4U70A

Hsmetap (f309m) in complex with (1-amino-2-cyclohexylethyl)phosphonic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u70A00
1YW9A 4U6WA 2GG7A 2IW2A 4MATA 4ZNGA 2BH3A 1N51A 1C23A 4A6WA 2G6PA 3IU9A 5JHUA 2GGBA 1YVMA 1BN5A 4OOKA 1R5GA 3CTZA 5CDEA 4HXXA 2V3YA 4FLLA 2B3LA 2EVCA 4RZYA 1JAWA 3BIPA 4U76A 2EVMA 3IU8A 1M35A 1W2MA 2V6CA 2GG9A 2OAZA 1WL9A 1XGNA 4B28A 3PKEA 5FCHA 2BHDA 4RGZ1 4FUKA 4JUQA 4U6CA 5FCFA 3MATA 3IG4A 4IKUA 2HOWA 4S00A 2BN7A 1WKMA 2GU6A 2Q95A 1KP0A 3RVAA 2GTXA 1YW8A 2Q92A 4IPAA 5CDLA 5JFRA 4EGEA 2EA4A 3L24A 3Q6DA 3TAVA 5D6FA 2BWWA 2BWXA 3FMRA 4R60A 4IKRA 1QXYA 2EVOA 2GU7A 3L7GA 4KM3A 5E5BA 5CE6A 4FLJA 1B59A 2GG0A 2BHAA 4FLKA 4RZZA 4IKTA 2NQ7A 1MATA 3PKCA 2GG2A 1B6AA 1XGMA 2BWYA 4A6VA 4IDYA 5D6EA 2BWUA 2ADUA 2GA2A 4U73A 1WY2A 1C22A 4Z7MA 1CHMA 1XGOA 2GU4A 3TB5A 2BWSA 2P98A 2Q96A 4ZWUA 1O0XA 2NQ6A 2BB7A 2Q93A 3RORA 1WL6A 3FMQA 3PKDA 4PV4A 1QXWA 1WLRA 1XNZA 4U1BA 1XGSA 2ZSGA 4IU6A 1KQ0A 2GZ5A 4U75A 4IKSA 1PV9A 4U6ZA 3PKBA 4FLIA 4S01A 2DFIA 3BIQA 5CDVA 3FM3A 2GU5A 4U71A 4U70A 2GG3A 5CNXA 4PNCA 4IECA 1WN1A 2B3KA 4ZWOA 1QZYA 2MATA 2OKNA 4ZWPA 4FO7A 2V3XA 1BOAA 1QXZA 4FO8A 3MR1A 1W7VA 3BITA 1R58A 3S6BA 1A16A 1C21A 2P99A 2GG8A 2GGCA 3D27A 2Q8KA 5JI6A 2B3HA 2V3ZA 4U69A 5CLSA 3MX6A 1YW7A 4S2TP 5CIKA 2GG5A 4FKCA 1C27A 3CB5A 1WBQA 1Y1NA 1R5HA 2BWVA 4IF7A 4S2RP 2BWTA 3CB6A 1YJ3A 2P9AA 3IU7A 2EA2A 3PKAA 2BHCA 2Q94A 4QR8A 4U6EA 4U6JA 1KQ9A 2BHBA 1C24A
chains in the Genus database with same CATH superfamily
1YW9A 4U6WA 2GG7A 2IW2A 4MATA 4ZNGA 2BH3A 1N51A 1C23A 4A6WA 2G6PA 3IU9A 5JHUA 2GGBA 1YVMA 1BN5A 4OOKA 1R5GA 3CTZA 5CDEA 4HXXA 2V3YA 4FLLA 2B3LA 2EVCA 4RZYA 1JAWA 3BIPA 4U76A 2EVMA 3IU8A 1M35A 1W2MA 2V6CA 2GG9A 2OAZA 1WL9A 1XGNA 4B28A 3PKEA 5FCHA 2BHDA 4RGZ1 4FUKA 4JUQA 4U6CA 5FCFA 3MATA 3IG4A 4IKUA 2HOWA 4S00A 2BN7A 1WKMA 2GU6A 2Q95A 1KP0A 3RVAA 2GTXA 1YW8A 2Q92A 4IPAA 5CDLA 5JFRA 4EGEA 2EA4A 3L24A 3Q6DA 3TAVA 5D6FA 2BWWA 2BWXA 3FMRA 4R60A 4IKRA 1QXYA 2EVOA 2GU7A 3L7GA 4KM3A 5E5BA 5CE6A 4FLJA 1B59A 2GG0A 2BHAA 4FLKA 