KU3A 4G8XA 4FLJA 4EM0B 1U6GA 1HKSA 4IPAA 3BROA 1IN8A 1TNTA 2Z9OA 4U6WA 1ULYA 4CDGA 3E6CC 3R61A 2XKOA 3Q6DA 5BS6A 2EFQA 2GG0A 4CZZA 5E20A 4U6CA 2HKXA 4L9JA 3O3KA 3TAVA 2R7DA 5DD8A 1REPC 2OA4A 3EUHA 3QRFF 4WX9A 5DUIA 1R7JA 2UWMA 5H20A 3MAJA 1YS7A 5EEGA 3IKTA 4MEYF 5L3GA 4GYIA 2IJLA 4IXAA 2BWTA 1ZYRF 1USSA 3QPTA 2GGBA 3H3ZA 4HQMA 1YLFA 3L9FA 1XGOA 2WTEA 4R79A 3E5QA 1S29A 3TOBA 3EETA 5L3BA 2A61A 1EH6A 3NRVA 3L24A 2CSOA 2NAZA 4LGWA 3ZMVA 1YO5C 1XSXA 2J5PA 3GXOA 2Y0MA 2MLKA 1S8NA 2XAHA 3KP3A 2QENA 1WI9A 4HXXA 3GLXA 1HBXG 2VT3A 3CUQC 2RGVA 2QZ8A 2CG4A 3GEZA 2FBIA 3L2CA 1WY2A 4OIPF 4EJTA 1CHMA 1ZRCA 1XGSA 3RTRA 1U8RA 2BHBA 1SD5A 4ASNA 2BE5F 3VB2A 4GO1A 5F6FA 3WODF 1C0WA 4P96A 1KA8A 1D3YA 3F22A 1AWCA 2LNBA 2W57A 3I58A 1U5TB 2IA1A 4HF0A 2EV5A 3CUOA 3S6BA 3KEQA 1BI3A 4CXFA 3WTSC 1TLHB 1EH8A 1W7VA 4KA4A 4LK0F 2GGCA 1SD4A 2M8EA 3MZHA 3IKVA 4N9IA 4MEXF 1I1SA 3R4KA 1UHWA 1H9GA 4G7ZF 3I59B 2ISYA 3B73A 3HHHA 2VE8A 1KYZA 5LLQA 5E8IA 1T2KA 2EV6A 5BPDA 1C27A 4P9UA 1W5TA 1KQ0A 2YSRA 3K1MA 3K1NA 2HR3A 2BYVE 4U73A 3ZP5A 4PV4A 3BOQA 1XCBA 3EDPA 2J5OA 5JVTA 3R0JA 2A6EF 1BM9A 2KKOA 2QM3A 2C6YA 3BP8A 2BWXA 5D8LB 4M9XA 4UVAA 5F64A 2HKOA 2Q8KA 4AVPA 1FBUA 2IA0A 2RQPA 3RJPA 2FBHA 2V1UA 5FB2A 3F8FA 1BI2A 4EJOA 3E3VA 3F21A 3CO6C 2FNAA 3IWFA 3MQ0A 2IP2A 2HOEA 1S6LA 1FY7A 2CWEA 1C22A 2L3DA 1Z91A 4ESBA 1BJAA 3RPUA 4TV7A 3GZ6A 4Q47A 3ISPA 3HSRA 1O3SA 3K1PA 1DPUA 2B3KA 2EB7A 2R3SA 3L09A 1YW7A 2A68F 1XMAA 2HYGD 3TQNA 2H27A 3GW2A 4KN7X 2HWVA 1U3EM 4HAMA 2BHCA 3WTTC 1QXYA 3L7GA 1OMIA 2GIVA 5HS7A 2YPRA 3PKEA 2BEOA 1FT9A 3TO6A 1P4XA 1WL9A 1QNTA 2MA3A 2BWUA 1XGMA 4KUMA 3F8BA 1V3FA 4S2RP 4RB3C 2RN7A 2PG4A 5L3FA 2NRAC 2RVCA 2BBYA 5E17F 2OZUA 3T1BA 5DCMB 1H0MA 2M1BA 