4U70A

Hsmetap (f309m) in complex with (1-amino-2-cyclohexylethyl)phosphonic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
molecule tags Hydrolase
source organism Homo sapiens
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u70A00
1C24A 2EVOA 2BHAA 3PKDA 4R60A 4KM3A 2V3ZA 1C22A 2BHDA 5CNXA 2P99A 1XGSA 4S00A 3TAVA 3IU7A 1YJ3A 4RZYA 2BH3A 4U6JA 2BWTA 1PV9A 1WL6A 2B3LA 2GGBA 4FLJA 2GU6A 3FMQA 4B28A 4FLKA 1JAWA 4RZZA 5D6FA 2GU7A 1YW7A 4FO7A 1XGNA 4IKSA 1W7VA 2BB7A 2GG2A 2G6PA 1QXWA 4ZWPA 4U1BA 4QR8A 4OOKA 2P9AA 2Q92A 2DFIA 4IKRA 2EA4A 1QXYA 5E5BA 4ZWOA 1WBQA 3CB5A 2HOWA 3PKEA 2GGCA 1R5GA 4FLIA 3BITA 2BHCA 4IKTA 2ADUA 4U6ZA 2BWVA 2Q8KA 4PNCA 2GZ5A 1XGMA 2GG0A 4S01A 4U71A 2B3KA 1WKMA 1MATA 2BWYA 1XNZA 1QZYA 2V6CA 2BWXA 4IF7A 4IU6A 4U75A 3FMRA 2OKNA 2BN7A 1W2MA 2EVMA 3BIQA 4U69A 1QXZA 1BN5A 5FCHA 1C27A 4A6VA 2MATA 1C21A 4FKCA 4FUKA 3CB6A 4FLLA 2Q95A 3IU8A 2GG8A 2GU5A 2IW2A 1XGOA 2V3XA 3MX6A 2GA2A 4ZWUA 4S2TP 2BHBA 3PKAA 3L7GA 3S6BA 5CDVA 4ZNGA 3L24A 4Z7MA 4MATA 3IU9A 1KP0A 2B3HA 2EVCA 4S2RP 5CDEA 3PKBA 3D27A 2Q96A 4U73A 5CDLA 4IDYA 4EGEA 1KQ9A 1CHMA 1O0XA 4U76A 4U6EA 2OAZA 1BOAA 1WLRA 5JHUA 2NQ7A 5JI6A 2ZSGA 1WL9A 3TB5A 2GG3A 5CLSA 1B59A 1YVMA 4IPAA 1YW9A 1M35A 5CIKA 4RGZ1 2BWUA 1WN1A 2BWSA 2Q93A 1B6AA 5JFRA 1R5HA 2GG7A 2V3YA 3FM3A 2EA2A 4FO8A 4HXXA 1YW8A 5FCFA 2Q94A 4IECA 5CE6A 3RVAA 1A16A 3PKCA 3CTZA 3BIPA 3RORA 1C23A 1Y1NA 2P98A 5D6EA 2GTXA 4U6CA 1KQ0A 4A6WA 1N51A 4JUQA 1WY2A 1R58A 2GG5A 2NQ6A 3IG4A 3MATA 3MR1A 4PV4A 4U70A 4U6WA 2GU4A 3Q6DA 4IKUA 2BWWA 2GG9A
chains in the Genus database with same CATH superfamily
1C24A 2EVOA 2BHAA 3PKDA 4R60A 4KM3A 2V3ZA 1C22A 2BHDA 5CNXA 2P99A 1XGSA 4S00A 3TAVA 3IU7A 1YJ3A 4RZYA 2BH3A 4U6JA 2BWTA 1PV9A 1WL6A 2B3LA 2GGBA 4FLJA 2GU6A 3FMQA 4B28A 4FLKA 1JAWA 4RZZA 5D6FA 2GU7A 1YW7A 4FO7A 1XGNA 4IKSA 1W7VA 2BB7A 2GG2A 2G6PA 1QXWA 4ZWPA 4U1BA 4QR8A 4OOKA 2P9AA 2Q92A 2DFIA 4IKRA 2EA4A 1QXYA 5E5BA 4ZWOA 1WBQA 3CB5A 2HOWA 3PKEA 2GGCA 1R5GA 4FLIA 3BITA 2BHCA 4IKTA 2ADUA 4U6ZA 2BWVA 2Q8KA 4PNCA 2GZ5A 1XGMA 2GG0A 4S01A 