4RZZA 4IKTA 2NQ7A 1MATA 3PKCA 2GG2A 1B6AA 1XGMA 2BWYA 4A6VA 4IDYA 5D6EA 2BWUA 2ADUA 2GA2A 4U73A 1WY2A 1C22A 4Z7MA 1CHMA 1XGOA 2GU4A 3TB5A 2BWSA 2P98A 2Q96A 4ZWUA 1O0XA 2NQ6A 2BB7A 2Q93A 3RORA 1WL6A 3FMQA 3PKDA 4PV4A 1QXWA 1WLRA 1XNZA 4U1BA 1XGSA 2ZSGA 4IU6A 1KQ0A 2GZ5A 4U75A 4IKSA 1PV9A 4U6ZA 3PKBA 4FLIA 4S01A 2DFIA 3BIQA 5CDVA 3FM3A 2GU5A 4U71A 4U70A 2GG3A 5CNXA 4PNCA 4IECA 1WN1A 2B3KA 4ZWOA 1QZYA 2MATA 2OKNA 4ZWPA 4FO7A 2V3XA 1BOAA 1QXZA 4FO8A 3MR1A 1W7VA 3BITA 1R58A 3S6BA 1A16A 1C21A 2P99A 2GG8A 2GGCA 3D27A 2Q8KA 5JI6A 2B3HA 2V3ZA 4U69A 5CLSA 3MX6A 1YW7A 4S2TP 5CIKA 2GG5A 4FKCA 1C27A 3CB5A 1WBQA 1Y1NA 1R5HA 2BWVA 4IF7A 4S2RP 2BWTA 3CB6A 1YJ3A 2P9AA 3IU7A 2EA2A 3PKAA 2BHCA 2Q94A 4QR8A 4U6EA 4U6JA 1KQ9A 2BHBA 1C24A
chains in the Genus database with same CATH topology
1YW9A 4U6WA 2GG7A 2IW2A 4MATA 4ZNGA 2BH3A 1N51A 1C23A 4A6WA 2G6PA 3IU9A 5JHUA 2GGBA 1YVMA 1BN5A 4OOKA 1R5GA 3CTZA 5CDEA 4HXXA 2V3YA 4FLLA 2B3LA 2EVCA 4RZYA 1JAWA 3BIPA 4U76A 2EVMA 3IU8A 1M35A 1W2MA 2V6CA 2GG9A 2OAZA 1WL9A 1XGNA 4B28A 3PKEA 5FCHA 2BHDA 4RGZ1 4FUKA 4JUQA 4U6CA 5FCFA 3MATA 3IG4A 4IKUA 2HOWA 4S00A 2BN7A 1WKMA 2GU6A 2Q95A 1KP0A 3RVAA 2GTXA 1YW8A 2Q92A 4IPAA 5CDLA 5JFRA 4EGEA 2EA4A 3L24A 3Q6DA 3TAVA 5D6FA 2BWWA 2BWXA 3FMRA 4R60A 4IKRA 1QXYA 2EVOA 2GU7A 3L7GA 4KM3A 5E5BA 5CE6A 4FLJA 1B59A 2GG0A 2BHAA 4FLKA 4RZZA 4IKTA 2NQ7A 1MATA 3PKCA 2GG2A 1B6AA 1XGMA 2BWYA 4A6VA 4IDYA 5D6EA 2BWUA 2ADUA 2GA2A 4U73A 1WY2A 1C22A 4Z7MA 1CHMA 1XGOA 2GU4A 3TB5A 2BWSA 2P98A 2Q96A 4ZWUA 1O0XA 2NQ6A 2BB7A 2Q93A 3RORA 1WL6A 3FMQA 3PKDA 4PV4A 1QXWA 1WLRA 1XNZA 4U1BA 1XGSA 2ZSGA 4IU6A 1KQ0A 2GZ5A 4U75A 4IKSA 1PV9A 4U6ZA 3PKBA 4FLIA 4S01A 2DFIA 3BIQA 5CDVA 3FM3A 2GU5A 4U71A 4U70A 2GG3A 5CNXA 4PNCA 4IECA 1WN1A 2B3KA 4ZWOA 1QZYA 2MATA 2OKNA 4ZWPA 4FO7A 2V3XA 1BOAA 1QXZA 4FO8A 3MR1A 1W7VA 3BITA 1R58A 3S6BA 1A16A 1C21A 2P99A 2GG8A 2GGCA 3D27A 2Q8KA 5JI6A 2B3HA 2V3ZA 4U69A 5CLSA 3MX6A 1YW7A 4S2TP 5CIKA 2GG5A 4FKCA 1C27A 3CB5A 1WBQA 1Y1NA 1R5HA 2BWVA 4IF7A 4S2RP 2BWTA 3CB6A 1YJ3A 2P9AA 