4U70A

Hsmetap (f309m) in complex with (1-amino-2-cyclohexylethyl)phosphonic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u70A00
5CNXA 2Q8KA 4S2TP 2BH3A 2DFIA 5CDLA 3FM3A 1QXZA 1QZYA 1R5HA 1YJ3A 3PKBA 4PV4A 2V3ZA 1JAWA 2V3YA 3PKEA 1B6AA 4FKCA 4IPAA 3CB5A 2B3HA 2B3KA 4U75A 2BWSA 2GTXA 2EVCA 4S00A 2Q94A 2GG2A 2Q95A 4IKTA 2BHDA 2EVOA 4FUKA 4U6CA 4QR8A 3S6BA 5JFRA 3IU7A 5E5BA 1XGMA 4U70A 1KP0A 1WKMA 4Z7MA 4ZWPA 3RVAA 5D6FA 2GU4A 4IKUA 1WL6A 2IW2A 2BWWA 2ADUA 2BB7A 4IU6A 4IF7A 4R60A 1XGNA 1R58A 2BWYA 2ZSGA 3TB5A 2OKNA 4U6ZA 2GGBA 5CIKA 4U73A 4OOKA 4U69A 2BWXA 1XGOA 2V6CA 4S01A 1YVMA 2GZ5A 2HOWA 3L7GA 4MATA 4U1BA 3PKDA 3TAVA 2V3XA 1WLRA 2GG8A 4IKRA 4FLJA 1W7VA 3MX6A 2BWVA 1WL9A 1PV9A 3CB6A 1M35A 2GG5A 1YW7A 2GG3A 4ZWUA 2G6PA 3RORA 4A6VA 3IG4A 1WY2A 3IU8A 1Y1NA 2P98A 5CDVA 5CDEA 4IKSA 4ZWOA 3BIQA 4A6WA 1C21A 5JHUA 1YW9A 2EVMA 2P99A 3BITA 3D27A 2BN7A 2GU5A 2GU7A 3FMRA 1O0XA 3PKCA 3FMQA 3IU9A 1QXYA 2GA2A 2MATA 2B3LA 2EA4A 4KM3A 5FCHA 4EGEA 1BN5A 2GU6A 4FLIA 1CHMA 4U76A 2BHCA 2Q92A 1C24A 1KQ0A 1XNZA 2GGCA 4HXXA 4IDYA 4JUQA 2GG0A 5JI6A 1N51A 4FO8A 3Q6DA 3BIPA 2GG7A 4FLKA 3MATA 2Q93A 4U71A 1BOAA 5FCFA 4S2RP 4ZNGA 3L24A 4U6WA 1C22A 1C23A 1C27A 2GG9A 2OAZA 3MR1A 2BHAA 5D6EA 1KQ9A 1R5GA 2NQ7A 5CLSA 2NQ6A 2P9AA 1XGSA 1W2MA 4FO7A 4U6JA 4RGZ1 2Q96A 1QXWA 1B59A 4RZYA 2BWUA 3CTZA 1WN1A 4IECA 2BWTA 2EA2A 4RZZA 3PKAA 4U6EA 1WBQA 4B28A 4FLLA 1MATA 2BHBA 4PNCA 5CE6A 1YW8A 1A16A
chains in the Genus database with same CATH superfamily
5CNXA 2Q8KA 4S2TP 2BH3A 2DFIA 5CDLA 3FM3A 1QXZA 1QZYA 1R5HA 1YJ3A 3PKBA 4PV4A 2V3ZA 1JAWA 2V3YA 3PKEA 1B6AA 4FKCA 4IPAA 3CB5A 2B3HA 2B3KA 4U75A 2BWSA 2GTXA 2EVCA 4S00A 2Q94A 2GG2A 2Q95A 4IKTA 2BHDA 2EVOA 4FUKA 4U6CA 4QR8A 3S6BA 5JFRA 3IU7A 5E5BA 1XGMA 4U70A 1KP0A 1WKMA 4Z7MA 4ZWPA 3RVAA 5D6FA 2GU4A 4IKUA 1WL6A 2IW2A 2BWWA 2ADUA 2BB7A 4IU6A 4IF7A 4R60A 1XGNA 1R58A 2BWYA 2ZSGA 3TB5A 2OKNA 4U6ZA 2GGBA 5CIKA 4U73A 4OOKA 4U69A 2BWXA 1XGOA 2V6CA 4S01A 1YVMA 2GZ5A 2HOWA 3L7GA 4MATA 4U1BA 3PKDA 3TAVA 2V3XA 1WLRA 2GG8A 4IKRA 