1WKMA

The product bound form of the mn(ii)loaded methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title EPR and X-ray crystallographic characterization of the product-bound form of the MnII-loaded methionyl aminopeptidase from Pyrococcus furiosus
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 92
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wkmA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wkmA01
3LQRA 5LEKA 3P9CA 4HXXA 2FNAA 2ZBKA 2HWVA 2YSRA 3WTYC 4Y17A 4KUMA 4AD9A 2GG8A 4WXDA 2BHCA 2R7FA 3WODF 1WKMA 1RZ4A 1DP7P 4BAYA 4M9ZA 5JVTA 4EGEA 2V1XA 4HDUA 1O3RA 5CYVA 2A68F 3I64A 3WE2A 1USTA 3N4MA 5CDEA 4KYWA 2BH3A 2G9WA 4KMFA 5HVQC 3S2WA 4ESFA 2FBHA 2KKOA 2XHKA 1J59A 2Q0OA 3L24A 4G6QA 2VBWA 4WWCA 3LQQA 5LEJA 5HS9A 2H09A 1B9MA 1CHMA 4LD5A 4MEYF 4S2TP 3BZ6A 1XCVA 3RVAA 1YFHA 3DPTA 4KT5C 2XAGA 4G94A 2NAZA 3WTSC 4MEXF 5E18F 2GZWA 1R36A 1JE8A 3F72A 2VXZA 5CJ9A 4UUVA 2HKXA 2Q95A 2UXNA 1QQIA 3QU6A 4OINF 4I0BA 3GF2A 1TW2A 2DTRA 4A6WA 1ZRDA 4IKRA 4MTEA 3JTGA 4P9FA 1FYLA 3DPLC 2STWA 5FLXK 2CSOA 2H94A 1LDKB 5FFXA 3WTUC 4HQMA 2G7UA 1ZG5A 4JQFA 2NNNA 2FF4A 3BY6A 2W84A 1XD7A 1UHMA 3QPTA 4GCVA 5JR3A 1QNTA 3CJNA 2GGBA 4LB6B 2DW4A 4N9IA 2OZ6A 4JUQA 3SZPA 2EFQA 3IU8A 1WWXA 5CE6A 4HZFA 2W25A 3CB6A 1TQPA 4QWQA 3I71A 2PMUA 3ZMZA 4P5OA 2K4BA 4ZYDA 4A0ZA 2LF8A 4EGYA 1LEBA 2ZKZA 3T1BA 4U6ZA 1ZN2A 4EM0B 1BI0A 3GO5A 1WQ2A 4HF1A 3U2RA 2M5WA 2BGCA 2VBZA 1ZREA 5AIPA 1T0FA 4S00A 1D8JA 1QZYA 4R8HA 3MFKA 1JAWA 3BIPA 4CO8A 3HRTA 1JHHA 2ZXJA 5E1ZB 5CLSA 5HDKA 5E1XA 4U1BA 1FC3A 2EVOA 1S8NA 5EEGA 3B02A 2GXBA 2V3XA 2A3SA 1LQ1A 1WSUA 1MJAA 3BJOA 1SD6A 4AIKA 2CYYA 4O3MA 2DAOA 2AXLA 5J6XA 2LDUA 2X0LA 2STTA 4I7HA 1KP0A 2BHBA 2M87A 3R4KA 2CFXA 4ESBA 2O6GE 3E97A 3G73A 3FMQA 1P4WA 3VB2A 4G7OF 1ZHFA 3FHZA 2GIVA 5FD6A 2QWWA 3H3UA 5LGUA 2FSWA 3JAMK 4FT8A 3K1PA 3L7WA 1WY2A 3VEPA 4AIJA 4BHCA 1HKTA 1BIAA 2K02A 4YG2F 2V3YA 5ILVA 1ZGJA 1QBJA 3PQJA 4IKUA 3JAMZ 2VN2A 2IW5A 1Z6TA 4LFUA 3WTVC 1D5VA 5HDGA 2MH2A 1U5TB 1MJ9A 3W6JB 3I54A 4XLNF 4U6EA 3FMRA 3CUQA 3J81Z 4KFCA 3TDZC 2HOWA 1IRFA 2FBIA 2Y48A 2HDCA 4G7ZF 1IN5A 4WF2A 2EA2A 3IKTA 1FLIA 4M74A 1YJ3A 4OIPF 3DF8A 3SQNA 1P2FA 2GTXA 1ZLJA 2DQRA 2RGVA 5A2QK 2B3HA 2MD5A 4MTDA 4N0BA 2Q8KA 1YS6A 2Q93A 4AWXB 4EJVA 1HW2A 4HX7A 2EV0A 1PP7U 4B8XA 1Z9CA 3FM5A 3HSFA 4E70A 3KP5A 3RYRA 5CDVA 3KP3A 2V1UA 2HGCA 3FMSA 5BMZA 2EV6A 2GG0A 4RGUA 4U7DA 1UHWA 2GG2A 4U69A 1O3TA 3FXUA 3C18A 3GYHX 1YQAA 4HX4A 1XB4A 1NHAA 3ZMSA 4P96A 2OQRA 2QQ9A 5IT3A 2FXAA 2FOKA 2XVCA 5CVVA 1ODDA 4EM1A 3SZTA 1PP8F 2V3ZA 4Q48A 4XSXF 3HRMA 2BN7A 4R1HA 1JXSA 1BIBA 1J9IA 1QZZA 3TO7A 1U3EM 4PGHA 1R58A 3ZPLA 4HA8A 4G9YA 1WL6A 2ADUA 1WI9A 1O7FA 2RC4A 5K5OA 3AAFA 5DD4A 4L9NA 3GVAA 1FSEA 1QGPA 1K7AA 1XMKA 2L3DA 4LLGF 3R0JA 1PV9A 4G7HF 3V8LA 3QAHA 5HS8A 4U7BA 3E6BA 4Q47A 1REPC 1UCRA 2BWWA 2DPDA 2L4MA 3DQVC 3OV8A 4EJUA 1KGSA 2BWSA 1JHFA 2DBBA 4WX9A 4Z7MA 2VT3A 1G3SA 4KIGA 4OIOF 4ZZDA 2O8XA 3OOPA 2FRHA 4HX8A 2QQAA 2LF7A 5DCMA 4GGGA 4U70A 5BOXA 2NNYA 2MBFA 3HHHA 4MNUA 4I98B 4OMZA 2GU4A 2JT1A 3P9KA 4HLXA 1W7PB 1Z91A 1IXSB 2Y0MA 4CYDA 3HUGA 3TB5A 5FD5A 2JPBA 1FBQA 2VONA 1AOYA 4KN7X 2VOOA 2HFHA 2P4WA 1OYWA 4HDVA 4L5IA 3I59A 2GZ5A 2P8TA 1XSVA 4UV8A 2P6TA 5F1RA 3SXYA 4ENJA 3IL2A 1IF1A 3MAJA 2ESHA 4RB3C 3GFLA 3KEQA 1ZGAA 1BN5A 3NRVA 2B3LA 3IWFA 3RKYA 2EFWA 4PCQA 2DO7A 1YIOA 2QUFA 1MATA 5FCHA 5DEQA 4LJZF 3C7JA 3CLOA 2DK8A 2Q96A 4EMSA 2ESNA 5D6EA 3BPVA 2VE9A 3F8BA 2F5CA 2K27A 3O3KA 2PG4A 1SMYF 2JSCA 1WL9A 2IW2A 4HF0A 3WTTC 3HRSA 4IJAA 3GEZA 2VODA 4A0XA 5ICGA 2GU5A 1MD0A 2Q94A 4CZZA 4JBAA 1SAXA 3BWGA 3KETA 1ZRFA 3LA2A 3T8RA 3WU0A 1AWCA 1LDJA 1R1TA 4U0WA 1T98A 4Y13A 3BPXA 3K1MA 1XGSA 4OIQF 3GZ6A 4P55A 5BPDA 3WGGA 3CUQC 3MWMA 2M1BA 3GLXA 2K7LA 4BHPA 4KDPA 1HW1A 3M1EA 4IRIA 2B3KA 3U1DA 3BDDA 3JTHA 3I5UA 2XKPA 2FQ3A 4U0YA 2O0YA 2HYFA 5L3BA 1ON2A 1G3YA 4KICA 2OQGA 3ZMTA 5E8GA 3IU7A 4FHTA 1VTNC 2HQRA 3TO6A 5DV5A 3RYPA 2GWRA 2HTSA 4BH9A 1BC7C 4OMYA 4LLLA 2EVMA 1U78A 3G3ZA 1QXZA 1Z1DA 2QENA 3F23A 3BJAA 3GFJA 2FU4A 2EB7A 5L3CA 3MX6A 3HIFA 2CO5A 1QXWA 1IN8A 3W6KB 5ICCA 5F64A 3T0YA 5L3GA 5D5XB 5A2QZ 3F8FA 1BM9A 2BEOA 4L9JA 1C23A 2NQ7A 2W57A 3HOTA 5HLGA 1Z6RA 2YX7A 2D45A 4RAYA 4P9UA 4XBFA 3REOA 3HSRA 2ACJA 5D5VB 3EUHA 3CUQB 2ZNZA 1U5TA 1YO5C 1IXRC 3IKVA 4ON0A 3J81K 3GZ5A 1HSTA 2W85A 2PFBA 3EETA 2GU7A 1SFUA 3E6DA 3NQOA 2FMLA 3CTZA 4MQ9F 1ULYA 2QYOA 4AVPA 2WV0A 2PLYA 2CWEA 4M73A 1SFXA 2HS5A 3MQ0A 2XAHA 4A5MA 3F8NA 1MJBA 3O2PE 5LBQA 4CHUA 2RDPA 5HLIA 2ISZA 1FSHA 1RUNA 1R7JA 5HDNA 4ZH4F 4Y15A 2OZUA 4GO1A 5D5WB 1OYIA 2KJBA 2NYXA 3EYIA 3RIRA 2H6BA 5H20A 2H27A 5CVIA 3GX4X 1K79A 2PN6A 1XGNA 4HW0A 1W7VA 3D5LA 1YW7A 2KIMA 3JW4A 2XRNA 5DD8A 2V9VA 3M9AA 1BOAA 1I1GA 5ED4A 2IT0A 3E6MA 1WLRA 3I59B 4UV9A 1ZYRF 4IDYA 2Z3YA 3L00A 5L3DA 4CDGA 5J8FA 4WXHA 2IA0A 1U8RA 2RN7A 3N97A 4KM3A 2Z33A 4MATA 3NEUA 2IP2A 2VC1A 4IXAA 1IAWA 3LSTA 2BE5F 4L9VA 4EJWA 3MCZA 2GA1A 2FMYA 4PNCA 1HKSA 4AIHA 2HZTA 3IRQA 1SD5A 3Q9SA 3KFWX 1XMAA 4I02A 2HEOA 3F3XA 2BWVA 3BROA 1KU2A 3V4GA 3FX3A 3KEOA 1BBYA 1T38A 2X4HA 