3S6BA

Crystal structure of methionine aminopeptidase 1b from plasmodium falciparum, pf10_0150
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
345
structure length
345
Chain Sequence
HLKTIVKKHLSPENFDPTNRKYWVYDDHLKNFVNFKFTGDVRPWPLSKINHVPSHIERPDYAISSIPESELIYKRKSDIYVNNEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAYPSTLNYYKFPKSCCTSVNEIVCHGIPDYRPLKSGDIINIDISVFYKGVHSDLNETYFVGDINDVPKEGKELVETCYFSLMEAIKKCKPGMFYKNIGTLIDAYVSKKNFSVVRSYSGHGVGKLFHSNPTVPHFKKNKAVGIMKPGHVFTIEPMINQGHYSDVLWPDQWTSATSDGKLSAQFEHTLLITNNGVEILTKRTQDSPPLGFDTKDELYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Crystal structure of methionine aminopeptidase 1b from Plasmodium Falciparum, PF10_0150
rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 109
structure length 345
sequence length 345
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3s6bA01
1JAWA 2GG0A 4QR8A 5FCHA 4FLKA 3S6BA 2V3ZA 3TB5A 2Q95A 4U76A 2HOWA 2Q93A 1XGMA 2Q8KA 2EVCA 2GG8A 2B3KA 3FMRA 4FLLA 1C23A 2BWXA 2B3HA 2BHCA 4FO7A 2BHAA 1KQ0A 4OOKA 4ZNGA 3L7GA 1XNZA 2BHBA 3BIQA 4JUQA 2GG9A 1O0XA 1MATA 1C24A 2B3LA 2V3YA 4R60A 5JHUA 2EA2A 2EVMA 2BWUA 2V3XA 1KQ9A 3L24A 5D6EA 1XGOA 2ZSGA 2GU4A 4U1BA 4ZWUA 2BWSA 4RZZA 5JI6A 4IPAA 4S2RP 3TAVA 1R5HA 1XGSA 4FKCA 4FLJA 2BWWA 1Y1NA 2P99A 4Z7MA 2GU6A 1B6AA 4IKRA 2BB7A 1YVMA 4U6ZA 2GGCA 2GU7A 4U75A 2DFIA 1YW7A 5CDVA 1WL6A 2GZ5A 1A16A 2P9AA 1CHMA 2GG2A 2Q92A 1R5GA 2GG3A 4ZWPA 1QXYA 1XGNA 2BWYA 4U69A 2GA2A 1B59A 1C22A 3CB6A 5CNXA 1N51A 2Q96A 2V6CA 1BN5A 1BOAA 2OAZA 2P98A 2IW2A 4S00A 2BHDA 1WLRA 1WY2A 4IU6A 1QXZA 2Q94A 2GGBA 4B28A 4EGEA 4U6EA 5CE6A 1KP0A 2GG7A 4FUKA 3BITA 4FO8A 1WN1A 4A6VA 2ADUA 4IKUA 1R58A 4IECA 4U6CA 4A6WA 4IKTA 2NQ7A 4MATA 4PNCA 1QXWA 3BIPA 2BN7A 2GU5A 3IU7A 3PKEA 5D6FA 1WL9A 3MR1A 3RVAA 4U73A 3IG4A 2BH3A 5CDLA 3PKDA 4U6WA 2G6PA 3Q6DA 1W7VA 4U71A 5CIKA 4ZWOA 1C27A 1YW9A 3PKCA 4U70A 1YW8A 4U6JA 3RORA 4RZYA 3D27A 3IU9A 3PKAA 1W2MA 2GG5A 4HXXA 4IKSA 4S2TP 4S01A 5CLSA 3MX6A 1QZYA 5E5BA 1WKMA 2NQ6A 3CB5A 3MATA 2EA4A 1YJ3A 2EVOA 2OKNA 3FMQA 3PKBA 2BWTA 4FLIA 2GTXA 5JFRA 1M35A 4RGZ1 1WBQA 5CDEA 3FM3A 1C21A 2BWVA 4IDYA 3CTZA 2MATA 4IF7A 5FCFA 4KM3A 4PV4A 1PV9A 3IU8A
