4U70A

Hsmetap (f309m) in complex with (1-amino-2-cyclohexylethyl)phosphonic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u70A00
1MATA 4U70A 2V3XA 2GA2A 2GZ5A 4ZNGA 4IPAA 4OOKA 3PKEA 3MATA 1QXYA 1QXWA 4Z7MA 2Q95A 2Q94A 1WN1A 2BWSA 2GG2A 4U73A 3TB5A 1WBQA 4B28A 4U6EA 4FLLA 2BWUA 3IU7A 5FCFA 1BN5A 2BHCA 3BIQA 5FCHA 4S2TP 5CDVA 1WY2A 4IU6A 2BH3A 2P98A 3D27A 1WL9A 3FMRA 1QZYA 3BIPA 4U69A 5CDLA 3PKCA 2BHAA 1KP0A 3RVAA 5D6FA 2GG8A 1KQ9A 2GU6A 1C22A 4U76A 2Q8KA 2ZSGA 4FO8A 3PKAA 4U6ZA 1C23A 4A6WA 3IU8A 2V3YA 2P9AA 2BWXA 2GU7A 3L24A 1Y1NA 1WKMA 4IKRA 4QR8A 1YW8A 1W7VA 2GG5A 1M35A 5CE6A 3RORA 3FMQA 4IECA 2ADUA 2V3ZA 3PKDA 5JI6A 2HOWA 4ZWUA 2BHDA 2EVOA 5CLSA 3IU9A 4EGEA 4RZYA 1XGNA 3IG4A 2OAZA 1C24A 3MR1A 4FO7A 1WL6A 2EA4A 2GG7A 4RZZA 1YJ3A 4S2RP 2GTXA 1B59A 2BWYA 4FUKA 3BITA 4FKCA 5CIKA 3CB5A 4MATA 2GGBA 2GG3A 2GU5A 1A16A 2B3LA 2Q96A 4IKUA 5E5BA 3L7GA 2Q92A 2BHBA 3FM3A 5JHUA 4U6CA 1O0XA 2OKNA 4FLJA 1CHMA 2BB7A 1R5HA 3CTZA 1R5GA 2EVCA 2DFIA 1YW7A 1XGMA 1WLRA 4JUQA 5CDEA 2GG0A 4R60A 5CNXA 3TAVA 1KQ0A 4FLIA 4FLKA 4KM3A 3CB6A 4IKTA 4A6VA 1QXZA 5D6EA 3MX6A 3S6BA 1PV9A 4IDYA 3PKBA 4U75A 2MATA 2BWWA 1XNZA 3Q6DA 1JAWA 2EA2A 2G6PA 2IW2A 1XGSA 4U6WA 2BWTA 4PNCA 4PV4A 1XGOA 1C21A 4IF7A 2NQ7A 4U6JA 4ZWOA 1B6AA 4ZWPA 2Q93A 1W2MA 1YW9A 2NQ6A 2EVMA 2V6CA 4U71A 2GG9A 1R58A 1YVMA 2GU4A 5JFRA 2B3KA 2P99A 4S01A 2GGCA 4S00A 4HXXA 4RGZ1 4U1BA 1C27A 1BOAA 2BWVA 4IKSA 2BN7A 2B3HA 1N51A
chains in the Genus database with same CATH superfamily
1MATA 4U70A 2V3XA 2GA2A 2GZ5A 4ZNGA 4IPAA 4OOKA 3PKEA 3MATA 1QXYA 1QXWA 4Z7MA 2Q95A 2Q94A 1WN1A 2BWSA 2GG2A 4U73A 3TB5A 1WBQA 4B28A 4U6EA 4FLLA 2BWUA 3IU7A 5FCFA 1BN5A 2BHCA 3BIQA 5FCHA 4S2TP 5CDVA 1WY2A 4IU6A 2BH3A 2P98A 3D27A 1WL9A 3FMRA 1QZYA 3BIPA 4U69A 5CDLA 3PKCA 2BHAA 1KP0A 3RVAA 5D6FA 2GG8A 1KQ9A 2GU6A 1C22A 4U76A 2Q8KA 2ZSGA 4FO8A 3PKAA 4U6ZA 1C23A 4A6WA 3IU8A 2V3YA 2P9AA 2BWXA 2GU7A 3L24A 1Y1NA 1WKMA 4IKRA 4QR8A 1YW8A 1W7VA 2GG5A 1M35A 5CE6A 3RORA 3FMQA 4IECA 2ADUA 2V3ZA 3PKDA 5JI6A 2HOWA 4ZWUA 2BHDA 2EVOA 