1QXWA

Crystal structure of staphyloccocus aureus in complex with an aminoketone inhibitor 54135.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
b'MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methionyl aminopeptidase
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
total genus 82
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxwA00
1KQ0A 2GTXA 2GZ5A 4RGZ1 1YW7A 4Z7MA 2BN7A 5D6EA 2GU5A 2Q92A 1C24A 2P99A 3FMRA 2BWXA 4KM3A 3IU8A 2BH3A 2GGBA 2V6CA 4RZZA 5CNXA 2GU7A 4U71A 2BHCA 4U6EA 5FCFA 2V3ZA 3PKDA 4FO7A 1MATA 2Q94A 2BHBA 5CDVA 3BITA 1YW9A 1W7VA 4FKCA 2GG2A 4A6VA 4IPAA 5CDLA 2HOWA 4EGEA 3PKEA 2B3HA 4U6WA 4ZWOA 3IU9A 1QXWA 3MATA 4MATA 4RZYA 4ZWUA 4ZWPA 2BHDA 2BWWA 3TAVA 1XGMA 2P9AA 3BIQA 3CB6A 3TB5A 3FMQA 4FLIA 1QZYA 1QXZA 2GG7A 5D6FA 5CDEA 1C22A 1JAWA 2EA4A 3D27A 3CB5A 1PV9A 4U75A 1XGOA 3CTZA 3L7GA 5FCHA 4IKUA 4IF7A 1YW8A 4QR8A 1KQ9A 2BWSA 2B3KA 2GA2A 1C23A 1WL6A 5CE6A 5JI6A 4FLKA 5JHUA 3MX6A 4HXXA 5E5BA 3FM3A 2DFIA 1M35A 5JFRA 4OOKA 2GG0A 2BWVA 1C27A 1XGSA 2NQ6A 2Q95A 5CIKA 3PKCA 1KP0A 4IKTA 2GU6A 1O0XA 4IKRA 3MR1A 4U69A 1A16A 3S6BA 1WLRA 1XGNA 1WKMA 2MATA 4FUKA 2Q8KA 3Q6DA 2NQ7A 4PNCA 4U6ZA 1R5GA 3BIPA 1R58A 1W2MA 2BB7A 2EVCA 2GG9A 4PV4A 1YVMA 1BN5A 3L24A 4FLLA 4A6WA 4IDYA 1YJ3A 1Y1NA 4U1BA 2OAZA 1WY2A 1XNZA 2BWTA 1WN1A 2P98A 1C21A 4IU6A 4U70A 2GGCA 4U73A 3PKAA 2GG3A 2B3LA 2BWYA 2EA2A 1R5HA 2ZSGA 1QXYA 4S00A 1CHMA 2ADUA 2Q96A 2V3YA 4U76A 2EVMA 1B59A 2EVOA 4IKSA 4IECA 3PKBA 2BWUA 3IU7A 4S2RP 4B28A 4R60A 2Q93A 4U6JA 1BOAA 2GG8A 2IW2A 3RORA 5CLSA 2GU4A 3RVAA 3IG4A 1WL9A 4FLJA 2V3XA 2GG5A 4U6CA 2OKNA 4FO8A 1B6AA 1WBQA 4S2TP 4ZNGA 4S01A 1N51A 2BHAA 2G6PA 4JUQA
chains in the Genus database with same CATH superfamily