chains in the Genus database with same CATH superfamily
1JAWA 2GG0A 4QR8A 5FCHA 4FLKA 3S6BA 2V3ZA 3TB5A 2Q95A 4U76A 2HOWA 2Q93A 1XGMA 2Q8KA 2EVCA 2GG8A 2B3KA 3FMRA 4FLLA 1C23A 2BWXA 2B3HA 2BHCA 4FO7A 2BHAA 1KQ0A 4OOKA 4ZNGA 3L7GA 1XNZA 2BHBA 3BIQA 4JUQA 2GG9A 1O0XA 1MATA 1C24A 2B3LA 2V3YA 4R60A 5JHUA 2EA2A 2EVMA 2BWUA 2V3XA 1KQ9A 3L24A 5D6EA 1XGOA 2ZSGA 2GU4A 4U1BA 4ZWUA 2BWSA 4RZZA 5JI6A 4IPAA 4S2RP 3TAVA 1R5HA 1XGSA 4FKCA 4FLJA 2BWWA 1Y1NA 2P99A 4Z7MA 2GU6A 1B6AA 4IKRA 2BB7A 1YVMA 4U6ZA 2GGCA 2GU7A 4U75A 2DFIA 1YW7A 5CDVA 1WL6A 2GZ5A 1A16A 2P9AA 1CHMA 2GG2A 2Q92A 1R5GA 2GG3A 4ZWPA 1QXYA 1XGNA 2BWYA 4U69A 2GA2A 1B59A 1C22A 3CB6A 5CNXA 1N51A 2Q96A 2V6CA 1BN5A 1BOAA 2OAZA 2P98A 2IW2A 4S00A 2BHDA 1WLRA 1WY2A 4IU6A 1QXZA 2Q94A 2GGBA 4B28A 4EGEA 4U6EA 5CE6A 1KP0A 2GG7A 4FUKA 3BITA 4FO8A 1WN1A 4A6VA 2ADUA 4IKUA 1R58A 4IECA 4U6CA 4A6WA 4IKTA 2NQ7A 4MATA 4PNCA 1QXWA 3BIPA 2BN7A 2GU5A 3IU7A 3PKEA 5D6FA 1WL9A 3MR1A 3RVAA 4U73A 3IG4A 2BH3A 5CDLA 3PKDA 4U6WA 2G6PA 3Q6DA 1W7VA 4U71A 5CIKA 4ZWOA 1C27A 1YW9A 3PKCA 4U70A 1YW8A 4U6JA 3RORA 4RZYA 3D27A 3IU9A 3PKAA 1W2MA 2GG5A 4HXXA 4IKSA 4S2TP 4S01A 5CLSA 3MX6A 1QZYA 5E5BA 1WKMA 2NQ6A 3CB5A 3MATA 2EA4A 1YJ3A 2EVOA 2OKNA 3FMQA 3PKBA 2BWTA 4FLIA 2GTXA 5JFRA 1M35A 4RGZ1 1WBQA 5CDEA 3FM3A 1C21A 2BWVA 4IDYA 3CTZA 2MATA 4IF7A 5FCFA 4KM3A 4PV4A 1PV9A 3IU8A
chains in the Genus database with same CATH topology
1JAWA 2GG0A 4QR8A 5FCHA 4FLKA 3S6BA 2V3ZA 3TB5A 2Q95A 4U76A 2HOWA 2Q93A 1XGMA 2Q8KA 2EVCA 2GG8A 2B3KA 3FMRA 4FLLA 1C23A 2BWXA 2B3HA 2BHCA 4FO7A 2BHAA 1KQ0A 4OOKA 4ZNGA 3L7GA 1XNZA 2BHBA 3BIQA 4JUQA 2GG9A 1O0XA 1MATA 1C24A 2B3LA 2V3YA 4R60A 5JHUA 2EA2A 2EVMA 2BWUA 2V3XA 1KQ9A 3L24A 5D6EA 1XGOA 2ZSGA 2GU4A 4U1BA 4ZWUA 2BWSA 4RZZA 5JI6A 4IPAA 4S2RP 3TAVA 1R5HA 1XGSA 4FKCA 4FLJA 2BWWA 1Y1NA 2P99A 4Z7MA 2GU6A 1B6AA 4IKRA 2BB7A 1YVMA 4U6ZA 2GGCA 2GU7A 4U75A 2DFIA 1YW7A 5CDVA 1WL6A 2GZ5A 1A16A 2P9AA 1CHMA 2GG2A 2Q92A 1R5GA 2GG3A 4ZWPA 1QXYA 1XGNA 2BWYA 4U69A 2GA2A 1B59A 1C22A 3CB6A 5CNXA 1N51A 2Q96A 2V6CA 1BN5A 1BOAA 2OAZA 2P98A 2IW2A 4S00A 2BHDA 1WLRA 1WY2A 4IU6A 1QXZA 2Q94A 2GGBA 4B28A 4EGEA 4U6EA 5CE6A 1KP0A 2GG7A 4FUKA 3BITA 4FO8A 1WN1A 4A6VA 2ADUA 4IKUA 