4U70A

Hsmetap (f309m) in complex with (1-amino-2-cyclohexylethyl)phosphonic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u70A00
1WBQA 3RORA 1YVMA 2G6PA 4U6EA 4ZWOA 2GTXA 2BHBA 2V3ZA 4U6ZA 3L7GA 2Q96A 5CDLA 1YW9A 4U69A 2ADUA 1WL6A 4FLLA 1C23A 2GU5A 3BIQA 5CDVA 4U6WA 4FLIA 4IPAA 2Q94A 1QXZA 5E5BA 5CNXA 1WY2A 3TAVA 4S2RP 4IKSA 1R5GA 1WKMA 2GU4A 1JAWA 1M35A 2BWWA 2B3HA 3CB6A 3PKBA 2BHCA 1QZYA 4RZZA 2GG5A 1BOAA 4S01A 2NQ7A 3L24A 2Q93A 1W2MA 2B3KA 2GGBA 4MATA 4ZNGA 5FCHA 4OOKA 2BWYA 4U70A 4S00A 1XNZA 3PKDA 4IU6A 4KM3A 2BWUA 1B6AA 1QXWA 3D27A 2GU7A 4B28A 1C27A 3BIPA 2GG3A 3MR1A 4EGEA 3IG4A 2BWXA 3FMQA 1MATA 4FKCA 4IF7A 4HXXA 2BWVA 4JUQA 1YW7A 2BH3A 4FLJA 1KP0A 5CLSA 5D6EA 4ZWPA 1C21A 2V6CA 3TB5A 1A16A 5CDEA 1C24A 2ZSGA 5JFRA 4IKRA 2HOWA 1R58A 4U6CA 1PV9A 2EVOA 3S6BA 2BB7A 2BWSA 4U73A 2NQ6A 4FO8A 2EA4A 2Q95A 4U75A 3CB5A 3IU8A 1B59A 1CHMA 1KQ0A 2GU6A 1WN1A 2IW2A 4PV4A 4A6VA 2OAZA 2V3XA 2B3LA 2GG2A 3FM3A 2GA2A 2V3YA 1C22A 4A6WA 5JI6A 1YW8A 4IECA 2Q8KA 4IDYA 3PKAA 1XGSA 1XGNA 2GG0A 4S2TP 3MATA 4U1BA 1KQ9A 4FUKA 4RGZ1 2EVMA 2P9AA 1QXYA 2GG9A 2EVCA 5FCFA 3BITA 4Z7MA 3MX6A 3RVAA 1R5HA 2OKNA 2Q92A 4FO7A 1XGMA 2P98A 3CTZA 3FMRA 2BN7A 4U71A 2GZ5A 4FLKA 1WLRA 1WL9A 2GG8A 4IKTA 4RZYA 1BN5A 4IKUA 5JHUA 4QR8A 1XGOA 3PKCA 1YJ3A 2P99A 2MATA 1Y1NA 4PNCA 2EA2A 5D6FA 1W7VA 5CE6A 1O0XA 2GG7A 3IU9A 3IU7A 2DFIA 5CIKA 4ZWUA 4R60A 2BHAA 3PKEA 2BHDA 2BWTA 4U6JA 1N51A 3Q6DA 4U76A 2GGCA
chains in the Genus database with same CATH superfamily
1WBQA 3RORA 1YVMA 2G6PA 4U6EA 4ZWOA 2GTXA 2BHBA 2V3ZA 4U6ZA 3L7GA 2Q96A 5CDLA 1YW9A 4U69A 2ADUA 1WL6A 4FLLA 1C23A 2GU5A 3BIQA 5CDVA 4U6WA 4FLIA 4IPAA 2Q94A 1QXZA 5E5BA 5CNXA 1WY2A 3TAVA 4S2RP 4IKSA 1R5GA 1WKMA 2GU4A 1JAWA 1M35A 2BWWA 2B3HA 3CB6A 3PKBA 2BHCA 1QZYA 4RZZA 2GG5A 1BOAA 4S01A 2NQ7A 3L24A 2Q93A 1W2MA 2B3KA 2GGBA 4MATA 4ZNGA 5FCHA 4OOKA 2BWYA 4U70A 4S00A 1XNZA 3PKDA 4IU6A 4KM3A 2BWUA 1B6AA 1QXWA 3D27A 2GU7A 4B28A 1C27A 3BIPA 2GG3A 3MR1A 4EGEA 3IG4A 2BWXA 3FMQA 1MATA 4FKCA 4IF7A 4HXXA 2BWVA 4JUQA 1YW7A 2BH3A 