3TOAA 2IPQX 2OBPA 4KN4X 1F9NA 4OOKA 1KQ0A 2JPCA 1A04A 1ZRCA 1H9GA 2VC0A 1P92A 5LRRA 1EH6A 5FLXZ 1J7KA 2G7HA 4EJOA 2XAQA 4ASNA 1YLFA 1XGOA 2MC3A 3Q5FA 1BC8C 4ZZLA 3TAVA 2ZO4A 3WGHA 2UWMA 1A16A 2CGPA 3QOPA 1FY7A 2MLKA 3ZMDA 5DUKA 2DU9A 1ONVA 1H9TA 1FBSA 3WG9A 2F5FA 5LLQA 4S2RP 1YVMA 5DDGA 3U9GA 2VBXA 3VOEA 4U0VA 3F6VA 1O3SA 4ENMA 1Z7UA 3M7GA 3WTWC 3PKDA 4EJTA 1T39A 4FLKA 1KU3A 2YPRA 3EDPA 3KLOA 4ZWUA 4Z2YA 3V8JA 1U6GA 1IRGA 2XKOA 2G6PA 4U75A 4ZNGA 1W4MA 4FLJA 1MZBA 2ZSGA 1IW7F 2EV5A 2EFNA 3F8CA 4A5NA 2J5PA 2HKOA 1WBQA 1LNWA 3L2CA 1LJ9A 1O0XA 1B1BA 5CIKA 4FKCA 2LSOA 2Y75A 2ZFWA 1Z05A 4HYEA 2L01A 3WE3A 3KZYA 2Z99A 5ICFA 3ZMUA 2A61A 5AIQA 2R7DA 2XROA 3K0LA 3Q6DA 5L3EA 5ILSA 4L5JA 2XAFA 5BS6A 3PKAA 1C27A 4U6JA 4GYIA 3RKXA 3BIQA 4BHBA 5L3FA 2UZKA 3HTUA 3HSEA 5AONA 1KQ8A 1GVJA 4JK1X 3QP5A 3FZVA 3E6CC 2O03A 4M9XA 1ZG3A 2PI0A 3MR1A 2EA4A 1JGSA 4YFNF 1I5ZA 1USSA 1D8KA 3QU3A 1M35A 1P4XA 3F8MA 4NB5A 1KQ9A 4HV6A 5CNXA 4HQEA 2MLGA 4EVIA 2VOPA 3K69A 1G6NA 5FCFA 1E17A 1EH7A 2GAUA 2EFOA 4YIFA 4S05A 3DP7A 2DFIA 2R3SA 1TNTA 2BWTA 1BI2A 4CICA 4PZJA 3O6BB 2GU6A 1XDSA 4O5VA 3LAPA 1STZA 2MATA 5DYMA 1G4DA 1C0WA 5K5QA 4OIRF 4LGWA 5LGTA 1SD4A 3DKWA 2P7VB 4UNOA 1KYWA 4I0AA 1RNLA 2DT5A 1R5HA 3PKBA 2QBYB 1ZH5A 1ZG1A 2E7XA 1DPUA 2K4JA 4ENNA 1C21A 2F5DA 2OAZA 1U2WA 2CG4A 4IPAA 4EQQA 2QQBA 4IVNA 3LA3A 4L0ZB 3TGNA 3C1DA 1Y1NA 3R61A 3RPQA 5E17F 4IF4A 4HLYA 3B73A 2GG7A 3KP6A 3ABUA 1LB2A 1G3TA 4M9SA 3GWZA 2A6EF 3E3VA 3L9FA 1E2XA 2HOEA 3HTSB 2BHAA 3QRFF 1ZARA 4IRGA 4ZYEA 3RI4A 2GA2A 1FX7A 3FXRA 1TBXA 2HQNA 2JRTA 5DCFA 1FWZA 3J80K 3TQNA 2YR2A 3FXQA 3KZZA 5E20A 4OU0A 1J2XA 4RS8A 1H0MA 4LG0B 1R00A 2XGXA 3DFGA 2P9AA 1CGPA 1IN7A 2ZJ2A 5CVUA 1MDMB 3F22A 1SD7A 4EGZA 4M71A 3ISPA 2P7CB 4NHJA 1Y0UA 3F21A 1UB9A 4LK1F 4RAZA 1HBXG 4CXFA 2P5VA 4KNYA 1F1ZA 1DPRA 2LNBA 5ILUA 4D0PA 2V1DA 3TOBA 1GXPA 3P7NA 1T6SA 4EM2A 3L7GA 4FX4A 2M30A 5HS7A 4S01A 3E5UA 2PEXA 2V79A 5TJJA 1X3UA 4WK8F 5IT9Z 1O3QA 4A6DA 3IRRA 5D6FA 5LHGA 1FP2A 4PDKA 3K2ZA 2P5KA 2ELHA 2VE8A 3ZP5A 1XDUA 3K9TA 4M6YA 2W24A 2BWYA 5E5BA 1N51A 4RGZ1 5D8LB 4A12A 1YYVA 3KP2A 3D0SA 2QM3A 1RI7A 2Q92A 2CQKA 2YU3A 3GUDA 1FPQA 2DI3A 1L3LA 4IHSA 3ERED 3FM3A 2GQQA 2TDXA 5FO5A 3M8FA 2DQLA 2COMA 4RZZA 1QXYA 4B09A 2O3FA 5FB2A 5CVJA 1TNSA 4YIIA 1DDNA 4XRFA 2FEZA 3H3ZA 3CO6C 5LHHA 2ZCWA 3DXJF 2P5LC 4LB5A 3HRUA 5CDLA 3DEUA 3I53A 1EV7A 1XN7A 1C24A 1ON1A 4NQWA 1ZLKA 4Q5SF 1IUYA 4IECA 3KE2A 4HOBA 1V3FA 1HKQA 4RB2C 4ZYGA 1LEAA 4U6CA 5H6RA 2WTEA 4U88A 2EWNA 2DLLA 3TKYA 1C22A 3RPUA 3V7CA 1KU7A 2HR3A 3KCCA 1PUEE 4QR8A 4A6EA 4FUKA 1D3YA 2PMHA 4G6DA 1K78A 2JTVA 1B9NA 3KP7A 3V7SA 2BWUA 1LDDA 4KIBA 3R0AA 3P9IA 2GGCA 5LGNA 4HV5A 1OYYA 2V6CA 3FF5A 3ZMVA 1TW3A 2HTJA 3I58A 3VODA 4ZYHA 1Q1HA 3GXOA 2D2WA 3PQKA 3D27A 5IT9K 2BHDA 3QPHA 3I0TA 2D1VA 2GXGA 1J0RA 4KMUX 3QP6A 4OOIA 4BNCA 3EYYA 1B6AA 1U5TC 1YG2A 1HQCA 1O57A 2RKHA 1TTYA 2PBIA 3ROUA 1GXQA 3TO9A 1YS7A 1R22A 2UXXA 4N9HA 2VT2A 4PV4A 4HF2A 2ZMEA 4MQVA 1O7LA 4ZWOA 1OMIA 2VBYA 2RQPA 4I2OA 4RB1A 1OPCA 4FO7A 5E8IA 2ISYA 1UFMA 5K1YA 2BWXA 5E1WA 3JSPA 3RORA 4UVBA 2IRFG 1K6OA 1HW5A 3CTAA 1S29A 2XASA 3M8EA 3JSOA 3GFMA 4YFKF 5HOOA 1FYKA 3SFZA 1MDMA 1HSJA 3KLNA 3DV8A 1PDNC 5BPIA 2F2EA 4IKSA 4GYGA 5FFZA 2YX4A 2EVCA 5TRDA 3LA7A 3CUOA 3TDUC 3ECOA 4U76A 2GG3A 3LAJA 3BOQA 2F5EA 2IJLA 5EEHA 1FOKA 1WN1A 4UXNA 4FX0A 3R60A 4UVAA 1RIOH 1I6XA 4CGZA 1GHCA 5KK1A 3FWEA 4DNCA 2MH9A 1S3JA 4FLLA 2L02A 1L0OC 1KU9A 4M6XA 2WWYA 2GG9A 4WCGA 2KIFA 1G3WA 4XLPF 3K1NA 1LVAA 2E1CA 4L9TA 3L09A 4GXOA 3C3WA 1FNNA 2BB7A 2XUBA 2AS5F 1R1UA 2L54A 4R60A 4IKTA 4RZYA 3V8KA 3BP8A 2E7WA 2A5YB 1MKMA 2XIGA 4HBLA 1FZPB 2M8EA 1BJAA 1TQIA 4A2UA 3CDHA 2QBYA 2DPUA 4BXUA 2KIUA 1V4RA 3S6BA 1IZ1A 2QVOA 3IU9A 1B59A 1TQMA 1XCBA 3E5QA 4PGGA 4LLNA 5LRSA 4U73A 2Z9OA 3H92A 2OKNA 1P4AA 1F5TA 3Q9VA 2P99A 3ECHA 1CF7A 2A6HF 4B28A 1KYZA 4L0YB 1IN4A 3COAC 4FLIA 5FGMA 5HLHA 2C6YA 1KA8A 2MA3A 5D8KB 3MATA 3RJPA 1XSXA 1R1VA 2JZYA 2QZ8A 2P98A 5JI6A 4H0EA 4I01A 1YW8A 1W5SA 3I4PA 2PQ8A 2NRAC 3CO7C 1DUXC 2H6CA 4DQ2A 1ZAOA 4K2EA 4LG0A 3SHFA 3R6SA 2BV6A 4MGRA 4S04A 2K86A 5CVRA 4ZWPA 2DK5A 6PAXA 2NS0A 1OKRA 2CW0F 2HYGD 2IA1A 2FNPA 4KIFA 5D4SA 1J75A 3LWFA 2XV4S 2L4AA 4O6JA 4YFXF 3BJ6A 2IA2A 3PFIA 2KRFA 3F6OA 2P6SA 4IRHA 1IXCA 1R23A 1QO0D 1W2MA 4MHGA 1SFEA 4HAMA 3HYIA 5LHIA 4RGRA 2FE3A 3J80Z 1P6RA 3ULQB 1I1SA 1XGMA 4FO8A 1S6LA 1I27A 5ICEA 1R5GA 1TLHB 2EJRA 1BI3A 2B0LA 4R79A 2PJPA 3RDIA 2ZNYA 5KVRA 4UVCA 2M45A 4QLCU 4ESJA 3HOSA 3GFIA 4UHTA 3V7RA 4IHTA 3EQLF 1T2KA 4WXCA 2Z5UA 1MGTA 2BYVE 3IC7A 1FYMA 5ERIA 2LKPA 2ZMEB 4TV7A 4IF7A 2A69F 3WTXC 2EFPA 4BQAA 1QPMA 4A6VA 2XAJA 4RB0A 3MEXA 2FBKA 5DUIA 5DCMB 4F7ZA 3VFZA 3ZQ7A 3ABTA 5H6QA 1B4AA 4A0YA 1W7PD 2OA4A 3BITA 3E5XA 1W7PA 4EV0A 2BBYA 4XSZF 3IG4A 1FBUA 1YW9A 3LFKA 3RKWA 4M72A 2D1HA 3WU1B 5BQTA 3MZYA 1XNZA 3T8TA 2QLZA 1SMTA 3WTZA 2O61A 4ETSA 4KA4A 1EH8A 3ELKA 1BI1A 1K78B 3PKEA 5J8CA 4U6WA 2EK5A 1IN6A 1XSDA 5D4RA 4RGSA 4L18B 3RTRA 4LMYA 2KJCA 1S7AA 1YTYA 5D5UB 4I09A 5JHUA 2J5OA 2E1NA 4BYYA 4G8XA 3MZHA 4U71A 2OD5A 1S7OA 5F6FA 4LK0F 3KP4A 2Q2EA 1FT9A 3ZN0A 5JFRA 2RNJA 4Q4ZF 2A07F 1F4KA 1RUOA 3J7AO 1CF7B 4IU6A 2GG5A 2RVCA 3GW2A 1FP1D 3T5XA 5K5RA 2NQ6A 2WC2A 1J5YA 3PKCA 3ML6A 3HHGA 3IHUA 2IVMA 3WGIA 4ENKA 1W5TA 1WRJA 1HXDA 3IWZA 3CB5A 2FA5A 1OR7A 2OU2A 2RV8A 4RGXA 2ETHA 3ZN1A