3E97A 1FYLA 3P7NA 3HSEA 1T98A 2P5VA 2P9AA 3KE2A 3FMRA 3F6VA 3QP6A 1ZRFA 3FMSA 1R1TA 3GX4X 4HV6A 2W25A 3LA2A 2IRFG 1Z05A 1YFHA 2OU2A 2W84A 4HF2A 4ZZDA 4GCVA 4RB2C 2P4WA 1T6SA 2L4AA 4BQAA 2CO5A 3R0AA 1MJBA 1QZYA 4L9VA 4L5IA 4ENKA 4Q4ZF 5E5BA 3QP5A 4LLLA 4HDUA 1MKMA 5FFZA 3LAJA 1EH7A 1K79A 2L4MA 4WXDA 3J81K 3ERED 5D8KB 3RKWA 1O0XA 3WE2A 3JAMZ 4ZYEA 1U78A 2QQBA 2PQ8A 1FYKA 1P92A 2BHDA 1JHFA 2DBBA 4S05A 4FX4A 4BYYA 3GVAA 4RGZ1 5HVQC 3COAC 5LHGA 4S04A 3GZ5A 2XVCA 2BWWA 1LVAA 1FSEA 1G3TA 3EYYA 1Q1HA 4OIOF 2V3ZA 3WGHA 4FUKA 1ZLKA 2IA2A 4ZYHA 1LDKB 2XAQA 3K9TA 3I71A 5LGUA 1DP7P 2K27A 4OU0A 1ODDA 1FZPB 2BH3A 4A6VA 3HRUA 1F4KA 1ZLJA 2ZMEB 3DF8A 2DW4A 2LF8A 4AIKA 2STTA 3C7JA 5EEHA 2V9VA 2EVMA 1XSVA 1UFMA 2A5YB 3WE3A 2G6PA 2QVOA 5HDGA 4KIGA 3TDUC 4RS8A 3RORA 3JSPA 2XAGA 2E7XA 1HKTA 2R7FA 3O2PE 4YIIA 4HOBA 2PBIA 5DD4A 1I27A 1R5GA 5TJJA 3E6BA 2JT1A 4M9ZA 5HLHA 2G9WA 3RPQA 1FX7A 1Z7UA 3I59A 2ETHA 4NHJA 2DQRA 2L02A 1MDMB 3Q9VA 1SFXA 3HYIA 4O5VA 3ZMDA 1BC7C 5LRRA 2DK8A 3TGNA 3ABUA 4FO8A 2DPDA 1UB9A 2DAOA 4HX8A 3KEOA 1XD7A 2VC1A 4IECA 4WF2A 2ESNA 1WRJA 1RI7A 4L9NA 5IT3A 2K7LA 4M6XA 4EJWA 3DKWA 1BI1A 2MH2A 3CUQA 1LB2A 3IHUA 3V7SA 5JFRA 2GXBA 4B8XA 4U69A 1B9NA 4R1HA 2DO7A 3ML6A 2AXLA 2BHAA 1A04A 4YFXF 1O7FA 4I0AA 3ZMTA 4EV0A 3Q5FA 5HS8A 1O57A 1R58A 3M8FA 4IU6A 2JRTA 3E5UA 3K0LA 2PFBA 1HXDA 4L0ZB 1WLRA 3BITA 2ISZA 1P4AA 4NQWA 2JZYA 1QO0D 1LDDA 3TO7A 3RI4A 1L0OC 2L01A 2UXNA 2OQRA 1LEAA 4U7BA 2GG3A 4HF1A 2G7UA 1O3TA 4PCQA 1QGPA 2CGPA 3P9KA 5LHHA 4P9FA 2EA2A 5CVRA 3BJ6A 4XLNF 2XRNA 4B28A 5D5XB 2FRHA 1G3YA 2K86A 4P5OA 5DYMA 4A6WA 3BY6A 4D0PA 3DPLC 4ESFA 4G7HF 4LG0B 3ECHA 4A12A 3I53A 4MQ9F 1W7PA 1RZ4A 4Q5SF 1R5HA 1QXWA 1MJ9A 4L5JA 3M1EA 1JHHA 2A3SA 