4FLJA 1KP0A 5CLSA 5D6EA 4ZWPA 1C21A 2V6CA 3TB5A 1A16A 5CDEA 1C24A 2ZSGA 5JFRA 4IKRA 2HOWA 1R58A 4U6CA 1PV9A 2EVOA 3S6BA 2BB7A 2BWSA 4U73A 2NQ6A 4FO8A 2EA4A 2Q95A 4U75A 3CB5A 3IU8A 1B59A 1CHMA 1KQ0A 2GU6A 1WN1A 2IW2A 4PV4A 4A6VA 2OAZA 2V3XA 2B3LA 2GG2A 3FM3A 2GA2A 2V3YA 1C22A 4A6WA 5JI6A 1YW8A 4IECA 2Q8KA 4IDYA 3PKAA 1XGSA 1XGNA 2GG0A 4S2TP 3MATA 4U1BA 1KQ9A 4FUKA 4RGZ1 2EVMA 2P9AA 1QXYA 2GG9A 2EVCA 5FCFA 3BITA 4Z7MA 3MX6A 3RVAA 1R5HA 2OKNA 2Q92A 4FO7A 1XGMA 2P98A 3CTZA 3FMRA 2BN7A 4U71A 2GZ5A 4FLKA 1WLRA 1WL9A 2GG8A 4IKTA 4RZYA 1BN5A 4IKUA 5JHUA 4QR8A 1XGOA 3PKCA 1YJ3A 2P99A 2MATA 1Y1NA 4PNCA 2EA2A 5D6FA 1W7VA 5CE6A 1O0XA 2GG7A 3IU9A 3IU7A 2DFIA 5CIKA 4ZWUA 4R60A 2BHAA 3PKEA 2BHDA 2BWTA 4U6JA 1N51A 3Q6DA 4U76A 2GGCA
chains in the Genus database with same CATH topology
1WBQA 3RORA 1YVMA 2G6PA 4U6EA 4ZWOA 2GTXA 2BHBA 2V3ZA 4U6ZA 3L7GA 2Q96A 5CDLA 1YW9A 4U69A 2ADUA 1WL6A 4FLLA 1C23A 2GU5A 3BIQA 5CDVA 4U6WA 4FLIA 4IPAA 2Q94A 1QXZA 5E5BA 5CNXA 1WY2A 3TAVA 4S2RP 4IKSA 1R5GA 1WKMA 2GU4A 1JAWA 1M35A 2BWWA 2B3HA 3CB6A 3PKBA 2BHCA 1QZYA 4RZZA 2GG5A 1BOAA 4S01A 2NQ7A 3L24A 2Q93A 1W2MA 2B3KA 2GGBA 4MATA 4ZNGA 5FCHA 4OOKA 2BWYA 4U70A 4S00A 1XNZA 3PKDA 4IU6A 4KM3A 2BWUA 1B6AA 1QXWA 3D27A 2GU7A 4B28A 1C27A 3BIPA 2GG3A 3MR1A 4EGEA 3IG4A 2BWXA 3FMQA 1MATA 4FKCA 4IF7A 4HXXA 2BWVA 4JUQA 1YW7A 2BH3A 4FLJA 1KP0A 5CLSA 5D6EA 4ZWPA 1C21A 2V6CA 3TB5A 1A16A 5CDEA 1C24A 2ZSGA 5JFRA 4IKRA 2HOWA 1R58A 4U6CA 1PV9A 2EVOA 3S6BA 2BB7A 2BWSA 4U73A 2NQ6A 4FO8A 2EA4A 2Q95A 4U75A 3CB5A 3IU8A 1B59A 1CHMA 1KQ0A 2GU6A 1WN1A 2IW2A 4PV4A 4A6VA 2OAZA 2V3XA 2B3LA 2GG2A 3FM3A 2GA2A 2V3YA 1C22A 4A6WA 5JI6A 1YW8A 4IECA 2Q8KA 4IDYA 3PKAA 1XGSA 1XGNA 2GG0A 4S2TP 3MATA 4U1BA 1KQ9A 4FUKA 4RGZ1 2EVMA 2P9AA 1QXYA 2GG9A 2EVCA 5FCFA 3BITA 4Z7MA 3MX6A 3RVAA 1R5HA 2OKNA 2Q92A 4FO7A 1XGMA 2P98A 3CTZA 3FMRA 2BN7A 4U71A 2GZ5A 4FLKA 1WLRA 1WL9A 2GG8A 4IKTA 4RZYA 1BN5A 4IKUA 5JHUA 4QR8A 1XGOA 3PKCA 1YJ3A 2P99A 2MATA 1Y1NA 4PNCA 2EA2A 5D6FA 1W7VA 5CE6A 1O0XA 2GG7A 3IU9A 3IU7A 2DFIA 5CIKA 