1KQ0A 2GTXA 2GZ5A 4RGZ1 1YW7A 4Z7MA 2BN7A 5D6EA 2GU5A 2Q92A 1C24A 2P99A 3FMRA 2BWXA 4KM3A 3IU8A 2BH3A 2GGBA 2V6CA 4RZZA 5CNXA 2GU7A 4U71A 2BHCA 4U6EA 5FCFA 2V3ZA 3PKDA 4FO7A 1MATA 2Q94A 2BHBA 5CDVA 3BITA 1YW9A 1W7VA 4FKCA 2GG2A 4A6VA 4IPAA 5CDLA 2HOWA 4EGEA 3PKEA 2B3HA 4U6WA 4ZWOA 3IU9A 1QXWA 3MATA 4MATA 4RZYA 4ZWUA 4ZWPA 2BHDA 2BWWA 3TAVA 1XGMA 2P9AA 3BIQA 3CB6A 3TB5A 3FMQA 4FLIA 1QZYA 1QXZA 2GG7A 5D6FA 5CDEA 1C22A 1JAWA 2EA4A 3D27A 3CB5A 1PV9A 4U75A 1XGOA 3CTZA 3L7GA 5FCHA 4IKUA 4IF7A 1YW8A 4QR8A 1KQ9A 2BWSA 2B3KA 2GA2A 1C23A 1WL6A 5CE6A 5JI6A 4FLKA 5JHUA 3MX6A 4HXXA 5E5BA 3FM3A 2DFIA 1M35A 5JFRA 4OOKA 2GG0A 2BWVA 1C27A 1XGSA 2NQ6A 2Q95A 5CIKA 3PKCA 1KP0A 4IKTA 2GU6A 1O0XA 4IKRA 3MR1A 4U69A 1A16A 3S6BA 1WLRA 1XGNA 1WKMA 2MATA 4FUKA 2Q8KA 3Q6DA 2NQ7A 4PNCA 4U6ZA 1R5GA 3BIPA 1R58A 1W2MA 2BB7A 2EVCA 2GG9A 4PV4A 1YVMA 1BN5A 3L24A 4FLLA 4A6WA 4IDYA 1YJ3A 1Y1NA 4U1BA 2OAZA 1WY2A 1XNZA 2BWTA 1WN1A 2P98A 1C21A 4IU6A 4U70A 2GGCA 4U73A 3PKAA 2GG3A 2B3LA 2BWYA 2EA2A 1R5HA 2ZSGA 1QXYA 4S00A 1CHMA 2ADUA 2Q96A 2V3YA 4U76A 2EVMA 1B59A 2EVOA 4IKSA 4IECA 3PKBA 2BWUA 3IU7A 4S2RP 4B28A 4R60A 2Q93A 4U6JA 1BOAA 2GG8A 2IW2A 3RORA 5CLSA 2GU4A 3RVAA 3IG4A 1WL9A 4FLJA 2V3XA 2GG5A 4U6CA 2OKNA 4FO8A 1B6AA 1WBQA 4S2TP 4ZNGA 4S01A 1N51A 2BHAA 2G6PA 4JUQA
chains in the Genus database with same CATH topology
1KQ0A 2GTXA 2GZ5A 4RGZ1 1YW7A 4Z7MA 2BN7A 5D6EA 2GU5A 2Q92A 1C24A 2P99A 3FMRA 2BWXA 4KM3A 3IU8A 2BH3A 2GGBA 2V6CA 4RZZA 5CNXA 2GU7A 4U71A 2BHCA 4U6EA 5FCFA 2V3ZA 3PKDA 4FO7A 1MATA 2Q94A 2BHBA 5CDVA 3BITA 1YW9A 1W7VA 4FKCA 2GG2A 4A6VA 4IPAA 5CDLA 2HOWA 4EGEA 3PKEA 2B3HA 4U6WA 4ZWOA 3IU9A 1QXWA 3MATA 4MATA 4RZYA 4ZWUA 4ZWPA 2BHDA 2BWWA 3TAVA 1XGMA 2P9AA 3BIQA 3CB6A 3TB5A 3FMQA 4FLIA 1QZYA 1QXZA 2GG7A 5D6FA 5CDEA 1C22A 1JAWA 2EA4A 3D27A 3CB5A 1PV9A 4U75A 1XGOA 3CTZA 3L7GA 5FCHA 4IKUA 4IF7A 1YW8A 4QR8A 1KQ9A 2BWSA 2B3KA 2GA2A 1C23A 1WL6A 5CE6A 5JI6A 4FLKA 5JHUA 3MX6A 4HXXA 5E5BA 3FM3A 2DFIA 1M35A 5JFRA 4OOKA 2GG0A 2BWVA 1C27A 1XGSA 2NQ6A 2Q95A 5CIKA 3PKCA 1KP0A 4IKTA 2GU6A 1O0XA 4IKRA 3MR1A 4U69A 1A16A 3S6BA 1WLRA 1XGNA 1WKMA 2MATA 4FUKA 2Q8KA 3Q6DA 2NQ7A 4PNCA 4U6ZA 1R5GA 3BIPA 1R58A 1W2MA 2BB7A 2EVCA 2GG9A 