5CLSA 3IU9A 4EGEA 4RZYA 1XGNA 3IG4A 2OAZA 1C24A 3MR1A 4FO7A 1WL6A 2EA4A 2GG7A 4RZZA 1YJ3A 4S2RP 2GTXA 1B59A 2BWYA 4FUKA 3BITA 4FKCA 5CIKA 3CB5A 4MATA 2GGBA 2GG3A 2GU5A 1A16A 2B3LA 2Q96A 4IKUA 5E5BA 3L7GA 2Q92A 2BHBA 3FM3A 5JHUA 4U6CA 1O0XA 2OKNA 4FLJA 1CHMA 2BB7A 1R5HA 3CTZA 1R5GA 2EVCA 2DFIA 1YW7A 1XGMA 1WLRA 4JUQA 5CDEA 2GG0A 4R60A 5CNXA 3TAVA 1KQ0A 4FLIA 4FLKA 4KM3A 3CB6A 4IKTA 4A6VA 1QXZA 5D6EA 3MX6A 3S6BA 1PV9A 4IDYA 3PKBA 4U75A 2MATA 2BWWA 1XNZA 3Q6DA 1JAWA 2EA2A 2G6PA 2IW2A 1XGSA 4U6WA 2BWTA 4PNCA 4PV4A 1XGOA 1C21A 4IF7A 2NQ7A 4U6JA 4ZWOA 1B6AA 4ZWPA 2Q93A 1W2MA 1YW9A 2NQ6A 2EVMA 2V6CA 4U71A 2GG9A 1R58A 1YVMA 2GU4A 5JFRA 2B3KA 2P99A 4S01A 2GGCA 4S00A 4HXXA 4RGZ1 4U1BA 1C27A 1BOAA 2BWVA 4IKSA 2BN7A 2B3HA 1N51A
chains in the Genus database with same CATH topology
1MATA 4U70A 2V3XA 2GA2A 2GZ5A 4ZNGA 4IPAA 4OOKA 3PKEA 3MATA 1QXYA 1QXWA 4Z7MA 2Q95A 2Q94A 1WN1A 2BWSA 2GG2A 4U73A 3TB5A 1WBQA 4B28A 4U6EA 4FLLA 2BWUA 3IU7A 5FCFA 1BN5A 2BHCA 3BIQA 5FCHA 4S2TP 5CDVA 1WY2A 4IU6A 2BH3A 2P98A 3D27A 1WL9A 3FMRA 1QZYA 3BIPA 4U69A 5CDLA 3PKCA 2BHAA 1KP0A 3RVAA 5D6FA 2GG8A 1KQ9A 2GU6A 1C22A 4U76A 2Q8KA 2ZSGA 4FO8A 3PKAA 4U6ZA 1C23A 4A6WA 3IU8A 2V3YA 2P9AA 2BWXA 2GU7A 3L24A 1Y1NA 1WKMA 4IKRA 4QR8A 1YW8A 1W7VA 2GG5A 1M35A 5CE6A 3RORA 3FMQA 4IECA 2ADUA 2V3ZA 3PKDA 5JI6A 2HOWA 4ZWUA 2BHDA 2EVOA 5CLSA 3IU9A 4EGEA 4RZYA 1XGNA 3IG4A 2OAZA 1C24A 3MR1A 4FO7A 1WL6A 2EA4A 2GG7A 4RZZA 1YJ3A 4S2RP 2GTXA 1B59A 2BWYA 4FUKA 3BITA 4FKCA 5CIKA 3CB5A 4MATA 2GGBA 2GG3A 2GU5A 1A16A 2B3LA 2Q96A 4IKUA 5E5BA 3L7GA 2Q92A 2BHBA 3FM3A 5JHUA 4U6CA 1O0XA 2OKNA 4FLJA 1CHMA 2BB7A 1R5HA 3CTZA 1R5GA 2EVCA 2DFIA 1YW7A 1XGMA 1WLRA 4JUQA 5CDEA 2GG0A 4R60A 5CNXA 3TAVA 1KQ0A 4FLIA 4FLKA 4KM3A 3CB6A 4IKTA 4A6VA 1QXZA 5D6EA 3MX6A 3S6BA 1PV9A 4IDYA 3PKBA 4U75A 2MATA 2BWWA 1XNZA 3Q6DA 1JAWA 2EA2A 2G6PA 2IW2A 1XGSA 4U6WA 2BWTA 4PNCA 4PV4A 1XGOA 1C21A 4IF7A 2NQ7A 4U6JA 4ZWOA 1B6AA 4ZWPA 2Q93A 1W2MA 1YW9A 2NQ6A 2EVMA 2V6CA 4U71A 2GG9A 1R58A 1YVMA 2GU4A 5JFRA 2B3KA 2P99A 4S01A 2GGCA 