3S6BA

Crystal structure of methionine aminopeptidase 1b from plasmodium falciparum, pf10_0150
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
345
structure length
345
Chain Sequence
HLKTIVKKHLSPENFDPTNRKYWVYDDHLKNFVNFKFTGDVRPWPLSKINHVPSHIERPDYAISSIPESELIYKRKSDIYVNNEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAYPSTLNYYKFPKSCCTSVNEIVCHGIPDYRPLKSGDIINIDISVFYKGVHSDLNETYFVGDINDVPKEGKELVETCYFSLMEAIKKCKPGMFYKNIGTLIDAYVSKKNFSVVRSYSGHGVGKLFHSNPTVPHFKKNKAVGIMKPGHVFTIEPMINQGHYSDVLWPDQWTSATSDGKLSAQFEHTLLITNNGVEILTKRTQDSPPLGFDTKDELYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methionine aminopeptidase 1b from Plasmodium Falciparum, PF10_0150
rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 109
structure length 345
sequence length 345
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3s6bA01
1C21A 2GU4A 4ZWPA 4FLKA 4OOKA 4R60A 3CB6A 1C24A 3BIPA 2BHDA 2GGCA 4RZZA 1KQ9A 1XGSA 4Z7MA 2BWUA 4PNCA 1W7VA 4ZWOA 2IW2A 2GG5A 2ADUA 4U73A 1C27A 4A6VA 4JUQA 2V3YA 1N51A 5FCHA 1WL6A 1BN5A 4FUKA 3FMRA 3TB5A 2GGBA 3RVAA 2EVCA 1O0XA 4FLLA 2G6PA 3BITA 1YW7A 3PKEA 4IKSA 5CIKA 2GTXA 2BWXA 3TAVA 4U69A 2EVMA 1QXZA 2V3ZA 2P9AA 4HXXA 1KP0A 4IKRA 2OKNA 2P99A 2Q94A 2GG9A 5FCFA 3Q6DA 1YVMA 1QZYA 2BWYA 2EA2A 1R58A 1XNZA 3IU7A 4IECA 1WBQA 2GA2A 5CE6A 1C22A 3PKCA 3MATA 4FLIA 1WN1A 2NQ6A 1B59A 5CDEA 2NQ7A 4RGZ1 2B3KA 2BHCA 4IKUA 3BIQA 3L24A 2BHAA 2EA4A 1WLRA 2BWSA 4U76A 5JHUA 1A16A 3PKDA 1MATA 4A6WA 3IU8A 1YW8A 2BN7A 2GZ5A 2HOWA 5CDLA 2B3LA 4S2RP 2GU5A 3MR1A 2Q95A 2Q92A 5CNXA 1R5GA 2GU6A 4MATA 2Q8KA 3FMQA 2V6CA 4IU6A 5CLSA 2EVOA 1QXWA 3CB5A 4IF7A 4QR8A 3MX6A 2GG8A 4U71A 2BHBA 2B3HA 2BWVA 4FKCA 4U6JA 5JFRA 2GG2A 1JAWA 2DFIA 4ZWUA 1WL9A 1BOAA 3FM3A 4U6WA 2BWTA 1KQ0A 1WKMA 2P98A 2GG3A 1YJ3A 1WY2A 1B6AA 3S6BA 2OAZA 4PV4A 1XGNA 1XGOA 1YW9A 1PV9A 2Q93A 1M35A 3L7GA 3PKAA 1W2MA 4FO7A 4U6CA 5CDVA 3IU9A 5D6FA 1CHMA 4U6ZA 2GU7A 3PKBA 1XGMA 1R5HA 4IDYA 3IG4A 2GG0A 4IKTA 3D27A 2Q96A 4IPAA 2V3XA 4RZYA 2GG7A 2ZSGA 4ZNGA 1QXYA 4EGEA 4U6EA 5D6EA 2BWWA 5E5BA 5JI6A 4FO8A 1C23A 4U75A 2BB7A 4S2TP 4B28A 4S01A 2MATA 4KM3A 4S00A 1Y1NA 2BH3A 4U1BA 3CTZA 3RORA 4FLJA 4U70A
chains in the Genus database with same CATH superfamily