chains in the Genus database with same CATH superfamily
1LUJB 3LQRA 2H1KA 4M3EA 5LEKA 3P9CA 1BL0A 4HXXA 4C9YA 2FNAA 2GLOA 2ZBKA 2HWVA 2LC2A 3C2HA 2YSRA 3WTYC 2YUSA 2ZB9A 4Y17A 1BOBA 4KUMA 4AD9A 3AL0C 2GG8A 4WXDA 4NUBA 3SJMA 1JT0A 2KRHA 2BHCA 3GZNB 2R7FA 1WZ2A 3WODF 5M5XJ 1WKMA 1RZ4A 2WADA 2E2HJ 1DP7P 4RA2A 1IUFA 4BAYA 4M9ZA 5JVTA 1D5VA 4IHXA 1WJDA 4EGEA 4XLFA 2V1XA 3CJRB 2W48A 4HDUA 3BQZA 1O3RA 4HPQA 5CYVA 2A68F 3I64A 3WE2A 1USTA 3N4MA 5CDEA 4KYWA 3FXMA 2ZJQF 1Y39A 2BH3A 2G9WA 4KMFA 2K9NA 5HVQC 3ZQQA 2EIMH 2QSFX 4NDLA 3S2WA 4XLEA 4ESFA 2FBHA 2A05A 2KKOA 2XHKA 2BXYA 1J59A 2Q0OA 5IYCJ 4MIMA 3L24A 4G6QA 1TT5B 2VBWA 1AA7A 4WWCA 3LQQA 5LEJA 5HS9A 2KRCA 3ASOH 2H09A 1LE8A 1B9MA 1RC9A 1CHMA 1ETOA 4LD5A 4MEYF 2I8DA 4CYCB 2D5VA 4N4OB 4S2TP 1HC8A 3BZ6A 1XCVA 2Q1ZB 2GXAA 3RVAA 3Q0UA 1YFHA 3DPTA 4KT5C 2XAGA 3OYNA 4G94A 2NAZA 4XRSG 3WTSC 4MEXF 3GTGJ 4DYQA 5E18F 2GZWA 1R36A 3ZXSA 1JE8A 1K61A 3F72A 3QPLA 3JRBA 2VXZA 5CJ9A 3SDGA 1CQTA 2HKXA 4UUVA 2Q95A 2GIZA 2UXNA 1QQIA 3QU6A 4I0BA 4OINF 4C3HJ 3GF2A 4JYKA 3QPSA 1TW2A 2BW3B 2DTRA 4XOPA 1U8BA 4A6WA 1ZRDA 4IKRA 4MTEA 3JTGA 4P9FA 2HOSA 1IDYA 1W36D 2JUCA 2V9KA 1FYLA 3D5RC 2O7OA 3DPLC 2STWA 4F55A 5FLXK 2CSOA 2VQCA 2JA7J 2H94A 2W7NA 1LDKB 5FFXA 3WTUC 2HVRA 4HQMA 3TBIA 2G7UA 1ZG5A 5EJCA 2R5YA 1A36A 4JQFA 2NNNA 3FXOA 2FF4A 3BY6A 2W84A 1XD7A 3LSMA 1VQ4I 3IH4A 1UHMA 3QPTA 1BA5A 4IL6C 4Y3OA 2X1DA 1N75A 3G1MA 2O5RA 4GCVA 5JR3A 3H9QA 3OMYA 2IS1A 2IXSA 5BNGA 1QNTA 2IGKA 4DOZA 2ELJA 1X19A 1LVKA 1LKXA 3CJNA 3W2AA 2GGBA 3PNYA 4LB6B 3DLLF 4XMYA 2DW4A 3ABMH 4ZDPA 4N9IA 2OZ6A 3OYMA 4JUQA 2JMWA 3SZPA 1W1WE 2EFQA 3QYEA 3CP8A 1Z0XA 2EQRA 1QVUA 3IU8A 1WWXA 3ERMA 5CE6A 3HPGA 4HZFA 1ZR2A 4XKWA 4HRIA 2W25A 1YJNI 3LSHA 4B44A 4F3QA 3CB6A 2LOOA 1TQPA 4QWQA 3I71A 2PMUA 3ZMZA 2JA2A 1AKHA 1LFPA 4P5OA 2K4BA 4ZYDA 4A0ZA 3PUBA 2LF8A 4EGYA 4QPQA 1S9HA 1LEBA 2ZKZA 3BR6A 3T1BA 4U6ZA 4LITA 5EG0B 2OUMA 3OIOA 3BG5A 1ZN2A 4PJ0C 4EM0B 1BI0A 3GO5A 1WQ2A 3A01A 4HF1A 3U2RA 2M5WA 2BGCA 2VBZA 1KONA 1ZREA 5AIPA 5KAIC 1T0FA 4S00A 1DU6A 2X85A 3G71I 1D8JA 1PJRA 1QZYA 4R8HA 3MFKA 1JAWA 1NK3P 4Y33A 3BIPA 4CO8A 1GLNA 4PJLA 1OCOH 3HRTA 1JHHA 2VPRA 1OQYA 3E1SA 3F0CA 2ZXJA 3S14J 5E1ZB 4C3JJ 3LSPA 3PNTA 5CLSA 5HDKA 1ERDA 1R4MB 1YRNB 2EPFA 4XN0A 5E1XA 4U1BA 1XPXA 2MD0A 1G8XA 3I56I 1FC3A 1TZLA 2EVOA 3N05A 1S8NA 1WJCA 3B02A 5EEGA 1M1EB 2GXBA 2V3XA 2A3SA 2M0CA 1LQ1A 1VQPI 1UG2A 4CUGA 1WSUA 1MJAA 1IJWC 4G6TB 2R0QC 3BJOA 1O4XA 3GLLA 1SD6A 1NH3A 3GTPJ 4AIKA 2CYYA 3BR0A 3L2UA 2R7RA 4O3MA 1JKQC 2DAOA 5DM7F 3VYSB 4JOMA 2AXLA 2B63J 1JJ6C 5J6XA 2LDUA 2X0LA 2EILH 3KZIC 2STTA 1RETA 3CCJI 4I7HA 1KP0A 2AO9A 2BHBA 3MKLA 5IY5H 4HNUA 2M87A 1K4SA 3R4KA 2CFXA 2Y2ZA 4ESBA 3CMMA 2O6GE 3E97A 3HB9A 4F91B 4U87A 1JI8A 2L7KA 3G73A 3FMQA 1P4WA 3VB2A 1FJLA 3K6GA 4ZTFA 2CUFA 4G7OF 1ZHFA 3FHZA 3HBLA 2GIVA 5FD6A 2QWWA 3H3UA 5LGUA 4UB6C 1UELB 2FSWA 3JAMK 3S1QJ 3HL2A 1P7IA 4FT8A 4AU7A 3K1PA 3L7WA 5F0FA 1JJ8C 1WY2A 4DYRA 2ZC2A 1VQNI 3PO2J 3LSIA 3VEPA 4AIJA 4BHCA 1HKTA 1BIAA 2K02A 3DEEA 4YG2F 2V3YA 5ILVA 3DWLE 4B3XA 1ZGJA 1QBJA 3PQJA 4IKUA 3JAMZ 5DM6F 4BE2A 2VN2A 2IW5A 4BGDA 4QPOA 1Z6TA 4LFUA 2ZXWH 3WTVC 2KISA 2MH2A 5HDGA 5EGOA 4M3BA 4BU2A 5JVGF 4LIVA 2JUGA 1U5TB 2VB6A 1MJ9A 3W6JB 3I54A 3PIOF 4XLNF 4U6EA 5E79C 3AKZA 3FMRA 2OTLI 3CUQA 3J81Z 4KFCA 3ZQLA 3QOEA 3TDZC 2HOWA 3QYFA 1IRFA 1Z7LA 3CMYA 2FBIA 3BTCA 2Y48A 2DJIA 2WY7Q 5J47A 2HDCA 3OIQA 4IHYA 4G7ZF 3BLYA 3AG2H 3ZQGA 1IN5A 4WF2A 2EA2A 3IKTA 1FLIA 2F4IA 4BE0A 4M74A 4A3MJ 1RRJA 2R7TA 1YJ3A 2R92J 5GAEJ 4OIPF 1JKRC 3MKYB 1E0EA 3DF8A 1B8IA 3BG6A 2XSDC 2HXOA 1P2FA 3SQNA 2QEXI 2AXTC 2GTXA 1APLC 1ZLJA 2FUG2 1Y8QB 4RAGA 2DQRA 2RGVA 1VF9A 5A2QK 2B3HA 2AQEA 2IGNA 2MD5A 4MTDA 4N0BA 2Q8KA 1MBGA 1YS6A 2VJ5A 1ZGWA 2BZTA 4XR6A 3HOUJ 4AWXB 4EJVA 2Q93A 4IOCF 1HW2A 4ITVA 4HX7A 1WFXA 2EV0A 1PP7U 3TW6A 1K4TA 4B8XA 1Z9CA 3FM5A 3HSFA 1WH7A 3QODA 4E70A 3KP5A 3RYRA 1ITYA 5CDVA 3ZCOA 3KP3A 2KLOA 2GOXB 5K7FA 2ZJPF 3SEQA 2V1UA 2IBDA 2HGCA 4XONA 1NK2P 2M0MA 3OYLA 3FMSA 3ZRGA 5IP6A 3MVPA 2EV6A 5BMZA 5GAHJ 2GG0A 4RGUA 4U7DA 1UHWA 3CESA 2PJRA 2MC4A 5C3EJ 2GG2A 1VQ8I 2ZXIA 4U69A 4PK4A 3CD6I 4A3FJ 1O3TA 1FIPA 3FXUA 5HNHA 4UY8I 3OYHA 3C18A 3GYHX 1T56A 1YQAA 4HX4A 2E5NA 2HPMA 1XB4A 5FRMA 5JLWA 1NHAA 1OCPA 1XS9A 3ZMSA 4A3IJ 2RQQA 2JA6J 2CQQA 2QA4I 4P96A 5DTDA 2OQRA 1GDTA 3JREA 2QQ9A 5IT3A 2FXAA 2FOKA 2XVCA 5CVVA 4A3EJ 1ODDA 4EM1A 2HPIA 3SZTA 1PP8F 1IDZA 2V3ZA 4HG2A 4Q48A 5J4VA 2NVQJ 5C4XJ 2LYCA 3S15J 2OCCH 1EJ9A 2K85A 3C2BA 4HSRA 4XSXF 3HRMA 2BN7A 4R1HA 2DT7B 1X1DA 2JJ7A 1JXSA 1BIBA 1J9IA 2PMZN 2R5ZA 3H9GA 4JX5A 4M3DA 1QZZA 2M7BA 4PJNA 3TO7A 2DMTA 2YU9J 1U3EM 4PGHA 1R58A 4XLHA 3ZPLA 3AG3H 1QHGA 4HA8A 4G9YA 1WL6A 2XPWA 3G1LA 2ADUA 1WI9A 1O7FA 2RC4A 4F92B 1DU0A 3HJEA 5K5OA 3AAFA 1R49A 4NNJA 2TCTA 3ONQA 2VQGA 5DD4A 4L9NA 