4U71A 2B3KA 1WKMA 1MATA 2BWYA 1XNZA 1QZYA 2V6CA 2BWXA 4IF7A 4IU6A 4U75A 3FMRA 2OKNA 2BN7A 1W2MA 2EVMA 3BIQA 4U69A 1QXZA 1BN5A 5FCHA 1C27A 4A6VA 2MATA 1C21A 4FKCA 4FUKA 3CB6A 4FLLA 2Q95A 3IU8A 2GG8A 2GU5A 2IW2A 1XGOA 2V3XA 3MX6A 2GA2A 4ZWUA 4S2TP 2BHBA 3PKAA 3L7GA 3S6BA 5CDVA 4ZNGA 3L24A 4Z7MA 4MATA 3IU9A 1KP0A 2B3HA 2EVCA 4S2RP 5CDEA 3PKBA 3D27A 2Q96A 4U73A 5CDLA 4IDYA 4EGEA 1KQ9A 1CHMA 1O0XA 4U76A 4U6EA 2OAZA 1BOAA 1WLRA 5JHUA 2NQ7A 5JI6A 2ZSGA 1WL9A 3TB5A 2GG3A 5CLSA 1B59A 1YVMA 4IPAA 1YW9A 1M35A 5CIKA 4RGZ1 2BWUA 1WN1A 2BWSA 2Q93A 1B6AA 5JFRA 1R5HA 2GG7A 2V3YA 3FM3A 2EA2A 4FO8A 4HXXA 1YW8A 5FCFA 2Q94A 4IECA 5CE6A 3RVAA 1A16A 3PKCA 3CTZA 3BIPA 3RORA 1C23A 1Y1NA 2P98A 5D6EA 2GTXA 4U6CA 1KQ0A 4A6WA 1N51A 4JUQA 1WY2A 1R58A 2GG5A 2NQ6A 3IG4A 3MATA 3MR1A 4PV4A 4U70A 4U6WA 2GU4A 3Q6DA 4IKUA 2BWWA 2GG9A
chains in the Genus database with same CATH topology
1C24A 2EVOA 2BHAA 3PKDA 4R60A 4KM3A 2V3ZA 1C22A 2BHDA 5CNXA 2P99A 1XGSA 4S00A 3TAVA 3IU7A 1YJ3A 4RZYA 2BH3A 4U6JA 2BWTA 1PV9A 1WL6A 2B3LA 2GGBA 4FLJA 2GU6A 3FMQA 4B28A 4FLKA 1JAWA 4RZZA 5D6FA 2GU7A 1YW7A 4FO7A 1XGNA 4IKSA 1W7VA 2BB7A 2GG2A 2G6PA 1QXWA 4ZWPA 4U1BA 4QR8A 4OOKA 2P9AA 2Q92A 2DFIA 4IKRA 2EA4A 1QXYA 5E5BA 4ZWOA 1WBQA 3CB5A 2HOWA 3PKEA 2GGCA 1R5GA 4FLIA 3BITA 2BHCA 4IKTA 2ADUA 4U6ZA 2BWVA 2Q8KA 4PNCA 2GZ5A 1XGMA 2GG0A 4S01A 4U71A 2B3KA 1WKMA 1MATA 2BWYA 1XNZA 1QZYA 2V6CA 2BWXA 4IF7A 4IU6A 4U75A 3FMRA 2OKNA 2BN7A 1W2MA 2EVMA 3BIQA 4U69A 1QXZA 1BN5A 5FCHA 1C27A 4A6VA 2MATA 1C21A 4FKCA 4FUKA 3CB6A 4FLLA 2Q95A 3IU8A 2GG8A 2GU5A 2IW2A 1XGOA 2V3XA 3MX6A 2GA2A 4ZWUA 4S2TP 2BHBA 3PKAA 3L7GA 3S6BA 5CDVA 4ZNGA 3L24A 4Z7MA 4MATA 3IU9A 1KP0A 2B3HA 2EVCA 4S2RP 5CDEA 3PKBA 3D27A 2Q96A 4U73A 5CDLA 4IDYA 4EGEA 1KQ9A 1CHMA 1O0XA 4U76A 4U6EA 2OAZA 1BOAA 1WLRA 5JHUA 2NQ7A 5JI6A 2ZSGA 1WL9A 3TB5A 2GG3A 5CLSA 1B59A 1YVMA 4IPAA 1YW9A 1M35A 5CIKA 4RGZ1 2BWUA 1WN1A 2BWSA 2Q93A 1B6AA 5JFRA 1R5HA 2GG7A 2V3YA 3FM3A 2EA2A 4FO8A 4HXXA 1YW8A 5FCFA 2Q94A 4IECA 5CE6A 3RVAA 1A16A 3PKCA 3CTZA 3BIPA 3RORA 1C23A 1Y1NA 2P98A 5D6EA 