4ZWUA 4R60A 2BHAA 3PKEA 2BHDA 2BWTA 4U6JA 1N51A 3Q6DA 4U76A 2GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WBQ A;  3ROR A;  1YVM A;  2G6P A;  4U6E A;  4ZWO A;  2GTX A;  2BHB A;  2V3Z A;  4U6Z A;  3L7G A;  2Q96 A;  5CDL A;  1YW9 A;  4U69 A;  2ADU A;  1WL6 A;  4FLL A;  1C23 A;  2GU5 A;  3BIQ A;  5CDV A;  4U6W A;  4FLI A;  4IPA A;  2Q94 A;  1QXZ A;  5E5B A;  5CNX A;  1WY2 A;  3TAV A;  4S2R P;  4IKS A;  1R5G A;  1WKM A;  2GU4 A;  1JAW A;  1M35 A;  2BWW A;  2B3H A;  3CB6 A;  3PKB A;  2BHC A;  1QZY A;  4RZZ A;  2GG5 A;  1BOA A;  4S01 A;  2NQ7 A;  3L24 A;  2Q93 A;  1W2M A;  2B3K A;  2GGB A;  4MAT A;  4ZNG A;  5FCH A;  4OOK A;  2BWY A;  4U70 A;  4S00 A;  1XNZ A;  3PKD A;  4IU6 A;  4KM3 A;  2BWU A;  1B6A A;  1QXW A;  3D27 A;  2GU7 A;  4B28 A;  1C27 A;  3BIP A;  2GG3 A;  3MR1 A;  4EGE A;  3IG4 A;  2BWX A;  3FMQ A;  1MAT A;  4FKC A;  4IF7 A;  4HXX A;  2BWV A;  4JUQ A;  1YW7 A;  2BH3 A;  4FLJ A;  1KP0 A;  5CLS A;  5D6E A;  4ZWP A;  1C21 A;  2V6C A;  3TB5 A;  1A16 A;  5CDE A;  1C24 A;  2ZSG A;  5JFR A;  4IKR A;  2HOW A;  1R58 A;  4U6C A;  1PV9 A;  2EVO A;  3S6B A;  2BB7 A;  2BWS A;  4U73 A;  2NQ6 A;  4FO8 A;  2EA4 A;  2Q95 A;  4U75 A;  3CB5 A;  3IU8 A;  1B59 A;  1CHM A;  1KQ0 A;  2GU6 A;  1WN1 A;  2IW2 A;  4PV4 A;  4A6V A;  2OAZ A;  2V3X A;  2B3L A;  2GG2 A;  3FM3 A;  2GA2 A;  2V3Y A;  1C22 A;  4A6W A;  5JI6 A;  1YW8 A;  4IEC A;  2Q8K A;  4IDY A;  3PKA A;  1XGS A;  1XGN A;  2GG0 A;  4S2T P;  3MAT A;  4U1B A;  1KQ9 A;  4FUK A;  4RGZ 1;  2EVM A;  2P9A A;  1QXY A;  2GG9 A;  2EVC A;  5FCF A;  3BIT A;  4Z7M A;  3MX6 A;  3RVA A;  1R5H A;  2OKN A;  2Q92 A;  4FO7 A;  1XGM A;  2P98 A;  3CTZ A;  3FMR A;  2BN7 A;  4U71 A;  2GZ5 A;  4FLK A;  1WLR A;  1WL9 A;  2GG8 A;  4IKT A;  4RZY A;  1BN5 A;  4IKU A;  5JHU A;  4QR8 A;  1XGO A;  3PKC A;  1YJ3 A;  2P99 A;  2MAT A;  1Y1N A;  4PNC A;  2EA2 A;  5D6F A;  1W7V A;  5CE6 A;  1O0X A;  2GG7 A;  3IU9 A;  3IU7 A;  2DFI A;  5CIK A;  4ZWU A;  4R60 A;  2BHA A;  3PKE A;  2BHD A;  2BWT A;  4U6J A;  1N51 A;  3Q6D A;  4U76 A;  2GGC A; 