3GVAA 1U0JA 1FSEA 3DTIA 1QGPA 5JHFA 1Z77A 3DEWA 2JA8J 3F9KA 3SZGA 3S16J 1K7AA 1U9OA 3JR9A 1XMKA 2L3DA 2JK3A 1FOWA 2BY2A 4LLGF 1VZ0A 1X2NA 1FTZA 3R0JA 1PV9A 2E2IJ 4G7HF 2R7QA 3V8LA 3QAHA 3RCOA 2DMQA 1TWGJ 2BHZA 3CF5F 5HS8A 2CS3A 4U7BA 3H3VK 3E6BA 1WH5A 4Q47A 1REPC 1UCRA 3K4LA 3SEZA 2BWWA 2DPDA 2L4MA 3DQVC 3IV5A 3OV8A 4EJUA 1KGSA 5K7ZA 2BWSA 1JHFA 2DBBA 2HXIA 4F93B 5IOYA 4WX9A 3U21A 4Z7MA 1DQUA 2VT3A 2DXIA 1G3SA 3TP3A 4PUSA 5K7HA 2HVQA 4KIGA 3OYGA 4OIOF 2O8XA 4ZZDA 3OOPA 1TWCJ 4HSTA 4RLQA 3KPHA 2LLKA 2FRHA 4HX8A 5TISC 1SVOA 3I3LA 2QQAA 2LF7A 5DCMA 1HOMA 4GGGA 4U70A 4C3IJ 5BOXA 4CCKA 2V6EA 3OOUA 2NNYA 2VUMJ 2MBFA 3HHHA 3A0HC 2MW8A 4MNUA 4I98B 4C2UA 2CRGA 4OMZA 3WHBA 3RQ4A 5M5YJ 2VJIA 1X4PA 2GU4A 2JT1A 4M3GA 4B1RA 2Z2SB 3P9KA 4HLXA 4UUSA 1W7PB 2FOWA 1Z91A 1IXSB 2Y0MA 4CYDA 4E4HA 1EA3A 4I6ZA 1MNMC 4YEJA 3IH2A 2JRMA 2MFZA 3DTEA 3HUGA 3FIWA 3S3NA 4A3CJ 3TB5A 1RKTA 1VQ6I 5FD5A 1X4OA 4II3A 2JPBA 1FBQA 1XG1A 4OAZA 3RPUD 2VONA 1AOYA 4IZZA 2VXDA 3K4MA 4KN7X 2VOOA 3FHNA 1ZR4A 2HFHA 2P4WA 1OYWA 3CCLI 4HDVA 4B4CA 4L5IA 4MO7A 2L9NA 3I59A 2GZ5A 2P8TA 4I76A 2NVUB 3H35A 2OPTA 1XSVA 2V7FA 4UV8A 5B1AH 3DU6A 3PM1A 2P6TA 5F1RA 3SXYA 5EEAA 1OR7C 4ENJA 2M3AA 4X6AJ 3GTJJ 3IL2A 1B72B 1IF1A 2NVXJ 1R5ID 1E3PA 3MAJA 2ESHA 3H9JA 3O8HA 4GRIA 3TP0A 4RB3C 3GFLA 3KEQA 4J19A 2M4KA 1ZGAA 2QCOA 1BN5A 2CW8A 4X1EA 3NRVA 2B3LA 3IWFA 4RAFA 3RKYA 1VFCA 2EFWA 4PCQA 2DO7A 5CQGA 1YIOA 2QUFA 1POGA 4EEFG 1XTAA 1MATA 5FCHA 5DEQA 5J3LA 1OCZH 4LJZF 3FDYA 3C7JA 3CLOA 2DK8A 1Y56A 2Q96A 4EMSA 2ESNA 3ESWB 5D6EA 9ANTA 3BPVA 2VE9A 3CDIA 3F8BA 2F5CA 2K27A 4C30A 3O3KA 2PG4A 3BTJA 2HOAA 1SMYF 2JSCA 1WL9A 2LD5A 4HF0A 2IW2A 3WTTC 3HRSA 4IJAA 2ZFUA 3GEZA 2VODA 3M3YJ 2JVGA 4A0XA 5ICGA 2GU5A 1MD0A 2Q94A 1Z3YA 2W82A 4J01A 1AKHB 5IP7J 4CZZA 2KQRA 4JBAA 1SAXA 4LOCA 2XF6A 3BWGA 3KETA 4JP0A 1ZRFA 3LA2A 3T8RA 1YITI 2E35A 3WU0A 4AC0A 2M2EA 3M07A 3S17J 1AWCA 5LFAA 2Y31A 1W5CC 1LDJA 1R1TA 4NBQA 2DCEA 4U0WA 1T98A 4Y13A 2L7ZA 3M1CA 3DKYA 3BPXA 3W2WA 4OWRB 3K1MA 1XGSA 4BY1J 1S7EA 2DJNA 4OIQF 2XRLA 2Y0SN 3GZ6A 3TL4X 3RKQA 4P55A 4IQ4A 3WGGA 5BPDA 4MFDA 5J1UA 5TGTA 2LG4A 1V5GA 2KZVA 3H5AA 3V42A 3CUQC 3LL7A 3MWMA 2M1BA 1SAUA 3GLXA 2K7LA 1YRNA 4BHPA 3G1OA 1HW1A 3M1EA 4KDPA 3GMEA 4IRIA 2B3KA 3U1DA 4P1WA 4XKVA 3BDDA 3JTHA 3I5UA 2XKPA 2FQ3A 4N4NB 2AHQA 2VQHA 1BR4A 4U0YA 4CCJA 2L9SA 2ELKA 2O0YA 2LBFA 1V5EA 2HYFA 1ON2A 1G3YA 5L3BA 4KICA 2OQGA 3ZMTA 5E8GA 3IU7A 4FHTA 2EIJH 1VTNC 2HQRA 2BVLA 3TO6A 5DV5A 3RYPA 2GWRA 2HTSA 3OR2C 3DLAA 2DOAA 3FKIJ 4BH9A 1BC7C 4OMYA 4LLLA 3O8GA 2EVMA 1U78A 3G3ZA 1QXZA 1Z1DA 1ETWA 4NC6A 1V54H 2QENA 3F23A 3BJAA 2KDZA 3HOWJ 2DFEA 3GFJA 1YX5A 2FU4A 2EB7A 2VKVA 2W4SA 2X6WA 3P5JA 4IO9F 3CC7I 5L3CA 3MX6A 4C2TA 2K9LA 5FKKA 5KCMA 3HIFA 4CYCA 2CO5A 3MMYB 5LD2C 1QXWA 2IEKA 1IN8A 3W6KB 5ICCA 5F64A 3T0YA 4E7JA 5L3GA 1WJFA 4D7MA 5D5XB 1FEXA 5A2QZ 3ABLH 1I39A 3F8FA 1H8AC 2R7SA 2LMDA 1BM9A 2QSGX 2BEOA 1JTXA 4L9JA 1C23A 4CCOA 2ECBA 2NQ7A 2A5WA 2W57A 3HOTA 2NXNB 5FJ8J 3DKXA 1ZKGA 1Z6RA 2YX7A 5HLGA 2LY2A 2D45A 4D1QA 4D5FA 2RAEA 1YJWI 4RAYA 1Q1VA 2ZMEC 4E7ZA 4P9UA 2VIXA 4XBFA 3IP4B 3TW7A 2HI3A 3REOA 3HSRA 2ACJA 5D5VB 2I5UA 3EUHA 3CUQB 2OF7A 2ZNZA 1U5TA 1YO5C 4PJMA 2X6OA 1E3OC 1IXRC 3IKVA 5F08A 1S5LC 4ON0A 3J81K 2UV1A 1S72I 3GZ5A 3GTOJ 1HSTA 2W85A 2PFBA 3EETA 2GU7A 2KZGA 1SFUA 3VWBA 3E6DA 3NQOA 2FMLA 3PFYA 3CTZA 4MQ9F 1ULYA 2DMUA 1GT0C 3QWLA 3KYDB 3S3OA 2QYOA 4AVPA 2WV0A 4IHVA 3B6AA 4L5EA 2PLYA 2H1LA 2CWEA 4M73A 1SFXA 2HS5A 2L2OA 2CV0A 4V2GA 1A5JA 3I4MJ 3PO3J 3MQ0A 3BG3A 2FJ1A 3JRHA 1P7JA 2XAHA 4A5MA 2CQNA 4XICA 3F8NA 1Z67A 1MJBA 3O2PE 5LBQA 4CHUA 2JWTA 3FXKA 5GPCA 1A31A 2RDPA 5HLIA 3OSFA 4Y7NJ 1QVTA 1BJZA 2ISZA 1HA8A 1FSHA 2TRTA 1RUNA 1R7JA 4ZC3A 4B43A 5HDNA 3AG1H 4BXFA 4ZH4F 4Y15A 2H8RA 3K2AA 5C44J 2OZUA 3FISA 3UR3C 4GO1A 5D5WB 1OYIA 2KJBA 1YI2I 2NYXA 4PSXA 5J1RA 3EYIA 3RIRA 2H6BA 5H20A 5FROA 2H27A 1MBEA 2X1CA 2GBYA 5CVIA 3GX4X 1FIAA 2MSYA 1K79A 3L2RA 2PN6A 3HUGB 2DA4A 1XGNA 4HW0A 1W7VA 2WY8Q 3D5LA 1YW7A 4AIDA 2KIMA 3JW4A 2K5CA 2XRNA 5DD8A 2V9VA 1RESA 3M9AA 1BOAA 1I1GA 3ZQHA 4V2FA 5ED4A 2IT0A 3E6MA 2X9DA 1EKEA 4E7IA 1WLRA 3I59B 2DA2A 4KISA 4UV9A 1ZYRF 2DYSH 1VQ7I 1A6QA 4IDYA 5KNLA 2DA3A 2H8WA 2K3PA 2PX9A 4BJ5C 2Z3YA 3L00A 5L3DA 2EIKH 4CDGA 1MSEC 4A3KJ 1B72A 4CSWA 5J8FA 4WXHA 1MMDA 2IA0A 4DBQA 4Y52J 4B3AA 4E7SA 2M34A 1MSFC 2QKLB 3J7YJ 1U8RA 2LVSA 2RN7A 3N97A 4KM3A 2E1MC 4RLFA 2Z33A 2X6YA 4XLCA 1IV6A 1A35A 2BOLA 4C2MJ 4MATA 3NEUA 1WJBA 2IP2A 2VC1A 4IXAA 2EH3A 4FE4A 1LFUP 1IAWA 1DP3A 3LSTA 3OYIA 2BE5F 2WA0A 4L9VA 4EJWA 3MCZA 2GA1A 2FMYA 1HF0A 4PNCA 1HKSA 2ICWG 4AIHA 3NWTA 1FTTA 2UUZA 2HZTA 3IRQA 2KMUA 4NC7A 1GV2A 2KFDA 1SD5A 2OCEA 2QSHX 3GTLJ 1F36A 2KP6A 3Q9SA 1GV5A 3QYBA 3KFWX 1YHQI 2MG4A 1XMAA 4I02A 3OWTA 2HEOA 1G59A 3F3XA 4MLOA 2JN6A 2LK2A 4ANJA 1SFOJ 1QHHD 2BWVA 3BROA 1KU2A 3V4GA 1UHSA 1IO2A 3FX3A 4IX7A 3IH3A 3UKGA 3KEOA 1BBYA 5GTHC 2X4HA 4I99C 3OYBA 1T38A 4EATA 3TOAA 5KHDA 4BQOA 2IPQX 2O9LA 2IGMA 4XIDA 4Z6YA 3HOXJ 2OBPA 3ABKH 4KN4X 1F9NA 3NAUA 4OOKA 1KQ0A 4A3JJ 2JPCA 2Y30A 1A04A 1TWFJ 1ZRCA 