4S00A 4HXXA 4RGZ1 4U1BA 1C27A 1BOAA 2BWVA 4IKSA 2BN7A 2B3HA 1N51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAT A;  4U70 A;  2V3X A;  2GA2 A;  2GZ5 A;  4ZNG A;  4IPA A;  4OOK A;  3PKE A;  3MAT A;  1QXY A;  1QXW A;  4Z7M A;  2Q95 A;  2Q94 A;  1WN1 A;  2BWS A;  2GG2 A;  4U73 A;  3TB5 A;  1WBQ A;  4B28 A;  4U6E A;  4FLL A;  2BWU A;  3IU7 A;  5FCF A;  1BN5 A;  2BHC A;  3BIQ A;  5FCH A;  4S2T P;  5CDV A;  1WY2 A;  4IU6 A;  2BH3 A;  2P98 A;  3D27 A;  1WL9 A;  3FMR A;  1QZY A;  3BIP A;  4U69 A;  5CDL A;  3PKC A;  2BHA A;  1KP0 A;  3RVA A;  5D6F A;  2GG8 A;  1KQ9 A;  2GU6 A;  1C22 A;  4U76 A;  2Q8K A;  2ZSG A;  4FO8 A;  3PKA A;  4U6Z A;  1C23 A;  4A6W A;  3IU8 A;  2V3Y A;  2P9A A;  2BWX A;  2GU7 A;  3L24 A;  1Y1N A;  1WKM A;  4IKR A;  4QR8 A;  1YW8 A;  1W7V A;  2GG5 A;  1M35 A;  5CE6 A;  3ROR A;  3FMQ A;  4IEC A;  2ADU A;  2V3Z A;  3PKD A;  5JI6 A;  2HOW A;  4ZWU A;  2BHD A;  2EVO A;  5CLS A;  3IU9 A;  4EGE A;  4RZY A;  1XGN A;  3IG4 A;  2OAZ A;  1C24 A;  3MR1 A;  4FO7 A;  1WL6 A;  2EA4 A;  2GG7 A;  4RZZ A;  1YJ3 A;  4S2R P;  2GTX A;  1B59 A;  2BWY A;  4FUK A;  3BIT A;  4FKC A;  5CIK A;  3CB5 A;  4MAT A;  2GGB A;  2GG3 A;  2GU5 A;  1A16 A;  2B3L A;  2Q96 A;  4IKU A;  5E5B A;  3L7G A;  2Q92 A;  2BHB A;  3FM3 A;  5JHU A;  4U6C A;  1O0X A;  2OKN A;  4FLJ A;  1CHM A;  2BB7 A;  1R5H A;  3CTZ A;  1R5G A;  2EVC A;  2DFI A;  1YW7 A;  1XGM A;  1WLR A;  4JUQ A;  5CDE A;  2GG0 A;  4R60 A;  5CNX A;  3TAV A;  1KQ0 A;  4FLI A;  4FLK A;  4KM3 A;  3CB6 A;  4IKT A;  4A6V A;  1QXZ A;  5D6E A;  3MX6 A;  3S6B A;  1PV9 A;  4IDY A;  3PKB A;  4U75 A;  2MAT A;  2BWW A;  1XNZ A;  3Q6D A;  1JAW A;  2EA2 A;  2G6P A;  2IW2 A;  1XGS A;  4U6W A;  2BWT A;  4PNC A;  4PV4 A;  1XGO A;  1C21 A;  4IF7 A;  2NQ7 A;  4U6J A;  4ZWO A;  1B6A A;  4ZWP A;  2Q93 A;  1W2M A;  1YW9 A;  2NQ6 A;  2EVM A;  2V6C A;  4U71 A;  2GG9 A;  1R58 A;  1YVM A;  2GU4 A;  5JFR A;  2B3K A;  2P99 A;  4S01 A;  2GGC A;  4S00 A;  4HXX A;  4RGZ 1;  4U1B A;  1C27 A;  1BOA A;  2BWV A;  4IKS A;  2BN7 A;  2B3H A;  1N51 A; 