#chains in the Genus database with same CATH topology
 1WBQ A;  3ROR A;  1YVM A;  2G6P A;  4U6E A;  4ZWO A;  2GTX A;  2BHB A;  2V3Z A;  4U6Z A;  3L7G A;  2Q96 A;  5CDL A;  1YW9 A;  4U69 A;  2ADU A;  1WL6 A;  4FLL A;  1C23 A;  2GU5 A;  3BIQ A;  5CDV A;  4U6W A;  4FLI A;  4IPA A;  2Q94 A;  1QXZ A;  5E5B A;  5CNX A;  1WY2 A;  3TAV A;  4S2R P;  4IKS A;  1R5G A;  1WKM A;  2GU4 A;  1JAW A;  1M35 A;  2BWW A;  2B3H A;  3CB6 A;  3PKB A;  2BHC A;  1QZY A;  4RZZ A;  2GG5 A;  1BOA A;  4S01 A;  2NQ7 A;  3L24 A;  2Q93 A;  1W2M A;  2B3K A;  2GGB A;  4MAT A;  4ZNG A;  5FCH A;  4OOK A;  2BWY A;  4U70 A;  4S00 A;  1XNZ A;  3PKD A;  4IU6 A;  4KM3 A;  2BWU A;  1B6A A;  1QXW A;  3D27 A;  2GU7 A;  4B28 A;  1C27 A;  3BIP A;  2GG3 A;  3MR1 A;  4EGE A;  3IG4 A;  2BWX A;  3FMQ A;  1MAT A;  4FKC A;  4IF7 A;  4HXX A;  2BWV A;  4JUQ A;  1YW7 A;  2BH3 A;  4FLJ A;  1KP0 A;  5CLS A;  5D6E A;  4ZWP A;  1C21 A;  2V6C A;  3TB5 A;  1A16 A;  5CDE A;  1C24 A;  2ZSG A;  5JFR A;  4IKR A;  2HOW A;  1R58 A;  4U6C A;  1PV9 A;  2EVO A;  3S6B A;  2BB7 A;  2BWS A;  4U73 A;  2NQ6 A;  4FO8 A;  2EA4 A;  2Q95 A;  4U75 A;  3CB5 A;  3IU8 A;  1B59 A;  1CHM A;  1KQ0 A;  2GU6 A;  1WN1 A;  2IW2 A;  4PV4 A;  4A6V A;  2OAZ A;  2V3X A;  2B3L A;  2GG2 A;  3FM3 A;  2GA2 A;  2V3Y A;  1C22 A;  4A6W A;  5JI6 A;  1YW8 A;  4IEC A;  2Q8K A;  4IDY A;  3PKA A;  1XGS A;  1XGN A;  2GG0 A;  4S2T P;  3MAT A;  4U1B A;  1KQ9 A;  4FUK A;  4RGZ 1;  2EVM A;  2P9A A;  1QXY A;  2GG9 A;  2EVC A;  5FCF A;  3BIT A;  4Z7M A;  3MX6 A;  3RVA A;  1R5H A;  2OKN A;  2Q92 A;  4FO7 A;  1XGM A;  2P98 A;  3CTZ A;  3FMR A;  2BN7 A;  4U71 A;  2GZ5 A;  4FLK A;  1WLR A;  1WL9 A;  2GG8 A;  4IKT A;  4RZY A;  1BN5 A;  4IKU A;  5JHU A;  4QR8 A;  1XGO A;  3PKC A;  1YJ3 A;  2P99 A;  2MAT A;  1Y1N A;  4PNC A;  2EA2 A;  5D6F A;  1W7V A;  5CE6 A;  1O0X A;  2GG7 A;  3IU9 A;  3IU7 A;  2DFI A;  5CIK A;  4ZWU A;  4R60 A;  2BHA A;  3PKE A;  2BHD A;  2BWT A;  4U6J A;  1N51 A;  3Q6D A;  4U76 A;  2GGC A; 