1R58A 4IECA 4U6CA 4A6WA 4IKTA 2NQ7A 4MATA 4PNCA 1QXWA 3BIPA 2BN7A 2GU5A 3IU7A 3PKEA 5D6FA 1WL9A 3MR1A 3RVAA 4U73A 3IG4A 2BH3A 5CDLA 3PKDA 4U6WA 2G6PA 3Q6DA 1W7VA 4U71A 5CIKA 4ZWOA 1C27A 1YW9A 3PKCA 4U70A 1YW8A 4U6JA 3RORA 4RZYA 3D27A 3IU9A 3PKAA 1W2MA 2GG5A 4HXXA 4IKSA 4S2TP 4S01A 5CLSA 3MX6A 1QZYA 5E5BA 1WKMA 2NQ6A 3CB5A 3MATA 2EA4A 1YJ3A 2EVOA 2OKNA 3FMQA 3PKBA 2BWTA 4FLIA 2GTXA 5JFRA 1M35A 4RGZ1 1WBQA 5CDEA 3FM3A 1C21A 2BWVA 4IDYA 3CTZA 2MATA 4IF7A 5FCFA 4KM3A 4PV4A 1PV9A 3IU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAW A;  2GG0 A;  4QR8 A;  5FCH A;  4FLK A;  3S6B A;  2V3Z A;  3TB5 A;  2Q95 A;  4U76 A;  2HOW A;  2Q93 A;  1XGM A;  2Q8K A;  2EVC A;  2GG8 A;  2B3K A;  3FMR A;  4FLL A;  1C23 A;  2BWX A;  2B3H A;  2BHC A;  4FO7 A;  2BHA A;  1KQ0 A;  4OOK A;  4ZNG A;  3L7G A;  1XNZ A;  2BHB A;  3BIQ A;  4JUQ A;  2GG9 A;  1O0X A;  1MAT A;  1C24 A;  2B3L A;  2V3Y A;  4R60 A;  5JHU A;  2EA2 A;  2EVM A;  2BWU A;  2V3X A;  1KQ9 A;  3L24 A;  5D6E A;  1XGO A;  2ZSG A;  2GU4 A;  4U1B A;  4ZWU A;  2BWS A;  4RZZ A;  5JI6 A;  4IPA A;  4S2R P;  3TAV A;  1R5H A;  1XGS A;  4FKC A;  4FLJ A;  2BWW A;  1Y1N A;  2P99 A;  4Z7M A;  2GU6 A;  1B6A A;  4IKR A;  2BB7 A;  1YVM A;  4U6Z A;  2GGC A;  2GU7 A;  4U75 A;  2DFI A;  1YW7 A;  5CDV A;  1WL6 A;  2GZ5 A;  1A16 A;  2P9A A;  1CHM A;  2GG2 A;  2Q92 A;  1R5G A;  2GG3 A;  4ZWP A;  1QXY A;  1XGN A;  2BWY A;  4U69 A;  2GA2 A;  1B59 A;  1C22 A;  3CB6 A;  5CNX A;  1N51 A;  2Q96 A;  2V6C A;  1BN5 A;  1BOA A;  2OAZ A;  2P98 A;  2IW2 A;  4S00 A;  2BHD A;  1WLR A;  1WY2 A;  4IU6 A;  1QXZ A;  2Q94 A;  2GGB A;  4B28 A;  4EGE A;  4U6E A;  5CE6 A;  1KP0 A;  2GG7 A;  4FUK A;  3BIT A;  4FO8 A;  1WN1 A;  4A6V A;  2ADU A;  4IKU A;  1R58 A;  4IEC A;  4U6C A;  4A6W A;  4IKT A;  2NQ7 A;  4MAT A;  4PNC A;  1QXW A;  3BIP A;  2BN7 A;  2GU5 A;  3IU7 A;  3PKE A;  5D6F A;  1WL9 A;  3MR1 A;  3RVA A;  4U73 A;  3IG4 A;  2BH3 A;  5CDL A;  3PKD A;  4U6W A;  2G6P A;  3Q6D A;  1W7V A;  4U71 A;  5CIK A;  4ZWO A;  1C27 A;  1YW9 A;  3PKC A;  4U70 A;  1YW8 A;  4U6J A;  3ROR A;  4RZY A;  3D27 A;  3IU9 A;  3PKA A;  1W2M A;  2GG5 A;  4HXX A;  4IKS A;  4S2T P;  4S01 A;  5CLS A;  3MX6 A;  1QZY A;  5E5B A;  1WKM A;  2NQ6 A;  3CB5 A;  3MAT A;  2EA4 A;  1YJ3 A;  2EVO A;  2OKN A;  3FMQ A;  3PKB A;  2BWT A;  4FLI A;  2GTX A;  5JFR A;  1M35 A;  4RGZ 1;  1WBQ A;  5CDE A;  3FM3 A;  1C21 A;  2BWV A;  4IDY A;  3CTZ A;  2MAT A;  4IF7 A;  5FCF A;  4KM3 A;  4PV4 A;  1PV9 A;  3IU8 A; 