3IU7A 2EA2A 3PKAA 2BHCA 2Q94A 4QR8A 4U6EA 4U6JA 1KQ9A 2BHBA 1C24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW9 A;  4U6W A;  2GG7 A;  2IW2 A;  4MAT A;  4ZNG A;  2BH3 A;  1N51 A;  1C23 A;  4A6W A;  2G6P A;  3IU9 A;  5JHU A;  2GGB A;  1YVM A;  1BN5 A;  4OOK A;  1R5G A;  3CTZ A;  5CDE A;  4HXX A;  2V3Y A;  4FLL A;  2B3L A;  2EVC A;  4RZY A;  1JAW A;  3BIP A;  4U76 A;  2EVM A;  3IU8 A;  1M35 A;  1W2M A;  2V6C A;  2GG9 A;  2OAZ A;  1WL9 A;  1XGN A;  4B28 A;  3PKE A;  5FCH A;  2BHD A;  4RGZ 1;  4FUK A;  4JUQ A;  4U6C A;  5FCF A;  3MAT A;  3IG4 A;  4IKU A;  2HOW A;  4S00 A;  2BN7 A;  1WKM A;  2GU6 A;  2Q95 A;  1KP0 A;  3RVA A;  2GTX A;  1YW8 A;  2Q92 A;  4IPA A;  5CDL A;  5JFR A;  4EGE A;  2EA4 A;  3L24 A;  3Q6D A;  3TAV A;  5D6F A;  2BWW A;  2BWX A;  3FMR A;  4R60 A;  4IKR A;  1QXY A;  2EVO A;  2GU7 A;  3L7G A;  4KM3 A;  5E5B A;  5CE6 A;  4FLJ A;  1B59 A;  2GG0 A;  2BHA A;  4FLK A;  4RZZ A;  4IKT A;  2NQ7 A;  1MAT A;  3PKC A;  2GG2 A;  1B6A A;  1XGM A;  2BWY A;  4A6V A;  4IDY A;  5D6E A;  2BWU A;  2ADU A;  2GA2 A;  4U73 A;  1WY2 A;  1C22 A;  4Z7M A;  1CHM A;  1XGO A;  2GU4 A;  3TB5 A;  2BWS A;  2P98 A;  2Q96 A;  4ZWU A;  1O0X A;  2NQ6 A;  2BB7 A;  2Q93 A;  3ROR A;  1WL6 A;  3FMQ A;  3PKD A;  4PV4 A;  1QXW A;  1WLR A;  1XNZ A;  4U1B A;  1XGS A;  2ZSG A;  4IU6 A;  1KQ0 A;  2GZ5 A;  4U75 A;  4IKS A;  1PV9 A;  4U6Z A;  3PKB A;  4FLI A;  4S01 A;  2DFI A;  3BIQ A;  5CDV A;  3FM3 A;  2GU5 A;  4U71 A;  4U70 A;  2GG3 A;  5CNX A;  4PNC A;  4IEC A;  1WN1 A;  2B3K A;  4ZWO A;  1QZY A;  2MAT A;  2OKN A;  4ZWP A;  4FO7 A;  2V3X A;  1BOA A;  1QXZ A;  4FO8 A;  3MR1 A;  1W7V A;  3BIT A;  1R58 A;  3S6B A;  1A16 A;  1C21 A;  2P99 A;  2GG8 A;  2GGC A;  3D27 A;  2Q8K A;  5JI6 A;  2B3H A;  2V3Z A;  4U69 A;  5CLS A;  3MX6 A;  1YW7 A;  4S2T P;  5CIK A;  2GG5 A;  4FKC A;  1C27 A;  3CB5 A;  1WBQ A;  1Y1N A;  1R5H A;  2BWV A;  4IF7 A;  4S2R P;  2BWT A;  3CB6 A;  1YJ3 A;  2P9A A;  3IU7 A;  2EA2 A;  3PKA A;  2BHC A;  2Q94 A;  4QR8 A;  4U6E A;  4U6J A;  1KQ9 A;  2BHB A;  1C24 A; 