1C21A 2GU4A 4ZWPA 4FLKA 4OOKA 4R60A 3CB6A 1C24A 3BIPA 2BHDA 2GGCA 4RZZA 1KQ9A 1XGSA 4Z7MA 2BWUA 4PNCA 1W7VA 4ZWOA 2IW2A 2GG5A 2ADUA 4U73A 1C27A 4A6VA 4JUQA 2V3YA 1N51A 5FCHA 1WL6A 1BN5A 4FUKA 3FMRA 3TB5A 2GGBA 3RVAA 2EVCA 1O0XA 4FLLA 2G6PA 3BITA 1YW7A 3PKEA 4IKSA 5CIKA 2GTXA 2BWXA 3TAVA 4U69A 2EVMA 1QXZA 2V3ZA 2P9AA 4HXXA 1KP0A 4IKRA 2OKNA 2P99A 2Q94A 2GG9A 5FCFA 3Q6DA 1YVMA 1QZYA 2BWYA 2EA2A 1R58A 1XNZA 3IU7A 4IECA 1WBQA 2GA2A 5CE6A 1C22A 3PKCA 3MATA 4FLIA 1WN1A 2NQ6A 1B59A 5CDEA 2NQ7A 4RGZ1 2B3KA 2BHCA 4IKUA 3BIQA 3L24A 2BHAA 2EA4A 1WLRA 2BWSA 4U76A 5JHUA 1A16A 3PKDA 1MATA 4A6WA 3IU8A 1YW8A 2BN7A 2GZ5A 2HOWA 5CDLA 2B3LA 4S2RP 2GU5A 3MR1A 2Q95A 2Q92A 5CNXA 1R5GA 2GU6A 4MATA 2Q8KA 3FMQA 2V6CA 4IU6A 5CLSA 2EVOA 1QXWA 3CB5A 4IF7A 4QR8A 3MX6A 2GG8A 4U71A 2BHBA 2B3HA 2BWVA 4FKCA 4U6JA 5JFRA 2GG2A 1JAWA 2DFIA 4ZWUA 1WL9A 1BOAA 3FM3A 4U6WA 2BWTA 1KQ0A 1WKMA 2P98A 2GG3A 1YJ3A 1WY2A 1B6AA 3S6BA 2OAZA 4PV4A 1XGNA 1XGOA 1YW9A 1PV9A 2Q93A 1M35A 3L7GA 3PKAA 1W2MA 4FO7A 4U6CA 5CDVA 3IU9A 5D6FA 1CHMA 4U6ZA 2GU7A 3PKBA 1XGMA 1R5HA 4IDYA 3IG4A 2GG0A 4IKTA 3D27A 2Q96A 4IPAA 2V3XA 4RZYA 2GG7A 2ZSGA 4ZNGA 1QXYA 4EGEA 4U6EA 5D6EA 2BWWA 5E5BA 5JI6A 4FO8A 1C23A 4U75A 2BB7A 4S2TP 4B28A 4S01A 2MATA 4KM3A 4S00A 1Y1NA 2BH3A 4U1BA 3CTZA 3RORA 4FLJA 4U70A
chains in the Genus database with same CATH topology
1C21A 2GU4A 4ZWPA 4FLKA 4OOKA 4R60A 3CB6A 1C24A 3BIPA 2BHDA 2GGCA 4RZZA 1KQ9A 1XGSA 4Z7MA 2BWUA 4PNCA 1W7VA 4ZWOA 2IW2A 2GG5A 2ADUA 4U73A 1C27A 4A6VA 4JUQA 2V3YA 1N51A 5FCHA 1WL6A 1BN5A 4FUKA 3FMRA 3TB5A 2GGBA 3RVAA 2EVCA 1O0XA 4FLLA 2G6PA 3BITA 1YW7A 3PKEA 4IKSA 5CIKA 2GTXA 2BWXA 3TAVA 4U69A 2EVMA 1QXZA 2V3ZA 2P9AA 4HXXA 1KP0A 4IKRA 2OKNA 2P99A 2Q94A 2GG9A 5FCFA 3Q6DA 1YVMA 1QZYA 2BWYA 2EA2A 1R58A 1XNZA 3IU7A 4IECA 1WBQA 2GA2A 5CE6A 1C22A 3PKCA 3MATA 4FLIA 1WN1A 2NQ6A 1B59A 5CDEA 2NQ7A 4RGZ1 2B3KA 2BHCA 4IKUA 3BIQA 3L24A 2BHAA 2EA4A 1WLRA 2BWSA 4U76A 5JHUA 1A16A 3PKDA 1MATA 4A6WA 3IU8A 1YW8A 2BN7A 2GZ5A 2HOWA 5CDLA 2B3LA 4S2RP 2GU5A 3MR1A 2Q95A 2Q92A 5CNXA 1R5GA 2GU6A 4MATA 2Q8KA 3FMQA 2V6CA 4IU6A 5CLSA 2EVOA 1QXWA 3CB5A 4IF7A 4QR8A 3MX6A 2GG8A 4U71A 2BHBA 2B3HA 