4FLJA 1W7VA 3MX6A 2BWVA 1WL9A 1PV9A 3CB6A 1M35A 2GG5A 1YW7A 2GG3A 4ZWUA 2G6PA 3RORA 4A6VA 3IG4A 1WY2A 3IU8A 1Y1NA 2P98A 5CDVA 5CDEA 4IKSA 4ZWOA 3BIQA 4A6WA 1C21A 5JHUA 1YW9A 2EVMA 2P99A 3BITA 3D27A 2BN7A 2GU5A 2GU7A 3FMRA 1O0XA 3PKCA 3FMQA 3IU9A 1QXYA 2GA2A 2MATA 2B3LA 2EA4A 4KM3A 5FCHA 4EGEA 1BN5A 2GU6A 4FLIA 1CHMA 4U76A 2BHCA 2Q92A 1C24A 1KQ0A 1XNZA 2GGCA 4HXXA 4IDYA 4JUQA 2GG0A 5JI6A 1N51A 4FO8A 3Q6DA 3BIPA 2GG7A 4FLKA 3MATA 2Q93A 4U71A 1BOAA 5FCFA 4S2RP 4ZNGA 3L24A 4U6WA 1C22A 1C23A 1C27A 2GG9A 2OAZA 3MR1A 2BHAA 5D6EA 1KQ9A 1R5GA 2NQ7A 5CLSA 2NQ6A 2P9AA 1XGSA 1W2MA 4FO7A 4U6JA 4RGZ1 2Q96A 1QXWA 1B59A 4RZYA 2BWUA 3CTZA 1WN1A 4IECA 2BWTA 2EA2A 4RZZA 3PKAA 4U6EA 1WBQA 4B28A 4FLLA 1MATA 2BHBA 4PNCA 5CE6A 1YW8A 1A16A
chains in the Genus database with same CATH topology
5CNXA 2Q8KA 4S2TP 2BH3A 2DFIA 5CDLA 3FM3A 1QXZA 1QZYA 1R5HA 1YJ3A 3PKBA 4PV4A 2V3ZA 1JAWA 2V3YA 3PKEA 1B6AA 4FKCA 4IPAA 3CB5A 2B3HA 2B3KA 4U75A 2BWSA 2GTXA 2EVCA 4S00A 2Q94A 2GG2A 2Q95A 4IKTA 2BHDA 2EVOA 4FUKA 4U6CA 4QR8A 3S6BA 5JFRA 3IU7A 5E5BA 1XGMA 4U70A 1KP0A 1WKMA 4Z7MA 4ZWPA 3RVAA 5D6FA 2GU4A 4IKUA 1WL6A 2IW2A 2BWWA 2ADUA 2BB7A 4IU6A 4IF7A 4R60A 1XGNA 1R58A 2BWYA 2ZSGA 3TB5A 2OKNA 4U6ZA 2GGBA 5CIKA 4U73A 4OOKA 4U69A 2BWXA 1XGOA 2V6CA 4S01A 1YVMA 2GZ5A 2HOWA 3L7GA 4MATA 4U1BA 3PKDA 3TAVA 2V3XA 1WLRA 2GG8A 4IKRA 4FLJA 1W7VA 3MX6A 2BWVA 1WL9A 1PV9A 3CB6A 1M35A 2GG5A 1YW7A 2GG3A 4ZWUA 2G6PA 3RORA 4A6VA 3IG4A 1WY2A 3IU8A 1Y1NA 2P98A 5CDVA 5CDEA 4IKSA 4ZWOA 3BIQA 4A6WA 1C21A 5JHUA 1YW9A 2EVMA 2P99A 3BITA 3D27A 2BN7A 2GU5A 2GU7A 3FMRA 1O0XA 3PKCA 3FMQA 3IU9A 1QXYA 2GA2A 2MATA 2B3LA 2EA4A 4KM3A 5FCHA 4EGEA 1BN5A 2GU6A 4FLIA 1CHMA 4U76A 2BHCA 2Q92A 1C24A 1KQ0A 1XNZA 2GGCA 4HXXA 4IDYA 4JUQA 2GG0A 5JI6A 1N51A 4FO8A 3Q6DA 3BIPA 2GG7A 4FLKA 3MATA 2Q93A 4U71A 1BOAA 5FCFA 4S2RP 4ZNGA 3L24A 4U6WA 1C22A 1C23A 1C27A 2GG9A 2OAZA 3MR1A 2BHAA 5D6EA 1KQ9A 1R5GA 2NQ7A 5CLSA 2NQ6A 2P9AA 1XGSA 1W2MA 4FO7A 4U6JA 4RGZ1 2Q96A 1QXWA 1B59A 4RZYA 2BWUA 3CTZA 1WN1A 4IECA 2BWTA 2EA2A 4RZZA 3PKAA 