2ZNZA 1KU7A 3PKBA 3I64A 1E17A 4EMSA 3GYHX 4MQVA 2O61A 3KP5A 2D2WA 2MD5A 5BMZA 1C24A 4IKTA 2LF7A 1T38A 1CF7B 2CW0F 2P8TA 1SD7A 2O0YA 5K5QA 2EA4A 3WGIA 1O7LA 2BWVA 3FM3A 3OOPA 3JTGA 2IT0A 3IG4A 3I54A 1CF7A 3E6MA 3FM5A 1BBYA 1RUOA 4KMUX 3GFIA 1FLIA 5HS9A 5FCFA 1ZH5A 1WSUA 4IJAA 1XNZA 2NS0A 2EFPA 4O3MA 4UV8A 1WQ2A 3ECOA 2UZKA 2LSOA 1USTA 2CFXA 2GG7A 2VN2A 5AIQA 4XBFA 4GGGA 1O3QA 3MCZA 1YYVA 2GQQA 3BWGA 1KYWA 2XGXA 1YQAA 3ULQB 1STZA 1LEBA 2EFNA 4UUVA 1H9TA 4IRIA 4FKCA 3R60A 2ZFWA 4YG2F 4N9HA 5TRDA 3J80K 4ON0A 1W5SA 4K2EA 2OD5A 1LQ1A 1ZRDA 1IXCA 3K2ZA 2ZKZA 4QLCU 1OYWA 4HA8A 2ZXJA 2FMYA 2HS5A 2XAJA 3L7WA 2GU7A 4KT5C 2QLZA 3D0SA 3QU6A 4FT8A 2LKPA 3RKYA 3M8EA 4EQQA 1WN1A 2DQLA 2RKHA 5LBQA 1IUYA 3QPHA 3MWMA 4BNCA 1W2MA 2WV0A 3SZPA 2QBYA 1IN5A 3IL2A 1I6XA 1F5TA 2QYOA 1VTNC 5HDNA 4U1BA 3G3ZA 3IRQA 1IN6A 2NQ7A 3W6JB 3VEPA 5DDGA 4KNYA 1R36A 1K7AA 1GVJA 2Q93A 3CB6A 1IXSB 3P9IA 4ZWOA 1DUXC 1YS6A 4M73A 4M74A 5E1XA 2H94A 5LGTA 5CVIA 5IT9Z 1ON1A 4U0WA 1G6NA 1TNSA 4BHCA 4RGXA 2O6GE 4UV9A 4OIRF 1FOKA 2BWSA 2Y75A 3I0TA 3REOA 1IAWA 5CIKA 4RGSA 1QBJA 5CLSA 3PQJA 5BPIA 1ON2A 4ENJA 3BPVA 3VFZA 2ESHA 4DQ2A 4RZZA 1OYYA 1HW2A 2MLGA 1J2XA 1WWXA 1WKMA 5K5OA 5HOOA 4Q48A 3H3UA 4KIBA 4Y17A 4O6JA 4ZZLA 4PGHA 1W4MA 4A5MA 4A6DA 5DUKA 5FCHA 1MJAA 4LB5A 5L3DA 1T0FA 1WL6A 2Q96A 4KFCA 1TW3A 2H6BA 4IKUA 4G6DA 2COMA 3NQOA 3GFLA 1B9MA 3R6SA 1YIOA 1FNNA 1FSHA 5DEQA 1GHCA 3TDZC 2GG9A 4KN4X 3SXYA 1KQ8A 4XSXF 4LK1F 4KM3A 4I01A 1G3SA 2JPCA 3P9CA 2K02A 3ROUA 5BQTA 1O3RA 5FLXZ 3KP2A 2EFOA 3FF5A 3KFWX 5HDKA 2XIGA 2BB7A 3TB5A 1JXSA 2XHKA 2YU3A 5D4SA 1FBQA 4U6EA 2EJRA 3VOEA 3NEUA 4PDKA 1QQIA 3N4MA 3T8TA 1K6OA 1IW7F 4ENNA 3IU9A 4A2UA 1SAXA 3E6DA 2Q0OA 3KP4A 1KGSA 1R22A 1QXZA 