#chains in the Genus database with same CATH topology
 1JAW A;  2GG0 A;  4QR8 A;  5FCH A;  4FLK A;  3S6B A;  2V3Z A;  3TB5 A;  2Q95 A;  4U76 A;  2HOW A;  2Q93 A;  1XGM A;  2Q8K A;  2EVC A;  2GG8 A;  2B3K A;  3FMR A;  4FLL A;  1C23 A;  2BWX A;  2B3H A;  2BHC A;  4FO7 A;  2BHA A;  1KQ0 A;  4OOK A;  4ZNG A;  3L7G A;  1XNZ A;  2BHB A;  3BIQ A;  4JUQ A;  2GG9 A;  1O0X A;  1MAT A;  1C24 A;  2B3L A;  2V3Y A;  4R60 A;  5JHU A;  2EA2 A;  2EVM A;  2BWU A;  2V3X A;  1KQ9 A;  3L24 A;  5D6E A;  1XGO A;  2ZSG A;  2GU4 A;  4U1B A;  4ZWU A;  2BWS A;  4RZZ A;  5JI6 A;  4IPA A;  4S2R P;  3TAV A;  1R5H A;  1XGS A;  4FKC A;  4FLJ A;  2BWW A;  1Y1N A;  2P99 A;  4Z7M A;  2GU6 A;  1B6A A;  4IKR A;  2BB7 A;  1YVM A;  4U6Z A;  2GGC A;  2GU7 A;  4U75 A;  2DFI A;  1YW7 A;  5CDV A;  1WL6 A;  2GZ5 A;  1A16 A;  2P9A A;  1CHM A;  2GG2 A;  2Q92 A;  1R5G A;  2GG3 A;  4ZWP A;  1QXY A;  1XGN A;  2BWY A;  4U69 A;  2GA2 A;  1B59 A;  1C22 A;  3CB6 A;  5CNX A;  1N51 A;  2Q96 A;  2V6C A;  1BN5 A;  1BOA A;  2OAZ A;  2P98 A;  2IW2 A;  4S00 A;  2BHD A;  1WLR A;  1WY2 A;  4IU6 A;  1QXZ A;  2Q94 A;  2GGB A;  4B28 A;  4EGE A;  4U6E A;  5CE6 A;  1KP0 A;  2GG7 A;  4FUK A;  3BIT A;  4FO8 A;  1WN1 A;  4A6V A;  2ADU A;  4IKU A;  1R58 A;  4IEC A;  4U6C A;  4A6W A;  4IKT A;  2NQ7 A;  4MAT A;  4PNC A;  1QXW A;  3BIP A;  2BN7 A;  2GU5 A;  3IU7 A;  3PKE A;  5D6F A;  1WL9 A;  3MR1 A;  3RVA A;  4U73 A;  3IG4 A;  2BH3 A;  5CDL A;  3PKD A;  4U6W A;  2G6P A;  3Q6D A;  1W7V A;  4U71 A;  5CIK A;  4ZWO A;  1C27 A;  1YW9 A;  3PKC A;  4U70 A;  1YW8 A;  4U6J A;  3ROR A;  4RZY A;  3D27 A;  3IU9 A;  3PKA A;  1W2M A;  2GG5 A;  4HXX A;  4IKS A;  4S2T P;  4S01 A;  5CLS A;  3MX6 A;  1QZY A;  5E5B A;  1WKM A;  2NQ6 A;  3CB5 A;  3MAT A;  2EA4 A;  1YJ3 A;  2EVO A;  2OKN A;  3FMQ A;  3PKB A;  2BWT A;  4FLI A;  2GTX A;  5JFR A;  1M35 A;  4RGZ 1;  1WBQ A;  5CDE A;  3FM3 A;  1C21 A;  2BWV A;  4IDY A;  3CTZ A;  2MAT A;  4IF7 A;  5FCF A;  4KM3 A;  4PV4 A;  1PV9 A;  3IU8 A; 