4U6EA 1WBQA 4B28A 4FLLA 1MATA 2BHBA 4PNCA 5CE6A 1YW8A 1A16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CNX A;  2Q8K A;  4S2T P;  2BH3 A;  2DFI A;  5CDL A;  3FM3 A;  1QXZ A;  1QZY A;  1R5H A;  1YJ3 A;  3PKB A;  4PV4 A;  2V3Z A;  1JAW A;  2V3Y A;  3PKE A;  1B6A A;  4FKC A;  4IPA A;  3CB5 A;  2B3H A;  2B3K A;  4U75 A;  2BWS A;  2GTX A;  2EVC A;  4S00 A;  2Q94 A;  2GG2 A;  2Q95 A;  4IKT A;  2BHD A;  2EVO A;  4FUK A;  4U6C A;  4QR8 A;  3S6B A;  5JFR A;  3IU7 A;  5E5B A;  1XGM A;  4U70 A;  1KP0 A;  1WKM A;  4Z7M A;  4ZWP A;  3RVA A;  5D6F A;  2GU4 A;  4IKU A;  1WL6 A;  2IW2 A;  2BWW A;  2ADU A;  2BB7 A;  4IU6 A;  4IF7 A;  4R60 A;  1XGN A;  1R58 A;  2BWY A;  2ZSG A;  3TB5 A;  2OKN A;  4U6Z A;  2GGB A;  5CIK A;  4U73 A;  4OOK A;  4U69 A;  2BWX A;  1XGO A;  2V6C A;  4S01 A;  1YVM A;  2GZ5 A;  2HOW A;  3L7G A;  4MAT A;  4U1B A;  3PKD A;  3TAV A;  2V3X A;  1WLR A;  2GG8 A;  4IKR A;  4FLJ A;  1W7V A;  3MX6 A;  2BWV A;  1WL9 A;  1PV9 A;  3CB6 A;  1M35 A;  2GG5 A;  1YW7 A;  2GG3 A;  4ZWU A;  2G6P A;  3ROR A;  4A6V A;  3IG4 A;  1WY2 A;  3IU8 A;  1Y1N A;  2P98 A;  5CDV A;  5CDE A;  4IKS A;  4ZWO A;  3BIQ A;  4A6W A;  1C21 A;  5JHU A;  1YW9 A;  2EVM A;  2P99 A;  3BIT A;  3D27 A;  2BN7 A;  2GU5 A;  2GU7 A;  3FMR A;  1O0X A;  3PKC A;  3FMQ A;  3IU9 A;  1QXY A;  2GA2 A;  2MAT A;  2B3L A;  2EA4 A;  4KM3 A;  5FCH A;  4EGE A;  1BN5 A;  2GU6 A;  4FLI A;  1CHM A;  4U76 A;  2BHC A;  2Q92 A;  1C24 A;  1KQ0 A;  1XNZ A;  2GGC A;  4HXX A;  4IDY A;  4JUQ A;  2GG0 A;  5JI6 A;  1N51 A;  4FO8 A;  3Q6D A;  3BIP A;  2GG7 A;  4FLK A;  3MAT A;  2Q93 A;  4U71 A;  1BOA A;  5FCF A;  4S2R P;  4ZNG A;  3L24 A;  4U6W A;  1C22 A;  1C23 A;  1C27 A;  2GG9 A;  2OAZ A;  3MR1 A;  2BHA A;  5D6E A;  1KQ9 A;  1R5G A;  2NQ7 A;  5CLS A;  2NQ6 A;  2P9A A;  1XGS A;  1W2M A;  4FO7 A;  4U6J A;  4RGZ 1;  2Q96 A;  1QXW A;  1B59 A;  4RZY A;  2BWU A;  3CTZ A;  1WN1 A;  4IEC A;  2BWT A;  2EA2 A;  4RZZ A;  3PKA A;  4U6E A;  1WBQ A;  4B28 A;  4FLL A;  1MAT A;  2BHB A;  4PNC A;  5CE6 A;  1YW8 A;  1A16 A; 