#chains in the Genus database with same CATH topology
 1YW9 A;  4U6W A;  2GG7 A;  2IW2 A;  4MAT A;  4ZNG A;  2BH3 A;  1N51 A;  1C23 A;  4A6W A;  2G6P A;  3IU9 A;  5JHU A;  2GGB A;  1YVM A;  1BN5 A;  4OOK A;  1R5G A;  3CTZ A;  5CDE A;  4HXX A;  2V3Y A;  4FLL A;  2B3L A;  2EVC A;  4RZY A;  1JAW A;  3BIP A;  4U76 A;  2EVM A;  3IU8 A;  1M35 A;  1W2M A;  2V6C A;  2GG9 A;  2OAZ A;  1WL9 A;  1XGN A;  4B28 A;  3PKE A;  5FCH A;  2BHD A;  4RGZ 1;  4FUK A;  4JUQ A;  4U6C A;  5FCF A;  3MAT A;  3IG4 A;  4IKU A;  2HOW A;  4S00 A;  2BN7 A;  1WKM A;  2GU6 A;  2Q95 A;  1KP0 A;  3RVA A;  2GTX A;  1YW8 A;  2Q92 A;  4IPA A;  5CDL A;  5JFR A;  4EGE A;  2EA4 A;  3L24 A;  3Q6D A;  3TAV A;  5D6F A;  2BWW A;  2BWX A;  3FMR A;  4R60 A;  4IKR A;  1QXY A;  2EVO A;  2GU7 A;  3L7G A;  4KM3 A;  5E5B A;  5CE6 A;  4FLJ A;  1B59 A;  2GG0 A;  2BHA A;  4FLK A;  4RZZ A;  4IKT A;  2NQ7 A;  1MAT A;  3PKC A;  2GG2 A;  1B6A A;  1XGM A;  2BWY A;  4A6V A;  4IDY A;  5D6E A;  2BWU A;  2ADU A;  2GA2 A;  4U73 A;  1WY2 A;  1C22 A;  4Z7M A;  1CHM A;  1XGO A;  2GU4 A;  3TB5 A;  2BWS A;  2P98 A;  2Q96 A;  4ZWU A;  1O0X A;  2NQ6 A;  2BB7 A;  2Q93 A;  3ROR A;  1WL6 A;  3FMQ A;  3PKD A;  4PV4 A;  1QXW A;  1WLR A;  1XNZ A;  4U1B A;  1XGS A;  2ZSG A;  4IU6 A;  1KQ0 A;  2GZ5 A;  4U75 A;  4IKS A;  1PV9 A;  4U6Z A;  3PKB A;  4FLI A;  4S01 A;  2DFI A;  3BIQ A;  5CDV A;  3FM3 A;  2GU5 A;  4U71 A;  4U70 A;  2GG3 A;  5CNX A;  4PNC A;  4IEC A;  1WN1 A;  2B3K A;  4ZWO A;  1QZY A;  2MAT A;  2OKN A;  4ZWP A;  4FO7 A;  2V3X A;  1BOA A;  1QXZ A;  4FO8 A;  3MR1 A;  1W7V A;  3BIT A;  1R58 A;  3S6B A;  1A16 A;  1C21 A;  2P99 A;  2GG8 A;  2GGC A;  3D27 A;  2Q8K A;  5JI6 A;  2B3H A;  2V3Z A;  4U69 A;  5CLS A;  3MX6 A;  1YW7 A;  4S2T P;  5CIK A;  2GG5 A;  4FKC A;  1C27 A;  3CB5 A;  1WBQ A;  1Y1N A;  1R5H A;  2BWV A;  4IF7 A;  4S2R P;  2BWT A;  3CB6 A;  1YJ3 A;  2P9A A;  3IU7 A;  2EA2 A;  3PKA A;  2BHC A;  2Q94 A;  4QR8 A;  4U6E A;  4U6J A;  1KQ9 A;  2BHB A;  1C24 A; 