#chains in the Genus database with same CATH topology
 1MAT A;  4U70 A;  2V3X A;  2GA2 A;  2GZ5 A;  4ZNG A;  4IPA A;  4OOK A;  3PKE A;  3MAT A;  1QXY A;  1QXW A;  4Z7M A;  2Q95 A;  2Q94 A;  1WN1 A;  2BWS A;  2GG2 A;  4U73 A;  3TB5 A;  1WBQ A;  4B28 A;  4U6E A;  4FLL A;  2BWU A;  3IU7 A;  5FCF A;  1BN5 A;  2BHC A;  3BIQ A;  5FCH A;  4S2T P;  5CDV A;  1WY2 A;  4IU6 A;  2BH3 A;  2P98 A;  3D27 A;  1WL9 A;  3FMR A;  1QZY A;  3BIP A;  4U69 A;  5CDL A;  3PKC A;  2BHA A;  1KP0 A;  3RVA A;  5D6F A;  2GG8 A;  1KQ9 A;  2GU6 A;  1C22 A;  4U76 A;  2Q8K A;  2ZSG A;  4FO8 A;  3PKA A;  4U6Z A;  1C23 A;  4A6W A;  3IU8 A;  2V3Y A;  2P9A A;  2BWX A;  2GU7 A;  3L24 A;  1Y1N A;  1WKM A;  4IKR A;  4QR8 A;  1YW8 A;  1W7V A;  2GG5 A;  1M35 A;  5CE6 A;  3ROR A;  3FMQ A;  4IEC A;  2ADU A;  2V3Z A;  3PKD A;  5JI6 A;  2HOW A;  4ZWU A;  2BHD A;  2EVO A;  5CLS A;  3IU9 A;  4EGE A;  4RZY A;  1XGN A;  3IG4 A;  2OAZ A;  1C24 A;  3MR1 A;  4FO7 A;  1WL6 A;  2EA4 A;  2GG7 A;  4RZZ A;  1YJ3 A;  4S2R P;  2GTX A;  1B59 A;  2BWY A;  4FUK A;  3BIT A;  4FKC A;  5CIK A;  3CB5 A;  4MAT A;  2GGB A;  2GG3 A;  2GU5 A;  1A16 A;  2B3L A;  2Q96 A;  4IKU A;  5E5B A;  3L7G A;  2Q92 A;  2BHB A;  3FM3 A;  5JHU A;  4U6C A;  1O0X A;  2OKN A;  4FLJ A;  1CHM A;  2BB7 A;  1R5H A;  3CTZ A;  1R5G A;  2EVC A;  2DFI A;  1YW7 A;  1XGM A;  1WLR A;  4JUQ A;  5CDE A;  2GG0 A;  4R60 A;  5CNX A;  3TAV A;  1KQ0 A;  4FLI A;  4FLK A;  4KM3 A;  3CB6 A;  4IKT A;  4A6V A;  1QXZ A;  5D6E A;  3MX6 A;  3S6B A;  1PV9 A;  4IDY A;  3PKB A;  4U75 A;  2MAT A;  2BWW A;  1XNZ A;  3Q6D A;  1JAW A;  2EA2 A;  2G6P A;  2IW2 A;  1XGS A;  4U6W A;  2BWT A;  4PNC A;  4PV4 A;  1XGO A;  1C21 A;  4IF7 A;  2NQ7 A;  4U6J A;  4ZWO A;  1B6A A;  4ZWP A;  2Q93 A;  1W2M A;  1YW9 A;  2NQ6 A;  2EVM A;  2V6C A;  4U71 A;  2GG9 A;  1R58 A;  1YVM A;  2GU4 A;  5JFR A;  2B3K A;  2P99 A;  4S01 A;  2GGC A;  4S00 A;  4HXX A;  4RGZ 1;  4U1B A;  1C27 A;  1BOA A;  2BWV A;  4IKS A;  2BN7 A;  2B3H A;  1N51 A; 