2GTXA 4U6CA 1KQ0A 4A6WA 1N51A 4JUQA 1WY2A 1R58A 2GG5A 2NQ6A 3IG4A 3MATA 3MR1A 4PV4A 4U70A 4U6WA 2GU4A 3Q6DA 4IKUA 2BWWA 2GG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C24 A;  2EVO A;  2BHA A;  3PKD A;  4R60 A;  4KM3 A;  2V3Z A;  1C22 A;  2BHD A;  5CNX A;  2P99 A;  1XGS A;  4S00 A;  3TAV A;  3IU7 A;  1YJ3 A;  4RZY A;  2BH3 A;  4U6J A;  2BWT A;  1PV9 A;  1WL6 A;  2B3L A;  2GGB A;  4FLJ A;  2GU6 A;  3FMQ A;  4B28 A;  4FLK A;  1JAW A;  4RZZ A;  5D6F A;  2GU7 A;  1YW7 A;  4FO7 A;  1XGN A;  4IKS A;  1W7V A;  2BB7 A;  2GG2 A;  2G6P A;  1QXW A;  4ZWP A;  4U1B A;  4QR8 A;  4OOK A;  2P9A A;  2Q92 A;  2DFI A;  4IKR A;  2EA4 A;  1QXY A;  5E5B A;  4ZWO A;  1WBQ A;  3CB5 A;  2HOW A;  3PKE A;  2GGC A;  1R5G A;  4FLI A;  3BIT A;  2BHC A;  4IKT A;  2ADU A;  4U6Z A;  2BWV A;  2Q8K A;  4PNC A;  2GZ5 A;  1XGM A;  2GG0 A;  4S01 A;  4U71 A;  2B3K A;  1WKM A;  1MAT A;  2BWY A;  1XNZ A;  1QZY A;  2V6C A;  2BWX A;  4IF7 A;  4IU6 A;  4U75 A;  3FMR A;  2OKN A;  2BN7 A;  1W2M A;  2EVM A;  3BIQ A;  4U69 A;  1QXZ A;  1BN5 A;  5FCH A;  1C27 A;  4A6V A;  2MAT A;  1C21 A;  4FKC A;  4FUK A;  3CB6 A;  4FLL A;  2Q95 A;  3IU8 A;  2GG8 A;  2GU5 A;  2IW2 A;  1XGO A;  2V3X A;  3MX6 A;  2GA2 A;  4ZWU A;  4S2T P;  2BHB A;  3PKA A;  3L7G A;  3S6B A;  5CDV A;  4ZNG A;  3L24 A;  4Z7M A;  4MAT A;  3IU9 A;  1KP0 A;  2B3H A;  2EVC A;  4S2R P;  5CDE A;  3PKB A;  3D27 A;  2Q96 A;  4U73 A;  5CDL A;  4IDY A;  4EGE A;  1KQ9 A;  1CHM A;  1O0X A;  4U76 A;  4U6E A;  2OAZ A;  1BOA A;  1WLR A;  5JHU A;  2NQ7 A;  5JI6 A;  2ZSG A;  1WL9 A;  3TB5 A;  2GG3 A;  5CLS A;  1B59 A;  1YVM A;  4IPA A;  1YW9 A;  1M35 A;  5CIK A;  4RGZ 1;  2BWU A;  1WN1 A;  2BWS A;  2Q93 A;  1B6A A;  5JFR A;  1R5H A;  2GG7 A;  2V3Y A;  3FM3 A;  2EA2 A;  4FO8 A;  4HXX A;  1YW8 A;  5FCF A;  2Q94 A;  4IEC A;  5CE6 A;  3RVA A;  1A16 A;  3PKC A;  3CTZ A;  3BIP A;  3ROR A;  1C23 A;  1Y1N A;  2P98 A;  5D6E A;  2GTX A;  4U6C A;  1KQ0 A;  4A6W A;  1N51 A;  4JUQ A;  1WY2 A;  1R58 A;  2GG5 A;  2NQ6 A;  3IG4 A;  3MAT A;  3MR1 A;  4PV4 A;  4U70 A;  4U6W A;  2GU4 A;  3Q6D A;  4IKU A;  2BWW A;  2GG9 A; 