3LSKA 1H9GA 1MBHA 2VC0A 3VDXA 2HYJA 1P92A 3S1NJ 5LRRA 4M3FA 2COBA 2DA6A 1P9QC 1EH6A 2E34A 5FLXZ 2K9QA 4CCLA 1J7KA 2G7HA 4EJOA 1BW5A 2KPMA 2XAQA 4ASNA 1E3HA 1YLFA 2DYRH 2VQLA 3EUHC 4DZPA 4RBOA 1XGOA 1R71A 5J1YA 3CP2A 3BCBA 3OYJA 2MC3A 3Q5FA 3AL0B 5H2FC 1YOVB 4ZZLA 1BC8C 2ZO4A 2QQ8A 3TAVA 3WGHA 1OLTA 2UWMA 2HU9A 3VYUB 2O8KA 4BBSJ 1A16A 2WAQA 2CGPA 1FOYA 3QOPA 1FY7A 4GFBA 3KYCB 2MLKA 3ZMDA 5DUKA 2VJ4A 1I6HJ 3VYRB 2DU9A 1ONVA 3Q0VA 1H9TA 1EF4A 1W0UA 4W97A 1FBSA 3WG9A 4BEHA 5F1JA 2F5FA 4BUPA 1ETYA 4BXXJ 1F43A 5LLQA 3J7AY 4IOAF 3A02A 4S2RP 1YVMA 5DDGA 3U9GA 2VASA 2VBXA 3VOEA 4E7LA 4U0VA 3F6VA 2VI6A 1N77A 1O3SA 4FISA 4ENMA 1Z7UA 3M7GA 3WTWC 4JX6A 3PKDA 4EJTA 1T39A 1MNEA 4FLKA 1KU3A 5GP9A 3CCRI 2YPRA 3EDPA 3KLOA 3OYKA 2Y69H 5FKLA 1QZEA 4DJAA 3C2GA 2FQ4A 4ZWUA 4Z2YA 3V8JA 1U6GA 1V55H 1IRGA 2XKOA 1ETKA 4QIWN 2DMPA 2G6PA 2DN0A 4U75A 4ZNGA 4ABZA 1W4MA 4FLJA 3M4OJ 3HPHA 1MZBA 2R7WA 2ZSGA 1IW7F 2EV5A 3S2DJ 1D1CA 2EFNA 3F8CA 4A5NA 2J5PA 4FCYA 1JTYA 2HKOA 1WBQA 1LNWA 3L2CA 2ZJRF 1LJ9A 4BE1A 1O0XA 1UG0A 2E36A 1B1BA 5CIKA 1MNDA 4BS9A 3CC2I 4FKCA 2LSOA 5M3MJ 2Y75A 3OR1C 4V19K 2ZFWA 3BZKA 1Z05A 2BHYA 2F4MB 4HYEA 3NARA 2L01A 3WE3A 1TC3C 3H36A 2Z99A 3KZYA 2JA5J 5ICFA 3ZMUA 2A61A 3OIPA 5AIQA 2DA7A 2R7DA 3VPRA 2XROA 3K0LA 3Q6DA 3FK7A 2NOGA 4A69C 3KYLA 4KT6A 5L3EA 5M5WJ 3UNGC 5ILSA 4L5JA 2XAFA 5BS6A 4GDFA 4BACA 3CCUI 3PKAA 4ZJZA 1UZCA 1UJ8A 1C27A 1N25A 3EUKL 5HNFA 4U6JA 3FBNB 4GYIA 3RKXA 1XX5A 3BIQA 4BHBA 3B6CA 1OISA 2DT6A 5L3FA 2UZKA 3HTUA 3HSEA 3ZQCA 5F27A 5AONA 1PYVA 3FKJA 1KQ8A 1GVJA 4IHWA 4JK1X 3QP5A 1DGRM 2M8GX 3FZVA 5FKNA 2O03A 4LIUA 3E6CC 3S2HJ 1YE9A 4OAYA 4M9XA 2LTPA 4J00A 1OCTC 1ZQ3P 1MMSA 1ZG3A 2LY9A 2LBFB 1I3QJ 2PI0A 4BEHB 1SFKA 3MR1A 2EA4A 3HXLA 1JGSA 5IPAA 1R6RA 3A2KA 4YFNF 3G2BA 2NVTJ 1I5ZA 1USSA 2VL8A 1D8KA 3QU3A 1M35A 3Q3SA 4QTRA 2R7ZJ 3DBLB 2R5YB 1P4XA 3F8MA 1SC7A 4NB5A 2YS9A 3PSFA 1KQ9A 3K4CA 4HV6A 3K70C 5CNXA 4HQEA 3DBHB 2MLGA 2WAFA 3H0DA 1MW7A 4EVIA 3IAS2 2VOPA 3K69A 1G6NA 2CUEA 1QU3A 5FCFA 3SYTA 1E17A 1EH7A 4A93J 2GAUA 3S1MJ 2EFOA 4YIFA 4S05A 3DP7A 2DFIA 2R3SA 1TNTA 2BWTA 4RM3A 1BI2A 1TP4A 4CICA 2OJED 3H1CA 3A03A 4PFPA 3FBIB 3HZJA 3O6BB 4PZJA 2GU6A 1XDSA 1ZK8A 4O5VA 3LAPA 1STZA 2MATA 4ZTJA 5DYMA 1G4DA 1C0WA 5K5QA 4OIRF 4LGWA 1H88C 5LGTA 1SD4A 4DZJA 2BY1A 3W3CA 1FOXA 2XC7A 4BDZA 3DKWA 3D1NI 1ETXA 3X2QH 2XPVA 2P7VB 3MN2A 5EG0A 1LFBA 1VQ9I 3PJRA 4UNOA 1KYWA 2DOFA 2ZSHB 4I0AA 5B5EC 1JUSA 1RNLA 2DT5A 1R5HA 4XK4A 3PKBA 2QBYB 1ZH5A 1TWAJ 2WV1A 3GTMJ 1D0ZA 1ZG1A 2E7XA 2HOTA 2HVSA 1DPUA 2K4JA 4ENNA 4QSHA 1C21A 2Y9YA 1OCCH 2DTZA 2F5DA 2OAZA 2L9VA 2WAQN 3OL4A 2XF7A 1U2WA 2CG4A 4IPAA 4EQQA 2QQBA 2XGCA 4IVNA 3GCMA 3LA3A 2K3FA 4L0ZB 3TGNA 1WCMJ 3OY9A 3AFHA 3C1DA 1Y1NA 3R61A 3RPQA 5E17F 1X3ZB 3BR3A 4IF4A 4XORA 2CJJA 3EPZA 4HLYA 2MGQA 3B73A 3CCQI 2F48A 2GG7A 2EBIA 1D5YA 3KP6A 3ABUA 2DODA 2LREA 2P81A 3RZOJ 1LB2A 1G3TA 4DIQA 4CCMA 4M9SA 3GWZA 2A6EF 5EZGA 2MYSA 3CMEI 3E3VA 1VQLI 3L9FA 1E2XA 2HOEA 3HTSB 4H4KC 2BHAA 3QRFF 1ZARA 4BKXA 1G2HA 4IRGA 4YRVA 5FKMA 2E2JJ 4ZYEA 3RI4A 1ZELA 1FX7A 2GA2A 3FXRA 1TBXA 2LH9A 2HQNA 2JRTA 5DCFA 1FWZA 3IAM2 1WJAA 1NTCA 3J80K 3TQNA 2YR2A 3FXQA 2XSJC 3KZZA 5F0CA 3W2VA 2VKHA 5E20A 4OU0A 1J2XA 3PL8A 3MZ8A 4RS8A 3BTIA 3DU5A 1K83J 1H0MA 1LPQA 2KDOA 3DBRB 4E6KG 1MBKA 3ZR8X 1R00A 4LG0B 2XGXA 4FETA 3DFGA 3RSNA 2P9AA 1IN7A 2ZJ2A 1MDMB 5CVUA 2M4GA 3F22A 1CGPA 1Y0NA 2N8GA 1SD7A 3HKZN 4EGZA 4M71A 3ISPA 2DA5A 2P7CB 1T08B 4NHJA 2VPLA 3HKZA 1Y0UA 1YX3A 3F21A 5GPAA 1UB9A 3K4JA 1FMVA 2NS8A 4LK1F 4RAZA 1HBXG 4CXFA 2P5VA 4KNYA 4IKFA 1F1ZA 3JRIA 1DPRA 2RNGA 3BQYA 4BY7J 2LNBA 2CU7A 5ILUA 3A4CA 4RDUA 4CZCA 4D0PA 5J4YA 2V1DA 3TOBA 1GXPA 3P7NA 1T6SA 4EM2A 3L7GA 4FX4A 1BR2A 2V26A 1MMGA 2PMZA 1MH4A 2L0KA 2M30A 4Y4RA 5HS7A 4S01A 1IRXA 3E5UA 2M7AA 2PEXA 3MD2A 3CCSI 2V79A 5TJJA 1X3UA 4WK8F 5IT9Z 1O3QA 4A6DA 3IRRA 5D6FA 2X6XA 5LHGA 1FP2A 4PDKA 2BY0A 3K2ZA 2P5KA 2ELHA 2VE8A 3ZP5A 1MBJA 1XDUA 3K9TA 4M6YA 2K9SA 2W24A 2ID6A 2BWYA 2DMNA 5E5BA 5GADJ 1N51A 4BQNA 4RGZ1 5D8LB 1Z21A 1J09A 1YYVA 4A12A 1VI0A 3KP2A 4LG3A 3D0SA 2QM3A 1RI7A 2GM4A 2Q92A 2CQKA 2YU3A 3GUDA 4XLAA 1B8IB 1FPQA 1WVRA 2DI3A 4PFOA 2WAEA 3H0GJ 1L3LA 4IHSA 3ERED 3FM3A 2GQQA 2TDXA 2XB0X 5C4JJ 5FO5A 3M8FA 3ZGKA 5EZHA 1X2MA 2R7UA 1JUMA 2DQLA 2COMA 4RZZA 1QXYA 1WHUA 4B09A 2O3FA 5FB2A 1X58A 5CVJA 2HQ5A 1TNSA 1HLVA 4XKBA 4YIIA 1DDNA 2CUJA 4XRFA 5B66C 2FEZA 2JQ7A 2M9HA 3H3ZA 3D5SC 2FD5A 2DFHA 3FK6A 3CO6C 4PJJA 4FE7A 5E3NA 4B48A 3HM5A 4XKCA 5LHHA 2ZCWA 3BZCA 3K70D 3DXJF 4IQJA 2P5LC 4LB5A 2CMPA 4XQFA 4YIRX 4ZDOA 3HRUA 2K9MA 5FLMJ 3DEUA 3I53A 5CDLA 1RPWA 1EV7A 1XN7A 1MMNA 2LKSA 1C24A 1ON1A 4NQWA 1ZLKA 4Q5SF 1IUYA 4IECA 3KE2A 4HOBA 1SANA 2CV2A 1V3FA 3QQAA 1HKQA 4RB2C 4ZYGA 3CCVI 4A3BJ 3EUAA 1LEAA 4U6CA 5H6RA 2EZLA 2WTEA 2XGDA 2E60A 4U88A 2EWNA 2DLLA 3TKYA 1C22A 1A6IA 5JLXA 3RPUA 4RM2A 5GAGJ 3OS0A 3V7CA 1KU7A 1PVEA 2HR3A 3KCCA 3WG7H 1PUEE 3S3MA 3BG9A 2BXZA 2F4OB 1RR7A 4QR8A 2E1OA 5EDNA 4A6EA 3HOVJ 3MKWB 2WB1A 3BT9A 2LFBA 4XRMA 4FUKA 5CQEA 3PUFA 1D3YA 4XN3A 4DW6A 2L7MP 2PMHA 4G6DA 1K78A 2JTVA 