#chains in the Genus database with same CATH homology
 1JAW A;  2GG0 A;  4QR8 A;  5FCH A;  4FLK A;  3S6B A;  2V3Z A;  3TB5 A;  2Q95 A;  4U76 A;  2HOW A;  2Q93 A;  1XGM A;  2Q8K A;  2EVC A;  2GG8 A;  2B3K A;  3FMR A;  4FLL A;  1C23 A;  2BWX A;  2B3H A;  2BHC A;  4FO7 A;  2BHA A;  1KQ0 A;  4OOK A;  4ZNG A;  3L7G A;  1XNZ A;  2BHB A;  3BIQ A;  4JUQ A;  2GG9 A;  1O0X A;  1MAT A;  1C24 A;  2B3L A;  2V3Y A;  4R60 A;  5JHU A;  2EA2 A;  2EVM A;  2BWU A;  2V3X A;  1KQ9 A;  3L24 A;  5D6E A;  1XGO A;  2ZSG A;  2GU4 A;  4U1B A;  4ZWU A;  2BWS A;  4RZZ A;  5JI6 A;  4IPA A;  4S2R P;  3TAV A;  1R5H A;  1XGS A;  4FKC A;  4FLJ A;  2BWW A;  1Y1N A;  2P99 A;  4Z7M A;  2GU6 A;  1B6A A;  4IKR A;  2BB7 A;  1YVM A;  4U6Z A;  2GGC A;  2GU7 A;  4U75 A;  2DFI A;  1YW7 A;  5CDV A;  1WL6 A;  2GZ5 A;  1A16 A;  2P9A A;  1CHM A;  2GG2 A;  2Q92 A;  1R5G A;  2GG3 A;  4ZWP A;  1QXY A;  1XGN A;  2BWY A;  4U69 A;  2GA2 A;  1B59 A;  1C22 A;  3CB6 A;  5CNX A;  1N51 A;  2Q96 A;  2V6C A;  1BN5 A;  1BOA A;  2OAZ A;  2P98 A;  2IW2 A;  4S00 A;  2BHD A;  1WLR A;  1WY2 A;  4IU6 A;  1QXZ A;  2Q94 A;  2GGB A;  4B28 A;  4EGE A;  4U6E A;  5CE6 A;  1KP0 A;  2GG7 A;  4FUK A;  3BIT A;  4FO8 A;  1WN1 A;  4A6V A;  2ADU A;  4IKU A;  1R58 A;  4IEC A;  4U6C A;  4A6W A;  4IKT A;  2NQ7 A;  4MAT A;  4PNC A;  1QXW A;  3BIP A;  2BN7 A;  2GU5 A;  3IU7 A;  3PKE A;  5D6F A;  1WL9 A;  3MR1 A;  3RVA A;  4U73 A;  3IG4 A;  2BH3 A;  5CDL A;  3PKD A;  4U6W A;  2G6P A;  3Q6D A;  1W7V A;  4U71 A;  5CIK A;  4ZWO A;  1C27 A;  1YW9 A;  3PKC A;  4U70 A;  1YW8 A;  4U6J A;  3ROR A;  4RZY A;  3D27 A;  3IU9 A;  3PKA A;  1W2M A;  2GG5 A;  4HXX A;  4IKS A;  4S2T P;  4S01 A;  5CLS A;  3MX6 A;  1QZY A;  5E5B A;  1WKM A;  2NQ6 A;  3CB5 A;  3MAT A;  2EA4 A;  1YJ3 A;  2EVO A;  2OKN A;  3FMQ A;  3PKB A;  2BWT A;  4FLI A;  2GTX A;  5JFR A;  1M35 A;  4RGZ 1;  1WBQ A;  5CDE A;  3FM3 A;  1C21 A;  2BWV A;  4IDY A;  3CTZ A;  2MAT A;  4IF7 A;  5FCF A;  4KM3 A;  4PV4 A;  1PV9 A;  3IU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...