4PV4A 1YVMA 1BN5A 3L24A 4FLLA 4A6WA 4IDYA 1YJ3A 1Y1NA 4U1BA 2OAZA 1WY2A 1XNZA 2BWTA 1WN1A 2P98A 1C21A 4IU6A 4U70A 2GGCA 4U73A 3PKAA 2GG3A 2B3LA 2BWYA 2EA2A 1R5HA 2ZSGA 1QXYA 4S00A 1CHMA 2ADUA 2Q96A 2V3YA 4U76A 2EVMA 1B59A 2EVOA 4IKSA 4IECA 3PKBA 2BWUA 3IU7A 4S2RP 4B28A 4R60A 2Q93A 4U6JA 1BOAA 2GG8A 2IW2A 3RORA 5CLSA 2GU4A 3RVAA 3IG4A 1WL9A 4FLJA 2V3XA 2GG5A 4U6CA 2OKNA 4FO8A 1B6AA 1WBQA 4S2TP 4ZNGA 4S01A 1N51A 2BHAA 2G6PA 4JUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ0 A;  2GTX A;  2GZ5 A;  4RGZ 1;  1YW7 A;  4Z7M A;  2BN7 A;  5D6E A;  2GU5 A;  2Q92 A;  1C24 A;  2P99 A;  3FMR A;  2BWX A;  4KM3 A;  3IU8 A;  2BH3 A;  2GGB A;  2V6C A;  4RZZ A;  5CNX A;  2GU7 A;  4U71 A;  2BHC A;  4U6E A;  5FCF A;  2V3Z A;  3PKD A;  4FO7 A;  1MAT A;  2Q94 A;  2BHB A;  5CDV A;  3BIT A;  1YW9 A;  1W7V A;  4FKC A;  2GG2 A;  4A6V A;  4IPA A;  5CDL A;  2HOW A;  4EGE A;  3PKE A;  2B3H A;  4U6W A;  4ZWO A;  3IU9 A;  1QXW A;  3MAT A;  4MAT A;  4RZY A;  4ZWU A;  4ZWP A;  2BHD A;  2BWW A;  3TAV A;  1XGM A;  2P9A A;  3BIQ A;  3CB6 A;  3TB5 A;  3FMQ A;  4FLI A;  1QZY A;  1QXZ A;  2GG7 A;  5D6F A;  5CDE A;  1C22 A;  1JAW A;  2EA4 A;  3D27 A;  3CB5 A;  1PV9 A;  4U75 A;  1XGO A;  3CTZ A;  3L7G A;  5FCH A;  4IKU A;  4IF7 A;  1YW8 A;  4QR8 A;  1KQ9 A;  2BWS A;  2B3K A;  2GA2 A;  1C23 A;  1WL6 A;  5CE6 A;  5JI6 A;  4FLK A;  5JHU A;  3MX6 A;  4HXX A;  5E5B A;  3FM3 A;  2DFI A;  1M35 A;  5JFR A;  4OOK A;  2GG0 A;  2BWV A;  1C27 A;  1XGS A;  2NQ6 A;  2Q95 A;  5CIK A;  3PKC A;  1KP0 A;  4IKT A;  2GU6 A;  1O0X A;  4IKR A;  3MR1 A;  4U69 A;  1A16 A;  3S6B A;  1WLR A;  1XGN A;  1WKM A;  2MAT A;  4FUK A;  2Q8K A;  3Q6D A;  2NQ7 A;  4PNC A;  4U6Z A;  1R5G A;  3BIP A;  1R58 A;  1W2M A;  2BB7 A;  2EVC A;  2GG9 A;  4PV4 A;  1YVM A;  1BN5 A;  3L24 A;  4FLL A;  4A6W A;  4IDY A;  1YJ3 A;  1Y1N A;  4U1B A;  2OAZ A;  1WY2 A;  1XNZ A;  2BWT A;  1WN1 A;  2P98 A;  1C21 A;  4IU6 A;  4U70 A;  2GGC A;  4U73 A;  