2BWVA 4FKCA 4U6JA 5JFRA 2GG2A 1JAWA 2DFIA 4ZWUA 1WL9A 1BOAA 3FM3A 4U6WA 2BWTA 1KQ0A 1WKMA 2P98A 2GG3A 1YJ3A 1WY2A 1B6AA 3S6BA 2OAZA 4PV4A 1XGNA 1XGOA 1YW9A 1PV9A 2Q93A 1M35A 3L7GA 3PKAA 1W2MA 4FO7A 4U6CA 5CDVA 3IU9A 5D6FA 1CHMA 4U6ZA 2GU7A 3PKBA 1XGMA 1R5HA 4IDYA 3IG4A 2GG0A 4IKTA 3D27A 2Q96A 4IPAA 2V3XA 4RZYA 2GG7A 2ZSGA 4ZNGA 1QXYA 4EGEA 4U6EA 5D6EA 2BWWA 5E5BA 5JI6A 4FO8A 1C23A 4U75A 2BB7A 4S2TP 4B28A 4S01A 2MATA 4KM3A 4S00A 1Y1NA 2BH3A 4U1BA 3CTZA 3RORA 4FLJA 4U70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C21 A;  2GU4 A;  4ZWP A;  4FLK A;  4OOK A;  4R60 A;  3CB6 A;  1C24 A;  3BIP A;  2BHD A;  2GGC A;  4RZZ A;  1KQ9 A;  1XGS A;  4Z7M A;  2BWU A;  4PNC A;  1W7V A;  4ZWO A;  2IW2 A;  2GG5 A;  2ADU A;  4U73 A;  1C27 A;  4A6V A;  4JUQ A;  2V3Y A;  1N51 A;  5FCH A;  1WL6 A;  1BN5 A;  4FUK A;  3FMR A;  3TB5 A;  2GGB A;  3RVA A;  2EVC A;  1O0X A;  4FLL A;  2G6P A;  3BIT A;  1YW7 A;  3PKE A;  4IKS A;  5CIK A;  2GTX A;  2BWX A;  3TAV A;  4U69 A;  2EVM A;  1QXZ A;  2V3Z A;  2P9A A;  4HXX A;  1KP0 A;  4IKR A;  2OKN A;  2P99 A;  2Q94 A;  2GG9 A;  5FCF A;  3Q6D A;  1YVM A;  1QZY A;  2BWY A;  2EA2 A;  1R58 A;  1XNZ A;  3IU7 A;  4IEC A;  1WBQ A;  2GA2 A;  5CE6 A;  1C22 A;  3PKC A;  3MAT A;  4FLI A;  1WN1 A;  2NQ6 A;  1B59 A;  5CDE A;  2NQ7 A;  4RGZ 1;  2B3K A;  2BHC A;  4IKU A;  3BIQ A;  3L24 A;  2BHA A;  2EA4 A;  1WLR A;  2BWS A;  4U76 A;  5JHU A;  1A16 A;  3PKD A;  1MAT A;  4A6W A;  3IU8 A;  1YW8 A;  2BN7 A;  2GZ5 A;  2HOW A;  5CDL A;  2B3L A;  4S2R P;  2GU5 A;  3MR1 A;  2Q95 A;  2Q92 A;  5CNX A;  1R5G A;  2GU6 A;  4MAT A;  2Q8K A;  3FMQ A;  2V6C A;  4IU6 A;  5CLS A;  2EVO A;  1QXW A;  3CB5 A;  4IF7 A;  4QR8 A;  3MX6 A;  2GG8 A;  4U71 A;  2BHB A;  2B3H A;  2BWV A;  4FKC A;  4U6J A;  5JFR A;  2GG2 A;  1JAW A;  2DFI A;  4ZWU A;  1WL9 A;  1BOA A;  3FM3 A;  4U6W A;  2BWT A;  1KQ0 A;  1WKM A;  2P98 A;  2GG3 A;  1YJ3 A;  1WY2 A;  1B6A A;  3S6B A;  2OAZ A;  4PV4 A;  1XGN A;  1XGO A;  1YW9 A;  1PV9 A;  2Q93 A;  1M35 A;  3L7G A;  3PKA A;  1W2M A;  4FO7 A;  4U6C A;  5CDV A;  3IU9 A;  5D6F A;  1CHM A;  4U6Z A;  2GU7 A;  3PKB A;  1XGM A;  1R5H A;  4IDY A;  3IG4 A;  2GG0 A;  4IKT A;  3D27 A;  2Q96 A;  4IPA A;  2V3X A;  4RZY A;  2GG7 A;  2ZSG A;  4ZNG A;  1QXY A;  4EGE A;  4U6E A;  5D6E A;  2BWW A;  5E5B A;  5JI6 A;  4FO8 A;  1C23 A;  4U75 A;  2BB7 A;  4S2T P;  4B28 A;  4S01 A;  2MAT A;  4KM3 A;  4S00 A;  1Y1N A;  2BH3 A;  4U1B A;  3CTZ A;  3ROR A;  4FLJ A;  4U70 A; 