1B9NA 2ID3A 3KP7A 1TWHJ 3PSIA 1LDDA 3V7SA 3DPUA 4KIBA 1ACIA 2BWUA 3R0AA 3P9IA 2GGCA 1U9NA 5LGNA 2HDWA 4HV5A 3H5RA 3CDLA 1OYYA 4KITB 2V6CA 3FF5A 3ZMVA 4CA0A 4XOTA 3L1PA 1TW3A 2HTJA 3I58A 3OYEA 3VODA 2V1NA 4ZYHA 5IYDJ 2IS4A 1Q1HA 2KT0A 3GXOA 2D2WA 3PQKA 3D27A 3K7AJ 3K10A 5IT9K 4XRSA 3L2WA 1GUUA 2Y9ZA 2BHDA 3QPHA 3I0TA 1UMQA 2D1VA 1IV8A 1Y1VJ 1J0RA 2DDBA 2GXGA 3I9V2 4KMUX 3QP6A 4OOIA 4BNCA 3EYYA 3KIOA 1B6AA 1U5TC 4E7HA 1YG2A 1HQCA 1ENHA 1O57A 1I50J 2ZXHA 2RKHA 1TTYA 2PBIA 3ROUA 1GXQA 2R7VA 3TO9A 1YS7A 1R22A 2UXXA 4CH7A 1UAAA 4N9HA 2VT2A 1HDPA 1Y1WJ 4PV4A 4HF2A 4II2A 2ZMEA 4MQVA 1O7LA 4ZWOA 1OMIA 3L2VA 2VKEA 1W0TA 2VBYA 2RQPA 4I2OA 4RB1A 1OPCA 4FO7A 2CQ7A 5IP9J 5E8IA 2ISYA 1UFMA 1WJEA 5K1YA 2BWXA 3OL3A 2HDDA 2F6CA 5E1WA 2XB5A 3JSPA 3RORA 4UVBA 3TMOA 5E3OA 2EZHA 3DTKA 2IRFG 1K6OA 1HW5A 3CTAA 4DBRA 1S29A 2XASA 1Y8RB 3M8EA 3JSOA 1JKPC 3GFMA 3G4SI 1N78A 4HEA2 4YFKF 5HOOA 2IGOA 2QF7A 1FYKA 3SFZA 3LSGA 1HSJA 1MDMA 4UB8C 3KLNA 2ME6A 3DV8A 1PDNC 1AU7A 5BPIA 2F2EA 4IKSA 4GYGA 3BR5A 5FFZA 3HOZJ 2YX4A 2EVCA 2LKXA 5TRDA 2A6TA 1R4NB 3LA7A 2Y0SA 1VQOI 3CUOA 3TDUC 3S8PA 3ECOA 4U76A 3I55I 2GG3A 2GOMA 1QA6A 3LAJA 2CQXA 4MFEA 3BOQA 2F5EA 2IJLA 5EEHA 3DCFA 1FOKA 1WN1A 2QKMB 4AVZA 2CUZA 4UXNA 3HGYA 4FX0A 1PUFB 3R60A 2IS2A 4UVAA 5HLTA 1RIOH 1I6XA 4CGZA 1GHCA 5KK1A 5F0HA 3HG9A 2JVHA 3FWEA 3WHCA 4DNCA 2MH9A 5IOZA 1S3JA 4FLLA 5HODA 2L02A 1L0OC 1OFCX 1KU9A 4M6XA 2V9PA 3PIPF 2WWYA 1LE8B 2GG9A 2AQFA 4WCGA 2KIFA 2EZIA 2WB1N 1G3WA 3GTKJ 2W00A 3SFIA 4D5CA 4XLPF 5B1BH 3K1NA 1LVAA 1JGGA 4L9TA 2E1CA 3L09A 4GXOA 3C3WA 1DGWY 3ASNH 3CJQB 1FNNA 3ZQFA 1T95A 4UUTA 2ME0A 2BB7A 1ETQA 5IYBJ 3BCAA 2L7FP 2XUBA 4S0HB 2AS5F 2DOEA 1R1UA 2L54A 4ZDLA 3OSGA 3PNVA 4R60A 4IKTA 4RZYA 3V8KA 4HNVA 3OYDA 5B3SH 3BP8A 2E7WA 2A5YB 1MKMA 2K40A 2XIGA 5E3LA 2L9RA 3L2QA 5E3MA 2Z16A 4HBLA 4YELA 3WU2C 1SEUA 1WI3A 1FZPB 2BW3A 2M8EA 2V4JC 2E5ZA 3H5NA 1XMXA 1BJAA 1TQIA 2NS7A 5F04A 2VLAA 1T33A 2VKDA 1W36C 4A2UA 4BL0B 3CDHA 2QBYA 2DPUA 2L5QA 4BXUA 2KIUA 1V4RA 2XGEA 4AUXA 1WGXA 5CPRB 1ZTRA 1VNDA 3S6BA 1IZ1A 2QVOA 3IU9A 1B59A 1TQMA 1XCBA 3K4NA 4FTHA 1WPKA 1T8IA 3E5QA 4PGGA 1HCRA 4LLNA 4A3DJ 3KX2A 2JSPA 5LRSA 4U73A 3H92A 2Z9OA 2OKNA 3IUOA 1P4AA 3VYTB 3CCEI 1F5TA 2R93J 2FX0A 1IG7A 3Q9VA 2Q2EB 3S1RJ 2P99A 2DA1A 2LY1A 4A3GJ 1IGNA 3ECHA 1CF7A 2A6HF 3JRFA 4B28A 1KYZA 1BR1A 1HDDC 4L0YB 1IN4A 4B47A 3COAC 4FLIA 1X1CA 1KZHA 3S93A 2KHMA 5FGMA 2R4GA 2DFFA 5HLHA 2C6YA 1KA8A 1RKWA 3LOCA 5GTIC 1SVMA 2MA3A 5D8KB 1ETVA 3BG7A 3TEDA 3MATA 3RJPA 1XSXA 2E71A 2RREA 3JRAA 2E1MB 3Q0WA 1R1VA 1FMWA 3RQIA 2JZYA 3A01B 2QZ8A 4F52A 1MIJA 2P98A 5JI6A 3HC7A 4D9JA 1VQKI 4H0EA 4I01A 2XDVA 1X3WB 1YW8A 1W5SA 4FASD 3I4PA 3OYAA 2PQ8A 2G0EA 2NRAC 1NG6A 3CO7C 1DUXC 2CW7A 2H6CA 4DQ2A 1ZAOA 3LFUA 4K2EA 4UUSB 4XNFA 2NOJB 1MMAA 1X1AA 4LG0A 4BJ6C 2NVYJ 3SHFA 3R6SA 2BV6A 5M3FJ 4MGRA 4S04A 3HOYJ 2K86A 1VQ5I 2BVMA 3JRGA 3BR1A 3CCMI 2ECCA 5CVRA 4ZWPA 2DK5A 3JRDA 1YJ9I 6PAXA 2NS0A 1OKRA 2CW0F 2HYGD 2IA1A 3JCUC 2FNPA 3CCYA 4NC8A 5EF6A 3MKZA 1D1BA 4KIFA 5D4SA 1J75A 3LWFA 2XV4S 3A1YA 1JT6A 1YIJI 2L4AA 4O6JA 1BW6A 4YFXF 3BJ6A 1K6YA 2IA2A 3GBGA 2Z1DA 3PFIA 2B7EA 2KRFA 3F6OA 3CC4I 2OV7A 2P0WA 2P6SA 2R5ZB 4IRHA 3E7LA 1IXCA 3BTLA 1R23A 5FRNA 3E0JB 1QO0D 1W2MA 4MHGA 1SFEA 4HAMA 3HYIA 4PSWA 5LHIA 1MBFA 4RGRA 2IAIA 2FE3A 3VSLA 3ZOBA 2BY3A 3RZDJ 3J80Z 1P6RA 3ULQB 1I1SA 1VQMI 1XGMA 1XC5A 2HQAA 4BJTA 4FO8A 4ZYAA 1S6LA 3LSRA 1I27A 1AHDP 1QRYA 1Z3XA 5ICEA 1R5GA 3BR2A 1T0FC 1TLHB 2EZKA 5EYRA 4KJZA 4W1UA 3M8JA 2EJRA 1BI3A 2F5VA 4E7KA 3NWSA 2B0LA 1WJ5A 1RR8C 3LMMA 4R79A 3I4NJ 2PJPA 3FXLA 3RDIA 4XM3A 2ZNYA 5KVRA 4UVCA 3GTQJ 2M45A 4QLCU 2CV1A 4ESJA 3HOSA 3GFIA 4D7NA 2EINH 4UHTA 3V7RA 4IHTA 3OS1A 3EQLF 1T2KA 2CFOA 2Z5UA 4WXCA 1MGTA 2BYVE 2WBMA 2IS6A 3IC7A 1FYMA 1X1PA 5ERIA 5DS9A 2LKPA 2ZMEB 4A3LJ 4TV7A 2KIQA 3LNQA 4AYBN 2X1EA 3S32A 2MABA 4IF7A 2A69F 3WTXC 4DYCA 2EFPA 3CJTB 2DDAA 1QPMA 5EGOB 1TL8A 4BQAA 4A6VA 2LP0A 1PUFA 2XAJA 4RB0A 3MEXA 2FBKA 5DUIA 4RMNA 2OTJI 2X51A 3CLQA 5DCMB 2XAUA 2R7XA 4F7ZA 3VFZA 1OCRH 3ZQ7A 3ABTA 2KL4A 5H6QA 3HEFA 2ZSIB 1B4AA 4A0YA 5KAFC 1W7PD 2OA4A 3BITA 3E5XA 4DGWB 2E19A 1W7PA 4EV0A 2BBYA 4XSZF 1MH3A 3IG4A 4NQWB 1R9TJ 1IRZA 2XPUA 2B9SA 1FBUA 1YW9A 4IEJA 3BC8A 4BBRJ 5FLVA 3LFKA 4JX4A 3OYCA 4CCNA 3RKWA 4M72A 2D1HA 1OJLA 3J7ZI 3K4KA 5BQTA 3WU1B 5FKOA 1H89C 3MZYA 2HNHA 3K4BA 1XNZA 3T8TA 1JKOC 4XL9A 3HDDA 2QLZA 3G6EI 2OC6A 1IC8A 1SMTA 2VJJA 3WTZA 2LR8A 1Y6IA 2O61A 4ETSA 4KA4A 5CKTA 1EH8A 1JUPA 3ELKA 1BI1A 3A0BC 1K78B 3HGGA 4AYBA 3PKEA 5J8CA 4U6WA 3JRCA 2EK5A 1IN6A 2CH0A 1XSDA 5D4RA 4AM3A 4RGSA 4BQQA 4L18B 3RTRA 4LMYA 3ZQIA 3OYFA 1GVDA 2HZDA 1ORKA 1S7AA 2KJCA 1YTYA 2PJRB 5D5UB 5J40A 4I09A 5JHUA 1D0XA 2J5OA 2E1NA 4BYYA 4G8XA 3MZHA 3CZ6A 4U71A 3KEYA 2OD5A 1S7OA 5F6FA 4HNTA 3FXJA 4LK0F 3SDBA 1TT0A 3KP4A 2Q2EA 1I3AA 1SVLA 1FT9A 3ZN0A 5JFRA 2LRDA 2RNJA 4Q4ZF 2A07F 1F4KA 1RUOA 3J7AO 1CF7B 3CMAI 4IU6A 1X1BA 2GG5A 2RVCA 3GW2A 1FP1D 3T5XA 2XF5A 3LSJA 5K5RA 3OS2A 4BDYA 4X0GA 4G12A 2I10A 2NQ6A 4M6VA 3CQZJ 2WC2A 2W1OA 1J5YA 3PKCA 3ML6A 3HHGA 3IHUA 2IVMA 3AG4H 3VSKA 3WGIA 1NG7A 2R7OA 1QPIA 4ENKA 1W5TA 3W6VA 1WRJA 1V5FA 1HXDA 2QGUA 3IWZA 3CF2A 3CB5A 2FA5A 1OR7A 2OU2A 3U1KA 4FQGA 2RV8A 4RGXA 1D0YA 1D1AA 2ETHA 3ZN1A 2X48A