3PKA A;  2GG3 A;  2B3L A;  2BWY A;  2EA2 A;  1R5H A;  2ZSG A;  1QXY A;  4S00 A;  1CHM A;  2ADU A;  2Q96 A;  2V3Y A;  4U76 A;  2EVM A;  1B59 A;  2EVO A;  4IKS A;  4IEC A;  3PKB A;  2BWU A;  3IU7 A;  4S2R P;  4B28 A;  4R60 A;  2Q93 A;  4U6J A;  1BOA A;  2GG8 A;  2IW2 A;  3ROR A;  5CLS A;  2GU4 A;  3RVA A;  3IG4 A;  1WL9 A;  4FLJ A;  2V3X A;  2GG5 A;  4U6C A;  2OKN A;  4FO8 A;  1B6A A;  1WBQ A;  4S2T P;  4ZNG A;  4S01 A;  1N51 A;  2BHA A;  2G6P A;  4JUQ A; 
#chains in the Genus database with same CATH topology
 1KQ0 A;  2GTX A;  2GZ5 A;  4RGZ 1;  1YW7 A;  4Z7M A;  2BN7 A;  5D6E A;  2GU5 A;  2Q92 A;  1C24 A;  2P99 A;  3FMR A;  2BWX A;  4KM3 A;  3IU8 A;  2BH3 A;  2GGB A;  2V6C A;  4RZZ A;  5CNX A;  2GU7 A;  4U71 A;  2BHC A;  4U6E A;  5FCF A;  2V3Z A;  3PKD A;  4FO7 A;  1MAT A;  2Q94 A;  2BHB A;  5CDV A;  3BIT A;  1YW9 A;  1W7V A;  4FKC A;  2GG2 A;  4A6V A;  4IPA A;  5CDL A;  2HOW A;  4EGE A;  3PKE A;  2B3H A;  4U6W A;  4ZWO A;  3IU9 A;  1QXW A;  3MAT A;  4MAT A;  4RZY A;  4ZWU A;  4ZWP A;  2BHD A;  2BWW A;  3TAV A;  1XGM A;  2P9A A;  3BIQ A;  3CB6 A;  3TB5 A;  3FMQ A;  4FLI A;  1QZY A;  1QXZ A;  2GG7 A;  5D6F A;  5CDE A;  1C22 A;  1JAW A;  2EA4 A;  3D27 A;  3CB5 A;  1PV9 A;  4U75 A;  1XGO A;  3CTZ A;  3L7G A;  5FCH A;  4IKU A;  4IF7 A;  1YW8 A;  4QR8 A;  1KQ9 A;  2BWS A;  2B3K A;  2GA2 A;  1C23 A;  1WL6 A;  5CE6 A;  5JI6 A;  4FLK A;  5JHU A;  3MX6 A;  4HXX A;  5E5B A;  3FM3 A;  2DFI A;  1M35 A;  5JFR A;  4OOK A;  2GG0 A;  2BWV A;  1C27 A;  1XGS A;  2NQ6 A;  2Q95 A;  5CIK A;  3PKC A;  1KP0 A;  4IKT A;  2GU6 A;  1O0X A;  4IKR A;  3MR1 A;  4U69 A;  1A16 A;  3S6B A;  1WLR A;  1XGN A;  1WKM A;  2MAT A;  4FUK A;  2Q8K A;  3Q6D A;  2NQ7 A;  4PNC A;  4U6Z A;  1R5G A;  3BIP A;  1R58 A;  1W2M A;  2BB7 A;  2EVC A;  2GG9 A;  4PV4 A;  1YVM A;  1BN5 A;  3L24 A;  4FLL A;  4A6W A;  4IDY A;  1YJ3 A;  1Y1N A;  4U1B A;  2OAZ A;  1WY2 A;  1XNZ A;  2BWT A;  1WN1 A;  2P98 A;  1C21 A;  