#chains in the Genus database with same CATH homology
 1WBQ A;  3ROR A;  1YVM A;  2G6P A;  4U6E A;  4ZWO A;  2GTX A;  2BHB A;  2V3Z A;  4U6Z A;  3L7G A;  2Q96 A;  5CDL A;  1YW9 A;  4U69 A;  2ADU A;  1WL6 A;  4FLL A;  1C23 A;  2GU5 A;  3BIQ A;  5CDV A;  4U6W A;  4FLI A;  4IPA A;  2Q94 A;  1QXZ A;  5E5B A;  5CNX A;  1WY2 A;  3TAV A;  4S2R P;  4IKS A;  1R5G A;  1WKM A;  2GU4 A;  1JAW A;  1M35 A;  2BWW A;  2B3H A;  3CB6 A;  3PKB A;  2BHC A;  1QZY A;  4RZZ A;  2GG5 A;  1BOA A;  4S01 A;  2NQ7 A;  3L24 A;  2Q93 A;  1W2M A;  2B3K A;  2GGB A;  4MAT A;  4ZNG A;  5FCH A;  4OOK A;  2BWY A;  4U70 A;  4S00 A;  1XNZ A;  3PKD A;  4IU6 A;  4KM3 A;  2BWU A;  1B6A A;  1QXW A;  3D27 A;  2GU7 A;  4B28 A;  1C27 A;  3BIP A;  2GG3 A;  3MR1 A;  4EGE A;  3IG4 A;  2BWX A;  3FMQ A;  1MAT A;  4FKC A;  4IF7 A;  4HXX A;  2BWV A;  4JUQ A;  1YW7 A;  2BH3 A;  4FLJ A;  1KP0 A;  5CLS A;  5D6E A;  4ZWP A;  1C21 A;  2V6C A;  3TB5 A;  1A16 A;  5CDE A;  1C24 A;  2ZSG A;  5JFR A;  4IKR A;  2HOW A;  1R58 A;  4U6C A;  1PV9 A;  2EVO A;  3S6B A;  2BB7 A;  2BWS A;  4U73 A;  2NQ6 A;  4FO8 A;  2EA4 A;  2Q95 A;  4U75 A;  3CB5 A;  3IU8 A;  1B59 A;  1CHM A;  1KQ0 A;  2GU6 A;  1WN1 A;  2IW2 A;  4PV4 A;  4A6V A;  2OAZ A;  2V3X A;  2B3L A;  2GG2 A;  3FM3 A;  2GA2 A;  2V3Y A;  1C22 A;  4A6W A;  5JI6 A;  1YW8 A;  4IEC A;  2Q8K A;  4IDY A;  3PKA A;  1XGS A;  1XGN A;  2GG0 A;  4S2T P;  3MAT A;  4U1B A;  1KQ9 A;  4FUK A;  4RGZ 1;  2EVM A;  2P9A A;  1QXY A;  2GG9 A;  2EVC A;  5FCF A;  3BIT A;  4Z7M A;  3MX6 A;  3RVA A;  1R5H A;  2OKN A;  2Q92 A;  4FO7 A;  1XGM A;  2P98 A;  3CTZ A;  3FMR A;  2BN7 A;  4U71 A;  2GZ5 A;  4FLK A;  1WLR A;  1WL9 A;  2GG8 A;  4IKT A;  4RZY A;  1BN5 A;  4IKU A;  5JHU A;  4QR8 A;  1XGO A;  3PKC A;  1YJ3 A;  2P99 A;  2MAT A;  1Y1N A;  4PNC A;  2EA2 A;  5D6F A;  1W7V A;  5CE6 A;  1O0X A;  2GG7 A;  3IU9 A;  3IU7 A;  2DFI A;  5CIK A;  4ZWU A;  4R60 A;  2BHA A;  3PKE A;  2BHD A;  2BWT A;  4U6J A;  1N51 A;  3Q6D A;  4U76 A;  2GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...