chains in the Genus database with same CATH topology
3LQRA 5LEKA 3P9CA 4HXXA 2FNAA 2ZBKA 2HWVA 2YSRA 3WTYC 4Y17A 4KUMA 4AD9A 2GG8A 4WXDA 2BHCA 2R7FA 3WODF 1WKMA 1RZ4A 1DP7P 4BAYA 4M9ZA 5JVTA 4EGEA 2V1XA 4HDUA 1O3RA 5CYVA 2A68F 3I64A 3WE2A 1USTA 3N4MA 5CDEA 4KYWA 2BH3A 2G9WA 4KMFA 5HVQC 3S2WA 4ESFA 2FBHA 2KKOA 2XHKA 1J59A 2Q0OA 3L24A 4G6QA 2VBWA 4WWCA 3LQQA 5LEJA 5HS9A 2H09A 1B9MA 1CHMA 4LD5A 4MEYF 4S2TP 3BZ6A 1XCVA 3RVAA 1YFHA 3DPTA 4KT5C 2XAGA 4G94A 2NAZA 3WTSC 4MEXF 5E18F 2GZWA 1R36A 1JE8A 3F72A 2VXZA 5CJ9A 4UUVA 2HKXA 2Q95A 2UXNA 1QQIA 3QU6A 4OINF 4I0BA 3GF2A 1TW2A 2DTRA 4A6WA 1ZRDA 4IKRA 4MTEA 3JTGA 4P9FA 1FYLA 3DPLC 2STWA 5FLXK 2CSOA 2H94A 1LDKB 5FFXA 3WTUC 4HQMA 2G7UA 1ZG5A 4JQFA 2NNNA 2FF4A 3BY6A 2W84A 1XD7A 1UHMA 3QPTA 4GCVA 5JR3A 1QNTA 3CJNA 2GGBA 4LB6B 2DW4A 4N9IA 2OZ6A 4JUQA 3SZPA 2EFQA 3IU8A 1WWXA 5CE6A 4HZFA 2W25A 3CB6A 1TQPA 4QWQA 3I71A 2PMUA 3ZMZA 4P5OA 2K4BA 4ZYDA 4A0ZA 2LF8A 4EGYA 1LEBA 2ZKZA 3T1BA 4U6ZA 1ZN2A 4EM0B 1BI0A 3GO5A 1WQ2A 4HF1A 3U2RA 2M5WA 2BGCA 2VBZA 1ZREA 5AIPA 1T0FA 4S00A 1D8JA 1QZYA 4R8HA 3MFKA 1JAWA 3BIPA 4CO8A 3HRTA 1JHHA 2ZXJA 5E1ZB 5CLSA 5HDKA 5E1XA 4U1BA 1FC3A 2EVOA 1S8NA 5EEGA 3B02A 2GXBA 2V3XA 2A3SA 1LQ1A 1WSUA 1MJAA 3BJOA 1SD6A 4AIKA 2CYYA 4O3MA 2DAOA 2AXLA 5J6XA 2LDUA 2X0LA 2STTA 4I7HA 1KP0A 2BHBA 2M87A 3R4KA 2CFXA 4ESBA 2O6GE 3E97A 3G73A 3FMQA 1P4WA 3VB2A 4G7OF 1ZHFA 3FHZA 2GIVA 5FD6A 2QWWA 3H3UA 5LGUA 2FSWA 3JAMK 4FT8A 3K1PA 3L7WA 1WY2A 3VEPA 4AIJA 4BHCA 1HKTA 1BIAA 2K02A 4YG2F 2V3YA 5ILVA 1ZGJA 1QBJA 3PQJA 4IKUA 3JAMZ 2VN2A 2IW5A 1Z6TA 4LFUA 3WTVC 1D5VA 5HDGA 2MH2A 1U5TB 1MJ9A 3W6JB 3I54A 4XLNF 4U6EA 3FMRA 3CUQA 3J81Z 4KFCA 3TDZC 2HOWA 1IRFA 2FBIA 2Y48A 2HDCA 4G7ZF 1IN5A 4WF2A 2EA2A 3IKTA 1FLIA 4M74A 1YJ3A 4OIPF 3DF8A 3SQNA 1P2FA 2GTXA 1ZLJA 2DQRA 2RGVA 5A2QK 2B3HA 2MD5A 4MTDA 4N0BA 2Q8KA 1YS6A 2Q93A 4AWXB 4EJVA 1HW2A 4HX7A 2EV0A 1PP7U 4B8XA 1Z9CA 3FM5A 3HSFA 4E70A 3KP5A 3RYRA 5CDVA 3KP3A 2V1UA 2HGCA 3FMSA 5BMZA 2EV6A 2GG0A 4RGUA 4U7DA 1UHWA 2GG2A 4U69A 1O3TA 3FXUA 3C18A 3GYHX 1YQAA 4HX4A 1XB4A 1NHAA 3ZMSA 4P96A 2OQRA 2QQ9A 5IT3A 2FXAA 2FOKA 2XVCA 5CVVA 1ODDA 4EM1A 3SZTA 1PP8F 2V3ZA 4Q48A 4XSXF 3HRMA 2BN7A 4R1HA 1JXSA 1BIBA 1J9IA 1QZZA 3TO7A 1U3EM 4PGHA 1R58A 3ZPLA 4HA8A 4G9YA 1WL6A 2ADUA 1WI9A 1O7FA 2RC4A 5K5OA 3AAFA 5DD4A 4L9NA 3GVAA 1FSEA 1QGPA 1K7AA 1XMKA 2L3DA 4LLGF 3R0JA 1PV9A 4G7HF 3V8LA 3QAHA 5HS8A 4U7BA 3E6BA 4Q47A 1REPC 1UCRA 2BWWA 2DPDA 2L4MA 3DQVC 3OV8A 4EJUA 1KGSA 2BWSA 1JHFA 2DBBA 4WX9A 4Z7MA 2VT3A 1G3SA 4KIGA 4OIOF 4ZZDA 2O8XA 3OOPA 2FRHA 4HX8A 2QQAA 2LF7A 5DCMA 4GGGA 4U70A 5BOXA 2NNYA 2MBFA 3HHHA 4MNUA 4I98B 4OMZA 2GU4A 2JT1A 3P9KA 4HLXA 1W7PB 1Z91A 1IXSB 2Y0MA 4CYDA 3HUGA 3TB5A 5FD5A 2JPBA 1FBQA 2VONA 1AOYA 4KN7X 2VOOA 2HFHA 2P4WA 1OYWA 4HDVA 4L5IA 3I59A 2GZ5A 2P8TA 1XSVA 4UV8A 2P6TA 5F1RA 3SXYA 4ENJA 3IL2A 1IF1A 3MAJA 2ESHA 4RB3C 3GFLA 3KEQA 1ZGAA 1BN5A 3NRVA 2B3LA 3IWFA 3RKYA 2EFWA 4PCQA 2DO7A 1YIOA 2QUFA 1MATA 5FCHA 5DEQA 4LJZF 3C7JA 3CLOA 2DK8A 2Q96A 4EMSA 2ESNA 5D6EA 3BPVA 2VE9A 3F8BA 2F5CA 2K27A 3O3KA 2PG4A 1SMYF 2JSCA 1WL9A 2IW2A 4HF0A 3WTTC 3HRSA 4IJAA 3GEZA 2VODA 4A0XA 5ICGA 2GU5A 1MD0A 2Q94A 4CZZA 4JBAA 1SAXA 3BWGA 3KETA 1ZRFA 3LA2A 3T8RA 3WU0A 1AWCA 1LDJA 1R1TA 4U0WA 1T98A 4Y13A 3BPXA 3K1MA 1XGSA 4OIQF 3GZ6A 4P55A 5BPDA 3WGGA 3CUQC 3MWMA 2M1BA 3GLXA 2K7LA 4BHPA 4KDPA 1HW1A 3M1EA 4IRIA 2B3KA 3U1DA 3BDDA 3JTHA 3I5UA 2XKPA 2FQ3A 4U0YA 2O0YA 2HYFA 5L3BA 1ON2A 1G3YA 4KICA 2OQGA 3ZMTA 5E8GA 3IU7A 4FHTA 1VTNC 2HQRA 3TO6A 5DV5A 3RYPA 2GWRA 2HTSA 4BH9A 1BC7C 4OMYA 4LLLA 2EVMA 1U78A 3G3ZA 1QXZA 1Z1DA 2QENA 3F23A 3BJAA 3GFJA 2FU4A 2EB7A 5L3CA 3MX6A 3HIFA 2CO5A 1QXWA 1IN8A 3W6KB 5ICCA 5F64A 3T0YA 5L3GA 5D5XB 5A2QZ 3F8FA 1BM9A 2BEOA 4L9JA 1C23A 2NQ7A 2W57A 3HOTA 5HLGA 1Z6RA 2YX7A 2D45A 4RAYA 4P9UA 4XBFA 3REOA 3HSRA 2ACJA 5D5VB 3EUHA 3CUQB 2ZNZA 1U5TA 1YO5C 1IXRC 3IKVA 4ON0A 3J81K 3GZ5A 1HSTA 2W85A 2PFBA 3EETA 2GU7A 1SFUA 3E6DA 3NQOA 2FMLA 3CTZA 4MQ9F 1ULYA 2QYOA 4AVPA 2WV0A 2PLYA 2CWEA 4M73A 1SFXA 2HS5A 3MQ0A 2XAHA 4A5MA 3F8NA 1MJBA 3O2PE 5LBQA 4CHUA 2RDPA 5HLIA 2ISZA 1FSHA 1RUNA 1R7JA 5HDNA 4ZH4F 4Y15A 2OZUA 4GO1A 5D5WB 1OYIA 2KJBA 2NYXA 3EYIA 3RIRA 2H6BA 5H20A 2H27A 5CVIA 3GX4X 1K79A 2PN6A 1XGNA 4HW0A 1W7VA 3D5LA 1YW7A 2KIMA 3JW4A 2XRNA 5DD8A 2V9VA 3M9AA 1BOAA 1I1GA 5ED4A 2IT0A 3E6MA 1WLRA 3I59B 4UV9A 1ZYRF 4IDYA 2Z3YA 3L00A 5L3DA 4CDGA 5J8FA 4WXHA 2IA0A 1U8RA 2RN7A 3N97A 4KM3A 2Z33A 4MATA 3NEUA 2IP2A 2VC1A 4IXAA 1IAWA 3LSTA 2BE5F 4L9VA 4EJWA 3MCZA 2GA1A 2FMYA 4PNCA 1HKSA 4AIHA 2HZTA 3IRQA 1SD5A 3Q9SA 3KFWX 1XMAA 4I02A 2HEOA 3F3XA 2BWVA 3BROA 1KU2A 3V4GA 3FX3A 3KEOA 1BBYA 1T38A 2X4HA 3TOAA 2IPQX 2OBPA 4KN4X 1F9NA 4OOKA 1KQ0A 2JPCA 1A04A 1ZRCA 1H9GA 2VC0A 1P92A 5LRRA 1EH6A 5FLXZ 1J7KA 2G7HA 4EJOA 2XAQA 4ASNA 1YLFA 1XGOA 2MC3A 3Q5FA 1BC8C 4ZZLA 3TAVA 2ZO4A 3WGHA 2UWMA 1A16A 2CGPA 3QOPA 