#chains in the Genus database with same CATH topology
 1C24 A;  2EVO A;  2BHA A;  3PKD A;  4R60 A;  4KM3 A;  2V3Z A;  1C22 A;  2BHD A;  5CNX A;  2P99 A;  1XGS A;  4S00 A;  3TAV A;  3IU7 A;  1YJ3 A;  4RZY A;  2BH3 A;  4U6J A;  2BWT A;  1PV9 A;  1WL6 A;  2B3L A;  2GGB A;  4FLJ A;  2GU6 A;  3FMQ A;  4B28 A;  4FLK A;  1JAW A;  4RZZ A;  5D6F A;  2GU7 A;  1YW7 A;  4FO7 A;  1XGN A;  4IKS A;  1W7V A;  2BB7 A;  2GG2 A;  2G6P A;  1QXW A;  4ZWP A;  4U1B A;  4QR8 A;  4OOK A;  2P9A A;  2Q92 A;  2DFI A;  4IKR A;  2EA4 A;  1QXY A;  5E5B A;  4ZWO A;  1WBQ A;  3CB5 A;  2HOW A;  3PKE A;  2GGC A;  1R5G A;  4FLI A;  3BIT A;  2BHC A;  4IKT A;  2ADU A;  4U6Z A;  2BWV A;  2Q8K A;  4PNC A;  2GZ5 A;  1XGM A;  2GG0 A;  4S01 A;  4U71 A;  2B3K A;  1WKM A;  1MAT A;  2BWY A;  1XNZ A;  1QZY A;  2V6C A;  2BWX A;  4IF7 A;  4IU6 A;  4U75 A;  3FMR A;  2OKN A;  2BN7 A;  1W2M A;  2EVM A;  3BIQ A;  4U69 A;  1QXZ A;  1BN5 A;  5FCH A;  1C27 A;  4A6V A;  2MAT A;  1C21 A;  4FKC A;  4FUK A;  3CB6 A;  4FLL A;  2Q95 A;  3IU8 A;  2GG8 A;  2GU5 A;  2IW2 A;  1XGO A;  2V3X A;  3MX6 A;  2GA2 A;  4ZWU A;  4S2T P;  2BHB A;  3PKA A;  3L7G A;  3S6B A;  5CDV A;  4ZNG A;  3L24 A;  4Z7M A;  4MAT A;  3IU9 A;  1KP0 A;  2B3H A;  2EVC A;  4S2R P;  5CDE A;  3PKB A;  3D27 A;  2Q96 A;  4U73 A;  5CDL A;  4IDY A;  4EGE A;  1KQ9 A;  1CHM A;  1O0X A;  4U76 A;  4U6E A;  2OAZ A;  1BOA A;  1WLR A;  5JHU A;  2NQ7 A;  5JI6 A;  2ZSG A;  1WL9 A;  3TB5 A;  2GG3 A;  5CLS A;  1B59 A;  1YVM A;  4IPA A;  1YW9 A;  1M35 A;  5CIK A;  4RGZ 1;  2BWU A;  1WN1 A;  2BWS A;  2Q93 A;  1B6A A;  5JFR A;  1R5H A;  2GG7 A;  2V3Y A;  3FM3 A;  2EA2 A;  4FO8 A;  4HXX A;  1YW8 A;  5FCF A;  2Q94 A;  4IEC A;  5CE6 A;  3RVA A;  1A16 A;  3PKC A;  3CTZ A;  3BIP A;  3ROR A;  1C23 A;  1Y1N A;  2P98 A;  5D6E A;  2GTX A;  4U6C A;  1KQ0 A;  4A6W A;  1N51 A;  4JUQ A;  1WY2 A;  1R58 A;  2GG5 A;  2NQ6 A;  3IG4 A;  3MAT A;  3MR1 A;  4PV4 A;  4U70 A;  4U6W A;  2GU4 A;  3Q6D A;  4IKU A;  2BWW A;  2GG9 A; 