#chains in the Genus database with same CATH homology
 1MAT A;  4U70 A;  2V3X A;  2GA2 A;  2GZ5 A;  4ZNG A;  4IPA A;  4OOK A;  3PKE A;  3MAT A;  1QXY A;  1QXW A;  4Z7M A;  2Q95 A;  2Q94 A;  1WN1 A;  2BWS A;  2GG2 A;  4U73 A;  3TB5 A;  1WBQ A;  4B28 A;  4U6E A;  4FLL A;  2BWU A;  3IU7 A;  5FCF A;  1BN5 A;  2BHC A;  3BIQ A;  5FCH A;  4S2T P;  5CDV A;  1WY2 A;  4IU6 A;  2BH3 A;  2P98 A;  3D27 A;  1WL9 A;  3FMR A;  1QZY A;  3BIP A;  4U69 A;  5CDL A;  3PKC A;  2BHA A;  1KP0 A;  3RVA A;  5D6F A;  2GG8 A;  1KQ9 A;  2GU6 A;  1C22 A;  4U76 A;  2Q8K A;  2ZSG A;  4FO8 A;  3PKA A;  4U6Z A;  1C23 A;  4A6W A;  3IU8 A;  2V3Y A;  2P9A A;  2BWX A;  2GU7 A;  3L24 A;  1Y1N A;  1WKM A;  4IKR A;  4QR8 A;  1YW8 A;  1W7V A;  2GG5 A;  1M35 A;  5CE6 A;  3ROR A;  3FMQ A;  4IEC A;  2ADU A;  2V3Z A;  3PKD A;  5JI6 A;  2HOW A;  4ZWU A;  2BHD A;  2EVO A;  5CLS A;  3IU9 A;  4EGE A;  4RZY A;  1XGN A;  3IG4 A;  2OAZ A;  1C24 A;  3MR1 A;  4FO7 A;  1WL6 A;  2EA4 A;  2GG7 A;  4RZZ A;  1YJ3 A;  4S2R P;  2GTX A;  1B59 A;  2BWY A;  4FUK A;  3BIT A;  4FKC A;  5CIK A;  3CB5 A;  4MAT A;  2GGB A;  2GG3 A;  2GU5 A;  1A16 A;  2B3L A;  2Q96 A;  4IKU A;  5E5B A;  3L7G A;  2Q92 A;  2BHB A;  3FM3 A;  5JHU A;  4U6C A;  1O0X A;  2OKN A;  4FLJ A;  1CHM A;  2BB7 A;  1R5H A;  3CTZ A;  1R5G A;  2EVC A;  2DFI A;  1YW7 A;  1XGM A;  1WLR A;  4JUQ A;  5CDE A;  2GG0 A;  4R60 A;  5CNX A;  3TAV A;  1KQ0 A;  4FLI A;  4FLK A;  4KM3 A;  3CB6 A;  4IKT A;  4A6V A;  1QXZ A;  5D6E A;  3MX6 A;  3S6B A;  1PV9 A;  4IDY A;  3PKB A;  4U75 A;  2MAT A;  2BWW A;  1XNZ A;  3Q6D A;  1JAW A;  2EA2 A;  2G6P A;  2IW2 A;  1XGS A;  4U6W A;  2BWT A;  4PNC A;  4PV4 A;  1XGO A;  1C21 A;  4IF7 A;  2NQ7 A;  4U6J A;  4ZWO A;  1B6A A;  4ZWP A;  2Q93 A;  1W2M A;  1YW9 A;  2NQ6 A;  2EVM A;  2V6C A;  4U71 A;  2GG9 A;  1R58 A;  1YVM A;  2GU4 A;  5JFR A;  2B3K A;  2P99 A;  4S01 A;  2GGC A;  4S00 A;  4HXX A;  4RGZ 1;  4U1B A;  1C27 A;  1BOA A;  2BWV A;  4IKS A;  2BN7 A;  2B3H A;  1N51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...