#chains in the Genus database with same CATH topology
 1C21 A;  2GU4 A;  4ZWP A;  4FLK A;  4OOK A;  4R60 A;  3CB6 A;  1C24 A;  3BIP A;  2BHD A;  2GGC A;  4RZZ A;  1KQ9 A;  1XGS A;  4Z7M A;  2BWU A;  4PNC A;  1W7V A;  4ZWO A;  2IW2 A;  2GG5 A;  2ADU A;  4U73 A;  1C27 A;  4A6V A;  4JUQ A;  2V3Y A;  1N51 A;  5FCH A;  1WL6 A;  1BN5 A;  4FUK A;  3FMR A;  3TB5 A;  2GGB A;  3RVA A;  2EVC A;  1O0X A;  4FLL A;  2G6P A;  3BIT A;  1YW7 A;  3PKE A;  4IKS A;  5CIK A;  2GTX A;  2BWX A;  3TAV A;  4U69 A;  2EVM A;  1QXZ A;  2V3Z A;  2P9A A;  4HXX A;  1KP0 A;  4IKR A;  2OKN A;  2P99 A;  2Q94 A;  2GG9 A;  5FCF A;  3Q6D A;  1YVM A;  1QZY A;  2BWY A;  2EA2 A;  1R58 A;  1XNZ A;  3IU7 A;  4IEC A;  1WBQ A;  2GA2 A;  5CE6 A;  1C22 A;  3PKC A;  3MAT A;  4FLI A;  1WN1 A;  2NQ6 A;  1B59 A;  5CDE A;  2NQ7 A;  4RGZ 1;  2B3K A;  2BHC A;  4IKU A;  3BIQ A;  3L24 A;  2BHA A;  2EA4 A;  1WLR A;  2BWS A;  4U76 A;  5JHU A;  1A16 A;  3PKD A;  1MAT A;  4A6W A;  3IU8 A;  1YW8 A;  2BN7 A;  2GZ5 A;  2HOW A;  5CDL A;  2B3L A;  4S2R P;  2GU5 A;  3MR1 A;  2Q95 A;  2Q92 A;  5CNX A;  1R5G A;  2GU6 A;  4MAT A;  2Q8K A;  3FMQ A;  2V6C A;  4IU6 A;  5CLS A;  2EVO A;  1QXW A;  3CB5 A;  4IF7 A;  4QR8 A;  3MX6 A;  2GG8 A;  4U71 A;  2BHB A;  2B3H A;  2BWV A;  4FKC A;  4U6J A;  5JFR A;  2GG2 A;  1JAW A;  2DFI A;  4ZWU A;  1WL9 A;  1BOA A;  3FM3 A;  4U6W A;  2BWT A;  1KQ0 A;  1WKM A;  2P98 A;  2GG3 A;  1YJ3 A;  1WY2 A;  1B6A A;  3S6B A;  2OAZ A;  4PV4 A;  1XGN A;  1XGO A;  1YW9 A;  1PV9 A;  2Q93 A;  1M35 A;  3L7G A;  3PKA A;  1W2M A;  4FO7 A;  4U6C A;  5CDV A;  3IU9 A;  5D6F A;  1CHM A;  4U6Z A;  2GU7 A;  3PKB A;  1XGM A;  1R5H A;  4IDY A;  3IG4 A;  2GG0 A;  4IKT A;  3D27 A;  2Q96 A;  4IPA A;  2V3X A;  4RZY A;  2GG7 A;  2ZSG A;  4ZNG A;  1QXY A;  4EGE A;  4U6E A;  5D6E A;  2BWW A;  5E5B A;  5JI6 A;  4FO8 A;  1C23 A;  4U75 A;  2BB7 A;  4S2T P;  4B28 A;  4S01 A;  2MAT A;  4KM3 A;  4S00 A;  1Y1N A;  2BH3 A;  4U1B A;  3CTZ A;  3ROR A;  4FLJ A;  4U70 A; 