3BPXA 3V7CA 3LWFA 5ILVA 3RDIA 4L9TA 3LA7A 4ZNGA 2FSWA 5D5UB 1U5TC 4YIFA 4Y15A 4MGRA 5FGMA 2K4BA 3O6BB 2O8XA 2FEZA 3CTAA 3DXJF 4LMYA 2V3YA 1L3LA 1P4WA 1W7PD 5ICEA 3KLOA 1BI0A 1P2FA 1J9IA 4XSZF 3WTWC 3GFMA 3RIRA 2BWYA 2CQKA 1OYIA 1S7AA 1KP0A 1HQCA 3CUQB 1LDJA 4AD9A 4LJZF 1PP8F 1XGNA 3IRRA 1BC8C 2BV6A 2DTRA 1B1BA 1ZG1A 1J5YA 3KLNA 1OKRA 2B0LA 1YJ3A 4I2OA 2PN6A 1K78B 2ZCWA 4NB5A 4MTEA 3W6KB 2A6HF 2FOKA 4OMYA 1R1VA 4OMZA 2XKPA 5J8FA 5JHUA 3D5LA 1EV7A 4HX7A 2O3FA 3HHGA 2KIMA 3ZPLA 1IRFA 3F72A 1TBXA 2GU4A 4LLNA 4U7DA 4HZFA 4IF4A 4MNUA 1IZ1A 2V1XA 2XROA 1I5ZA 3GF2A 5H6QA 2DLLA 2FE3A 4LG0A 2GZ5A 2MBFA 1J7KA 2K4JA 3SQNA 2W85A 3DEUA 4HQEA 3J81Z 3QU3A 2JTVA 5CJ9A 2BN7A 3HRTA 2HTSA 4F7ZA 2ZNYA 1HSJA 1KQ9A 4ZWPA 2MATA 1HKQA 3PFIA 2V79A 2RNJA 1ZREA 5CDEA 1P6RA 1YVMA 5H6RA 1UCRA 3CB5A 2V1DA 1SFUA 3WTVC 2DK5A 2ELHA 1FC3A 4ETSA 2CYYA 1IRGA 3WG9A 2F5EA 1RIOH 5LGNA 3M7GA 1XSDA 4MTDA 2GA1A 4U70A 2JPBA 5KK1A 2VE9A 4U6JA 4EGEA 4WXCA 3QOPA 1XDSA 1OPCA 1ZHFA 4KDPA 3RYRA 3KP7A 3ZMUA 5K5RA 1XN7A 3PKDA 2YX4A 2PMUA 4FHTA 2FXAA 3JTHA 4ZH4F 5IT9K 2KIFA 1DDNA 2WWYA 2VT2A 3SFZA 1V4RA 3HTUA 3F6OA 3MZYA 2M45A 4WCGA 1I1GA 2W24A 3FXQA 6PAXA 3FXUA 5E8GA 3WTUC 3C3WA 2P99A 2HTJA 2EVOA 1FYMA 2P98A 4OIQF 5DCMA 4Y13A 5D5VB 4R60A 5D5WB 2O03A 4EJVA 4I0BA 5ED4A 4A5NA 3GUDA 4EJUA 2ZSGA 5ERIA 4AIHA 1U2WA 4RB1A 4U71A 2ZJ2A 4G7OF 4G9YA 2JSCA 4S01A 5DCFA 4BHBA 5ILSA 1D8JA 2P6TA 2P6SA 4M72A 2HQNA 3T8RA 3DP7A 2OZ6A 1MATA 2OQGA 3LAPA 3FX3A 2M5WA 5LHIA 3Q9SA 4KIFA 4HYEA 4UVCA 3BJAA 4L18B 4HX4A 3CO7C 4A0XA 2H6CA 1XMKA 2GG5A 3HTSB 1XDUA 1PP7U 3WU0A 3RKXA 4ZWUA 2RDPA 2VC0A 5FFXA 4G94A 2UXXA 2F2EA 3CJNA 3IWZA 4IRHA 5KVRA 2V6CA 4FLKA 2VBZA 3RYPA 3DQVC 4HLXA 4XRFA 4CYDA 1ZGJA 2YR2A 