#chains in the Genus database with same CATH homology
 1C24 A;  2EVO A;  2BHA A;  3PKD A;  4R60 A;  4KM3 A;  2V3Z A;  1C22 A;  2BHD A;  5CNX A;  2P99 A;  1XGS A;  4S00 A;  3TAV A;  3IU7 A;  1YJ3 A;  4RZY A;  2BH3 A;  4U6J A;  2BWT A;  1PV9 A;  1WL6 A;  2B3L A;  2GGB A;  4FLJ A;  2GU6 A;  3FMQ A;  4B28 A;  4FLK A;  1JAW A;  4RZZ A;  5D6F A;  2GU7 A;  1YW7 A;  4FO7 A;  1XGN A;  4IKS A;  1W7V A;  2BB7 A;  2GG2 A;  2G6P A;  1QXW A;  4ZWP A;  4U1B A;  4QR8 A;  4OOK A;  2P9A A;  2Q92 A;  2DFI A;  4IKR A;  2EA4 A;  1QXY A;  5E5B A;  4ZWO A;  1WBQ A;  3CB5 A;  2HOW A;  3PKE A;  2GGC A;  1R5G A;  4FLI A;  3BIT A;  2BHC A;  4IKT A;  2ADU A;  4U6Z A;  2BWV A;  2Q8K A;  4PNC A;  2GZ5 A;  1XGM A;  2GG0 A;  4S01 A;  4U71 A;  2B3K A;  1WKM A;  1MAT A;  2BWY A;  1XNZ A;  1QZY A;  2V6C A;  2BWX A;  4IF7 A;  4IU6 A;  4U75 A;  3FMR A;  2OKN A;  2BN7 A;  1W2M A;  2EVM A;  3BIQ A;  4U69 A;  1QXZ A;  1BN5 A;  5FCH A;  1C27 A;  4A6V A;  2MAT A;  1C21 A;  4FKC A;  4FUK A;  3CB6 A;  4FLL A;  2Q95 A;  3IU8 A;  2GG8 A;  2GU5 A;  2IW2 A;  1XGO A;  2V3X A;  3MX6 A;  2GA2 A;  4ZWU A;  4S2T P;  2BHB A;  3PKA A;  3L7G A;  3S6B A;  5CDV A;  4ZNG A;  3L24 A;  4Z7M A;  4MAT A;  3IU9 A;  1KP0 A;  2B3H A;  2EVC A;  4S2R P;  5CDE A;  3PKB A;  3D27 A;  2Q96 A;  4U73 A;  5CDL A;  4IDY A;  4EGE A;  1KQ9 A;  1CHM A;  1O0X A;  4U76 A;  4U6E A;  2OAZ A;  1BOA A;  1WLR A;  5JHU A;  2NQ7 A;  5JI6 A;  2ZSG A;  1WL9 A;  3TB5 A;  2GG3 A;  5CLS A;  1B59 A;  1YVM A;  4IPA A;  1YW9 A;  1M35 A;  5CIK A;  4RGZ 1;  2BWU A;  1WN1 A;  2BWS A;  2Q93 A;  1B6A A;  5JFR A;  1R5H A;  2GG7 A;  2V3Y A;  3FM3 A;  2EA2 A;  4FO8 A;  4HXX A;  1YW8 A;  5FCF A;  2Q94 A;  4IEC A;  5CE6 A;  3RVA A;  1A16 A;  3PKC A;  3CTZ A;  3BIP A;  3ROR A;  1C23 A;  1Y1N A;  2P98 A;  5D6E A;  2GTX A;  4U6C A;  1KQ0 A;  4A6W A;  1N51 A;  4JUQ A;  1WY2 A;  1R58 A;  2GG5 A;  2NQ6 A;  3IG4 A;  3MAT A;  3MR1 A;  4PV4 A;  4U70 A;  4U6W A;  2GU4 A;  3Q6D A;  4IKU A;  2BWW A;  2GG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...