#chains in the Genus database with same CATH topology
 5CNX A;  2Q8K A;  4S2T P;  2BH3 A;  2DFI A;  5CDL A;  3FM3 A;  1QXZ A;  1QZY A;  1R5H A;  1YJ3 A;  3PKB A;  4PV4 A;  2V3Z A;  1JAW A;  2V3Y A;  3PKE A;  1B6A A;  4FKC A;  4IPA A;  3CB5 A;  2B3H A;  2B3K A;  4U75 A;  2BWS A;  2GTX A;  2EVC A;  4S00 A;  2Q94 A;  2GG2 A;  2Q95 A;  4IKT A;  2BHD A;  2EVO A;  4FUK A;  4U6C A;  4QR8 A;  3S6B A;  5JFR A;  3IU7 A;  5E5B A;  1XGM A;  4U70 A;  1KP0 A;  1WKM A;  4Z7M A;  4ZWP A;  3RVA A;  5D6F A;  2GU4 A;  4IKU A;  1WL6 A;  2IW2 A;  2BWW A;  2ADU A;  2BB7 A;  4IU6 A;  4IF7 A;  4R60 A;  1XGN A;  1R58 A;  2BWY A;  2ZSG A;  3TB5 A;  2OKN A;  4U6Z A;  2GGB A;  5CIK A;  4U73 A;  4OOK A;  4U69 A;  2BWX A;  1XGO A;  2V6C A;  4S01 A;  1YVM A;  2GZ5 A;  2HOW A;  3L7G A;  4MAT A;  4U1B A;  3PKD A;  3TAV A;  2V3X A;  1WLR A;  2GG8 A;  4IKR A;  4FLJ A;  1W7V A;  3MX6 A;  2BWV A;  1WL9 A;  1PV9 A;  3CB6 A;  1M35 A;  2GG5 A;  1YW7 A;  2GG3 A;  4ZWU A;  2G6P A;  3ROR A;  4A6V A;  3IG4 A;  1WY2 A;  3IU8 A;  1Y1N A;  2P98 A;  5CDV A;  5CDE A;  4IKS A;  4ZWO A;  3BIQ A;  4A6W A;  1C21 A;  5JHU A;  1YW9 A;  2EVM A;  2P99 A;  3BIT A;  3D27 A;  2BN7 A;  2GU5 A;  2GU7 A;  3FMR A;  1O0X A;  3PKC A;  3FMQ A;  3IU9 A;  1QXY A;  2GA2 A;  2MAT A;  2B3L A;  2EA4 A;  4KM3 A;  5FCH A;  4EGE A;  1BN5 A;  2GU6 A;  4FLI A;  1CHM A;  4U76 A;  2BHC A;  2Q92 A;  1C24 A;  1KQ0 A;  1XNZ A;  2GGC A;  4HXX A;  4IDY A;  4JUQ A;  2GG0 A;  5JI6 A;  1N51 A;  4FO8 A;  3Q6D A;  3BIP A;  2GG7 A;  4FLK A;  3MAT A;  2Q93 A;  4U71 A;  1BOA A;  5FCF A;  4S2R P;  4ZNG A;  3L24 A;  4U6W A;  1C22 A;  1C23 A;  1C27 A;  2GG9 A;  2OAZ A;  3MR1 A;  2BHA A;  5D6E A;  1KQ9 A;  1R5G A;  2NQ7 A;  5CLS A;  2NQ6 A;  2P9A A;  1XGS A;  1W2M A;  4FO7 A;  4U6J A;  4RGZ 1;  2Q96 A;  1QXW A;  1B59 A;  4RZY A;  2BWU A;  3CTZ A;  1WN1 A;  4IEC A;  2BWT A;  2EA2 A;  4RZZ A;  3PKA A;  4U6E A;  1WBQ A;  4B28 A;  4FLL A;  1MAT A;  2BHB A;  4PNC A;  5CE6 A;  1YW8 A;  1A16 A; 