1FY7A 2MLKA 3ZMDA 5DUKA 2DU9A 1ONVA 1H9TA 1FBSA 3WG9A 2F5FA 5LLQA 4S2RP 1YVMA 5DDGA 3U9GA 2VBXA 3VOEA 4U0VA 3F6VA 1O3SA 4ENMA 1Z7UA 3M7GA 3WTWC 3PKDA 4EJTA 1T39A 4FLKA 1KU3A 2YPRA 3EDPA 3KLOA 4ZWUA 4Z2YA 3V8JA 1U6GA 1IRGA 2XKOA 2G6PA 4U75A 4ZNGA 1W4MA 4FLJA 1MZBA 2ZSGA 1IW7F 2EV5A 2EFNA 3F8CA 4A5NA 2J5PA 2HKOA 1WBQA 1LNWA 3L2CA 1LJ9A 1O0XA 1B1BA 5CIKA 4FKCA 2LSOA 2Y75A 2ZFWA 1Z05A 4HYEA 2L01A 3WE3A 3KZYA 2Z99A 5ICFA 3ZMUA 2A61A 5AIQA 2R7DA 2XROA 3K0LA 3Q6DA 5L3EA 5ILSA 4L5JA 2XAFA 5BS6A 3PKAA 1C27A 4U6JA 4GYIA 3RKXA 3BIQA 4BHBA 5L3FA 2UZKA 3HTUA 3HSEA 5AONA 1KQ8A 1GVJA 4JK1X 3QP5A 3FZVA 3E6CC 2O03A 4M9XA 1ZG3A 2PI0A 3MR1A 2EA4A 1JGSA 4YFNF 1I5ZA 1USSA 1D8KA 3QU3A 1M35A 1P4XA 3F8MA 4NB5A 1KQ9A 4HV6A 5CNXA 4HQEA 2MLGA 4EVIA 2VOPA 3K69A 1G6NA 5FCFA 1E17A 1EH7A 2GAUA 2EFOA 4YIFA 4S05A 3DP7A 2DFIA 2R3SA 1TNTA 2BWTA 1BI2A 4CICA 4PZJA 3O6BB 2GU6A 1XDSA 4O5VA 3LAPA 1STZA 2MATA 5DYMA 1G4DA 1C0WA 5K5QA 4OIRF 4LGWA 5LGTA 1SD4A 3DKWA 2P7VB 4UNOA 1KYWA 4I0AA 1RNLA 2DT5A 1R5HA 3PKBA 2QBYB 1ZH5A 1ZG1A 2E7XA 1DPUA 2K4JA 4ENNA 1C21A 2F5DA 2OAZA 1U2WA 2CG4A 4IPAA 4EQQA 2QQBA 4IVNA 3LA3A 4L0ZB 3TGNA 3C1DA 1Y1NA 3R61A 3RPQA 5E17F 4IF4A 4HLYA 3B73A 2GG7A 3KP6A 3ABUA 1LB2A 1G3TA 4M9SA 3GWZA 2A6EF 3E3VA 3L9FA 1E2XA 2HOEA 3HTSB 2BHAA 3QRFF 1ZARA 4IRGA 4ZYEA 3RI4A 2GA2A 1FX7A 3FXRA 1TBXA 2HQNA 2JRTA 5DCFA 1FWZA 3J80K 3TQNA 2YR2A 3FXQA 3KZZA 5E20A 4OU0A 1J2XA 4RS8A 1H0MA 4LG0B 1R00A 2XGXA 3DFGA 2P9AA 1CGPA 1IN7A 2ZJ2A 5CVUA 1MDMB 3F22A 1SD7A 4EGZA 4M71A 3ISPA 2P7CB 4NHJA 1Y0UA 3F21A 1UB9A 4LK1F 4RAZA 1HBXG 4CXFA 2P5VA 4KNYA 1F1ZA 1DPRA 2LNBA 5ILUA 4D0PA 2V1DA 3TOBA 1GXPA 3P7NA 1T6SA 4EM2A 3L7GA 4FX4A 2M30A 5HS7A 4S01A 3E5UA 2PEXA 2V79A 5TJJA 1X3UA 4WK8F 5IT9Z 1O3QA 4A6DA 3IRRA 5D6FA 5LHGA 1FP2A 4PDKA 3K2ZA 2P5KA 2ELHA 2VE8A 3ZP5A 1XDUA 3K9TA 4M6YA 2W24A 2BWYA 5E5BA 1N51A 4RGZ1 5D8LB 4A12A 1YYVA 3KP2A 3D0SA 2QM3A 1RI7A 2Q92A 2CQKA 2YU3A 3GUDA 1FPQA 2DI3A 1L3LA 4IHSA 3ERED 3FM3A 2GQQA 2TDXA 5FO5A 3M8FA 2DQLA 2COMA 4RZZA 1QXYA 4B09A 2O3FA 5FB2A 5CVJA 1TNSA 4YIIA 1DDNA 4XRFA 2FEZA 3H3ZA 3CO6C 5LHHA 2ZCWA 3DXJF 2P5LC 4LB5A 3HRUA 5CDLA 3DEUA 3I53A 1EV7A 1XN7A 1C24A 1ON1A 4NQWA 1ZLKA 4Q5SF 1IUYA 4IECA 3KE2A 4HOBA 1V3FA 1HKQA 4RB2C 4ZYGA 1LEAA 4U6CA 5H6RA 2WTEA 4U88A 2EWNA 2DLLA 3TKYA 1C22A 3RPUA 3V7CA 1KU7A 2HR3A 3KCCA 1PUEE 4QR8A 4A6EA 4FUKA 1D3YA 2PMHA 4G6DA 1K78A 2JTVA 1B9NA 3KP7A 3V7SA 2BWUA 1LDDA 4KIBA 3R0AA 3P9IA 2GGCA 5LGNA 4HV5A 1OYYA 2V6CA 3FF5A 3ZMVA 1TW3A 2HTJA 3I58A 3VODA 4ZYHA 1Q1HA 3GXOA 2D2WA 3PQKA 3D27A 5IT9K 2BHDA 3QPHA 3I0TA 2D1VA 2GXGA 1J0RA 4KMUX 3QP6A 4OOIA 4BNCA 3EYYA 1B6AA 1U5TC 1YG2A 1HQCA 1O57A 2RKHA 1TTYA 2PBIA 3ROUA 1GXQA 3TO9A 1YS7A 1R22A 2UXXA 4N9HA 2VT2A 4PV4A 4HF2A 2ZMEA 4MQVA 1O7LA 4ZWOA 1OMIA 2VBYA 2RQPA 4I2OA 4RB1A 1OPCA 4FO7A 5E8IA 2ISYA 1UFMA 5K1YA 2BWXA 5E1WA 3JSPA 3RORA 4UVBA 2IRFG 1K6OA 1HW5A 3CTAA 1S29A 2XASA 3M8EA 3JSOA 3GFMA 4YFKF 5HOOA 1FYKA 3SFZA 1MDMA 1HSJA 3KLNA 3DV8A 1PDNC 5BPIA 2F2EA 4IKSA 4GYGA 5FFZA 2YX4A 2EVCA 5TRDA 3LA7A 3CUOA 3TDUC 3ECOA 4U76A 2GG3A 3LAJA 3BOQA 2F5EA 2IJLA 5EEHA 1FOKA 1WN1A 4UXNA 4FX0A 3R60A 4UVAA 1RIOH 1I6XA 4CGZA 1GHCA 5KK1A 3FWEA 4DNCA 2MH9A 1S3JA 4FLLA 2L02A 1L0OC 1KU9A 4M6XA 2WWYA 2GG9A 4WCGA 2KIFA 1G3WA 4XLPF 3K1NA 1LVAA 2E1CA 4L9TA 3L09A 4GXOA 3C3WA 1FNNA 2BB7A 2XUBA 2AS5F 1R1UA 2L54A 4R60A 4IKTA 4RZYA 3V8KA 3BP8A 2E7WA 2A5YB 1MKMA 2XIGA 4HBLA 1FZPB 2M8EA 1BJAA 1TQIA 4A2UA 3CDHA 2QBYA 2DPUA 4BXUA 2KIUA 1V4RA 3S6BA 1IZ1A 2QVOA 3IU9A 1B59A 1TQMA 1XCBA 3E5QA 4PGGA 4LLNA 5LRSA 4U73A 2Z9OA 3H92A 2OKNA 1P4AA 1F5TA 3Q9VA 2P99A 3ECHA 1CF7A 2A6HF 4B28A 1KYZA 4L0YB 1IN4A 3COAC 4FLIA 5FGMA 5HLHA 2C6YA 1KA8A 2MA3A 5D8KB 3MATA 3RJPA 1XSXA 1R1VA 2JZYA 2QZ8A 2P98A 5JI6A 4H0EA 4I01A 1YW8A 1W5SA 3I4PA 2PQ8A 2NRAC 3CO7C 1DUXC 2H6CA 4DQ2A 1ZAOA 4K2EA 4LG0A 3SHFA 3R6SA 2BV6A 4MGRA 4S04A 2K86A 5CVRA 4ZWPA 2DK5A 6PAXA 2NS0A 1OKRA 2CW0F 2HYGD 2IA1A 2FNPA 4KIFA 5D4SA 1J75A 3LWFA 2XV4S 2L4AA 4O6JA 4YFXF 3BJ6A 2IA2A 3PFIA 2KRFA 3F6OA 2P6SA 4IRHA 1IXCA 1R23A 1QO0D 1W2MA 4MHGA 1SFEA 4HAMA 3HYIA 5LHIA 4RGRA 2FE3A 3J80Z 1P6RA 3ULQB 1I1SA 1XGMA 4FO8A 1S6LA 1I27A 5ICEA 1R5GA 1TLHB 2EJRA 1BI3A 2B0LA 4R79A 2PJPA 3RDIA 2ZNYA 5KVRA 4UVCA 2M45A 4QLCU 4ESJA 3HOSA 3GFIA 4UHTA 3V7RA 4IHTA 3EQLF 1T2KA 4WXCA 2Z5UA 1MGTA 2BYVE 3IC7A 1FYMA 5ERIA 2LKPA 2ZMEB 4TV7A 4IF7A 2A69F 3WTXC 2EFPA 4BQAA 1QPMA 4A6VA 2XAJA 4RB0A 3MEXA 2FBKA 5DUIA 5DCMB 4F7ZA 3VFZA 3ZQ7A 3ABTA 5H6QA 1B4AA 4A0YA 1W7PD 2OA4A 3BITA 3E5XA 1W7PA 4EV0A 2BBYA 4XSZF 3IG4A 1FBUA 1YW9A 3LFKA 3RKWA 4M72A 2D1HA 3WU1B 5BQTA 3MZYA 1XNZA 3T8TA 2QLZA 1SMTA 3WTZA 2O61A 4ETSA 4KA4A 1EH8A 3ELKA 1BI1A 1K78B 3PKEA 5J8CA 4U6WA 2EK5A 1IN6A 1XSDA 5D4RA 4RGSA 4L18B 3RTRA 4LMYA 2KJCA 1S7AA 1YTYA 5D5UB 4I09A 5JHUA 2J5OA 2E1NA 4BYYA 4G8XA 3MZHA 4U71A 2OD5A 1S7OA 5F6FA 4LK0F 3KP4A 2Q2EA 1FT9A 3ZN0A 5JFRA 2RNJA 4Q4ZF 2A07F 1F4KA 1RUOA 3J7AO 1CF7B 4IU6A 2GG5A 2RVCA 3GW2A 1FP1D 3T5XA 5K5RA 2NQ6A 2WC2A 1J5YA 3PKCA 3ML6A 3HHGA 3IHUA 2IVMA 3WGIA 4ENKA 1W5TA 1WRJA 1HXDA 3IWZA 3CB5A