#chains in the Genus database with same CATH homology
 1C21 A;  2GU4 A;  4ZWP A;  4FLK A;  4OOK A;  4R60 A;  3CB6 A;  1C24 A;  3BIP A;  2BHD A;  2GGC A;  4RZZ A;  1KQ9 A;  1XGS A;  4Z7M A;  2BWU A;  4PNC A;  1W7V A;  4ZWO A;  2IW2 A;  2GG5 A;  2ADU A;  4U73 A;  1C27 A;  4A6V A;  4JUQ A;  2V3Y A;  1N51 A;  5FCH A;  1WL6 A;  1BN5 A;  4FUK A;  3FMR A;  3TB5 A;  2GGB A;  3RVA A;  2EVC A;  1O0X A;  4FLL A;  2G6P A;  3BIT A;  1YW7 A;  3PKE A;  4IKS A;  5CIK A;  2GTX A;  2BWX A;  3TAV A;  4U69 A;  2EVM A;  1QXZ A;  2V3Z A;  2P9A A;  4HXX A;  1KP0 A;  4IKR A;  2OKN A;  2P99 A;  2Q94 A;  2GG9 A;  5FCF A;  3Q6D A;  1YVM A;  1QZY A;  2BWY A;  2EA2 A;  1R58 A;  1XNZ A;  3IU7 A;  4IEC A;  1WBQ A;  2GA2 A;  5CE6 A;  1C22 A;  3PKC A;  3MAT A;  4FLI A;  1WN1 A;  2NQ6 A;  1B59 A;  5CDE A;  2NQ7 A;  4RGZ 1;  2B3K A;  2BHC A;  4IKU A;  3BIQ A;  3L24 A;  2BHA A;  2EA4 A;  1WLR A;  2BWS A;  4U76 A;  5JHU A;  1A16 A;  3PKD A;  1MAT A;  4A6W A;  3IU8 A;  1YW8 A;  2BN7 A;  2GZ5 A;  2HOW A;  5CDL A;  2B3L A;  4S2R P;  2GU5 A;  3MR1 A;  2Q95 A;  2Q92 A;  5CNX A;  1R5G A;  2GU6 A;  4MAT A;  2Q8K A;  3FMQ A;  2V6C A;  4IU6 A;  5CLS A;  2EVO A;  1QXW A;  3CB5 A;  4IF7 A;  4QR8 A;  3MX6 A;  2GG8 A;  4U71 A;  2BHB A;  2B3H A;  2BWV A;  4FKC A;  4U6J A;  5JFR A;  2GG2 A;  1JAW A;  2DFI A;  4ZWU A;  1WL9 A;  1BOA A;  3FM3 A;  4U6W A;  2BWT A;  1KQ0 A;  1WKM A;  2P98 A;  2GG3 A;  1YJ3 A;  1WY2 A;  1B6A A;  3S6B A;  2OAZ A;  4PV4 A;  1XGN A;  1XGO A;  1YW9 A;  1PV9 A;  2Q93 A;  1M35 A;  3L7G A;  3PKA A;  1W2M A;  4FO7 A;  4U6C A;  5CDV A;  3IU9 A;  5D6F A;  1CHM A;  4U6Z A;  2GU7 A;  3PKB A;  1XGM A;  1R5H A;  4IDY A;  3IG4 A;  2GG0 A;  4IKT A;  3D27 A;  2Q96 A;  4IPA A;  2V3X A;  4RZY A;  2GG7 A;  2ZSG A;  4ZNG A;  1QXY A;  4EGE A;  4U6E A;  5D6E A;  2BWW A;  5E5B A;  5JI6 A;  4FO8 A;  1C23 A;  4U75 A;  2BB7 A;  4S2T P;  4B28 A;  4S01 A;  2MAT A;  4KM3 A;  4S00 A;  1Y1N A;  2BH3 A;  4U1B A;  3CTZ A;  3ROR A;  4FLJ A;  4U70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...