#chains in the Genus database with same CATH homology
 5CNX A;  2Q8K A;  4S2T P;  2BH3 A;  2DFI A;  5CDL A;  3FM3 A;  1QXZ A;  1QZY A;  1R5H A;  1YJ3 A;  3PKB A;  4PV4 A;  2V3Z A;  1JAW A;  2V3Y A;  3PKE A;  1B6A A;  4FKC A;  4IPA A;  3CB5 A;  2B3H A;  2B3K A;  4U75 A;  2BWS A;  2GTX A;  2EVC A;  4S00 A;  2Q94 A;  2GG2 A;  2Q95 A;  4IKT A;  2BHD A;  2EVO A;  4FUK A;  4U6C A;  4QR8 A;  3S6B A;  5JFR A;  3IU7 A;  5E5B A;  1XGM A;  4U70 A;  1KP0 A;  1WKM A;  4Z7M A;  4ZWP A;  3RVA A;  5D6F A;  2GU4 A;  4IKU A;  1WL6 A;  2IW2 A;  2BWW A;  2ADU A;  2BB7 A;  4IU6 A;  4IF7 A;  4R60 A;  1XGN A;  1R58 A;  2BWY A;  2ZSG A;  3TB5 A;  2OKN A;  4U6Z A;  2GGB A;  5CIK A;  4U73 A;  4OOK A;  4U69 A;  2BWX A;  1XGO A;  2V6C A;  4S01 A;  1YVM A;  2GZ5 A;  2HOW A;  3L7G A;  4MAT A;  4U1B A;  3PKD A;  3TAV A;  2V3X A;  1WLR A;  2GG8 A;  4IKR A;  4FLJ A;  1W7V A;  3MX6 A;  2BWV A;  1WL9 A;  1PV9 A;  3CB6 A;  1M35 A;  2GG5 A;  1YW7 A;  2GG3 A;  4ZWU A;  2G6P A;  3ROR A;  4A6V A;  3IG4 A;  1WY2 A;  3IU8 A;  1Y1N A;  2P98 A;  5CDV A;  5CDE A;  4IKS A;  4ZWO A;  3BIQ A;  4A6W A;  1C21 A;  5JHU A;  1YW9 A;  2EVM A;  2P99 A;  3BIT A;  3D27 A;  2BN7 A;  2GU5 A;  2GU7 A;  3FMR A;  1O0X A;  3PKC A;  3FMQ A;  3IU9 A;  1QXY A;  2GA2 A;  2MAT A;  2B3L A;  2EA4 A;  4KM3 A;  5FCH A;  4EGE A;  1BN5 A;  2GU6 A;  4FLI A;  1CHM A;  4U76 A;  2BHC A;  2Q92 A;  1C24 A;  1KQ0 A;  1XNZ A;  2GGC A;  4HXX A;  4IDY A;  4JUQ A;  2GG0 A;  5JI6 A;  1N51 A;  4FO8 A;  3Q6D A;  3BIP A;  2GG7 A;  4FLK A;  3MAT A;  2Q93 A;  4U71 A;  1BOA A;  5FCF A;  4S2R P;  4ZNG A;  3L24 A;  4U6W A;  1C22 A;  1C23 A;  1C27 A;  2GG9 A;  2OAZ A;  3MR1 A;  2BHA A;  5D6E A;  1KQ9 A;  1R5G A;  2NQ7 A;  5CLS A;  2NQ6 A;  2P9A A;  1XGS A;  1W2M A;  4FO7 A;  4U6J A;  4RGZ 1;  2Q96 A;  1QXW A;  1B59 A;  4RZY A;  2BWU A;  3CTZ A;  1WN1 A;  4IEC A;  2BWT A;  2EA2 A;  4RZZ A;  3PKA A;  4U6E A;  1WBQ A;  4B28 A;  4FLL A;  1MAT A;  2BHB A;  4PNC A;  5CE6 A;  1YW8 A;  1A16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...