2H09A 2E1CA 2EVCA 4CO8A 2VODA 3SZTA 1S3JA 2HQRA 3S2WA 3ZN0A 2Y48A 4I7HA 4UXNA 2MC3A 1IF1A 1IN7A 2ZMEA 4KICA 4A0YA 1J0RA 3ABTA 5CDVA 2GU6A 4DNCA 3V7RA 3M9AA 3KP6A 1ZG5A 1Y1NA 1FP2A 3MEXA 2P7CB 1N51A 4EGZA 4BAYA 3V8JA 1FBSA 3EQLF 2Z99A 4UHTA 4M71A 2DT5A 3TKYA 3F8NA 3FZVA 3HOTA 2GWRA 1MGTA 4BHPA 4LB6B 4U76A 2MH9A 4ENMA 2DPUA 2PJPA 3E5XA 4EM1A 1Z6RA 2GU5A 3I4PA 1HSTA 4QR8A 3AAFA 2QQ9A 4R8HA 2LDUA 1B6AA 2HGCA 5A2QZ 3C18A 4I09A 4H0EA 2PMHA 2V3XA 2XUBA 1DPRA 3JW4A 2KIUA 4WK8F 1Z9CA 2RC4A 1Z6TA 2VOOA 5E18F 4P55A 3FMQA 1ZARA 2PLYA 1TQIA 3I5UA 5J6XA 1ONVA 3IU7A 3MX6A 3V8LA 1M35A 2STWA 2Q95A 4IRGA 1FP1D 4WXHA 3GWZA 2IVMA 2FF4A 2L54A 3K69A 1IN4A 2NYXA 5JI6A 2GAUA 4HBLA 5L3CA 1SD6A 2DFIA 2PI0A 1TW2A 2B3LA 1MZBA 1KU2A 2X4HA 2YX7A 4RAYA 4HW0A 4RZYA 4EGYA 2F5CA 2M87A 4PZJA 4U0YA 3C1DA 4RAZA 4LD5A 4RB0A 3WTYC 4FLLA 1GXQA 3GO5A 5JR3A 2F5FA 4BH9A 2E7WA 4HDVA 3OV8A 2ADUA 5DV5A 4CGZA 4I02A 3LA3A 2G7HA 3T0YA 1XB4A 4S00A 1K78A 3JSOA 1BOAA 3DPTA 4GYGA 2OBPA 4M6YA 3PKAA 2HEOA 4U88A 1LNWA 4KYWA 1HW1A 3FHZA 2QUFA 4IDYA 1GXPA 3BZ6A 4B09A 4M9SA 3CLOA 2Q94A 2NQ6A 4U75A 3J7AO 2Q2EA 2D1VA 3LSTA 4OOKA 4E70A 1D8KA 2GXGA 1QZZA 1U5TA 3ZQ7A 4U6ZA 2VONA 3J80Z 1ZN2A 2OKNA 4IHSA 2FNPA 3ELKA 3EYIA 2WC2A 2DI3A 5F1RA 1Y0UA 2XASA 3ZMSA 1BIBA 2NNNA 1G4DA 4RGUA 4UNOA 3IC7A 5D6EA 2HYFA 3TOAA 3V8KA 1WBQA 1X3UA 4PGGA 3F3XA 3KZYA 1ZGAA 2D1HA 4IHTA 3WU1B 1J59A 2BGCA 2A07F 3IU8A 2VBWA 4RGRA 2VBYA 3MFKA 4N0BA 3LQRA 3BIQA 5CVVA 3TO9A 4S2TP 1RNLA 1NHAA 3HIFA 4EVIA 1Z1DA 2FQ3A 5ICFA 1BIAA 1BN5A 3KETA 2B3HA 2VOPA 5HLGA 1OR7A 2P5KA 1AOYA 3JAMK 1YW8A 4CHUA 3F8MA 1TTYA 3B02A 2F5DA 4JK1X 4MHGA 2IW2A 2QBYB 3RVAA 5E1ZB 3WTXC 3D27A 5AIPA 4XLPF 3VODA 2FA5A 5LEJA 2GZWA 4Z2YA 1PV9A 4I98B