#chains in the Genus database with same CATH homology
 1YW9 A;  4U6W A;  2GG7 A;  2IW2 A;  4MAT A;  4ZNG A;  2BH3 A;  1N51 A;  1C23 A;  4A6W A;  2G6P A;  3IU9 A;  5JHU A;  2GGB A;  1YVM A;  1BN5 A;  4OOK A;  1R5G A;  3CTZ A;  5CDE A;  4HXX A;  2V3Y A;  4FLL A;  2B3L A;  2EVC A;  4RZY A;  1JAW A;  3BIP A;  4U76 A;  2EVM A;  3IU8 A;  1M35 A;  1W2M A;  2V6C A;  2GG9 A;  2OAZ A;  1WL9 A;  1XGN A;  4B28 A;  3PKE A;  5FCH A;  2BHD A;  4RGZ 1;  4FUK A;  4JUQ A;  4U6C A;  5FCF A;  3MAT A;  3IG4 A;  4IKU A;  2HOW A;  4S00 A;  2BN7 A;  1WKM A;  2GU6 A;  2Q95 A;  1KP0 A;  3RVA A;  2GTX A;  1YW8 A;  2Q92 A;  4IPA A;  5CDL A;  5JFR A;  4EGE A;  2EA4 A;  3L24 A;  3Q6D A;  3TAV A;  5D6F A;  2BWW A;  2BWX A;  3FMR A;  4R60 A;  4IKR A;  1QXY A;  2EVO A;  2GU7 A;  3L7G A;  4KM3 A;  5E5B A;  5CE6 A;  4FLJ A;  1B59 A;  2GG0 A;  2BHA A;  4FLK A;  4RZZ A;  4IKT A;  2NQ7 A;  1MAT A;  3PKC A;  2GG2 A;  1B6A A;  1XGM A;  2BWY A;  4A6V A;  4IDY A;  5D6E A;  2BWU A;  2ADU A;  2GA2 A;  4U73 A;  1WY2 A;  1C22 A;  4Z7M A;  1CHM A;  1XGO A;  2GU4 A;  3TB5 A;  2BWS A;  2P98 A;  2Q96 A;  4ZWU A;  1O0X A;  2NQ6 A;  2BB7 A;  2Q93 A;  3ROR A;  1WL6 A;  3FMQ A;  3PKD A;  4PV4 A;  1QXW A;  1WLR A;  1XNZ A;  4U1B A;  1XGS A;  2ZSG A;  4IU6 A;  1KQ0 A;  2GZ5 A;  4U75 A;  4IKS A;  1PV9 A;  4U6Z A;  3PKB A;  4FLI A;  4S01 A;  2DFI A;  3BIQ A;  5CDV A;  3FM3 A;  2GU5 A;  4U71 A;  4U70 A;  2GG3 A;  5CNX A;  4PNC A;  4IEC A;  1WN1 A;  2B3K A;  4ZWO A;  1QZY A;  2MAT A;  2OKN A;  4ZWP A;  4FO7 A;  2V3X A;  1BOA A;  1QXZ A;  4FO8 A;  3MR1 A;  1W7V A;  3BIT A;  1R58 A;  3S6B A;  1A16 A;  1C21 A;  2P99 A;  2GG8 A;  2GGC A;  3D27 A;  2Q8K A;  5JI6 A;  2B3H A;  2V3Z A;  4U69 A;  5CLS A;  3MX6 A;  1YW7 A;  4S2T P;  5CIK A;  2GG5 A;  4FKC A;  1C27 A;  3CB5 A;  1WBQ A;  1Y1N A;  1R5H A;  2BWV A;  4IF7 A;  4S2R P;  2BWT A;  3CB6 A;  1YJ3 A;  2P9A A;  3IU7 A;  2EA2 A;  3PKA A;  2BHC A;  2Q94 A;  4QR8 A;  4U6E A;  4U6J A;  1KQ9 A;  2BHB A;  1C24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...