4IU6 A;  4U70 A;  2GGC A;  4U73 A;  3PKA A;  2GG3 A;  2B3L A;  2BWY A;  2EA2 A;  1R5H A;  2ZSG A;  1QXY A;  4S00 A;  1CHM A;  2ADU A;  2Q96 A;  2V3Y A;  4U76 A;  2EVM A;  1B59 A;  2EVO A;  4IKS A;  4IEC A;  3PKB A;  2BWU A;  3IU7 A;  4S2R P;  4B28 A;  4R60 A;  2Q93 A;  4U6J A;  1BOA A;  2GG8 A;  2IW2 A;  3ROR A;  5CLS A;  2GU4 A;  3RVA A;  3IG4 A;  1WL9 A;  4FLJ A;  2V3X A;  2GG5 A;  4U6C A;  2OKN A;  4FO8 A;  1B6A A;  1WBQ A;  4S2T P;  4ZNG A;  4S01 A;  1N51 A;  2BHA A;  2G6P A;  4JUQ A; 
#chains in the Genus database with same CATH homology
 1KQ0 A;  2GTX A;  2GZ5 A;  4RGZ 1;  1YW7 A;  4Z7M A;  2BN7 A;  5D6E A;  2GU5 A;  2Q92 A;  1C24 A;  2P99 A;  3FMR A;  2BWX A;  4KM3 A;  3IU8 A;  2BH3 A;  2GGB A;  2V6C A;  4RZZ A;  5CNX A;  2GU7 A;  4U71 A;  2BHC A;  4U6E A;  5FCF A;  2V3Z A;  3PKD A;  4FO7 A;  1MAT A;  2Q94 A;  2BHB A;  5CDV A;  3BIT A;  1YW9 A;  1W7V A;  4FKC A;  2GG2 A;  4A6V A;  4IPA A;  5CDL A;  2HOW A;  4EGE A;  3PKE A;  2B3H A;  4U6W A;  4ZWO A;  3IU9 A;  1QXW A;  3MAT A;  4MAT A;  4RZY A;  4ZWU A;  4ZWP A;  2BHD A;  2BWW A;  3TAV A;  1XGM A;  2P9A A;  3BIQ A;  3CB6 A;  3TB5 A;  3FMQ A;  4FLI A;  1QZY A;  1QXZ A;  2GG7 A;  5D6F A;  5CDE A;  1C22 A;  1JAW A;  2EA4 A;  3D27 A;  3CB5 A;  1PV9 A;  4U75 A;  1XGO A;  3CTZ A;  3L7G A;  5FCH A;  4IKU A;  4IF7 A;  1YW8 A;  4QR8 A;  1KQ9 A;  2BWS A;  2B3K A;  2GA2 A;  1C23 A;  1WL6 A;  5CE6 A;  5JI6 A;  4FLK A;  5JHU A;  3MX6 A;  4HXX A;  5E5B A;  3FM3 A;  2DFI A;  1M35 A;  5JFR A;  4OOK A;  2GG0 A;  2BWV A;  1C27 A;  1XGS A;  2NQ6 A;  2Q95 A;  5CIK A;  3PKC A;  1KP0 A;  4IKT A;  2GU6 A;  1O0X A;  4IKR A;  3MR1 A;  4U69 A;  1A16 A;  3S6B A;  1WLR A;  1XGN A;  1WKM A;  2MAT A;  4FUK A;  2Q8K A;  3Q6D A;  2NQ7 A;  4PNC A;  4U6Z A;  1R5G A;  3BIP A;  1R58 A;  1W2M A;  2BB7 A;  2EVC A;  2GG9 A;  4PV4 A;  1YVM A;  1BN5 A;  3L24 A;  4FLL A;  4A6W A;  4IDY A;  1YJ3 A;  1Y1N A;  4U1B A;  2OAZ A;  1WY2 A;  1XNZ A;  2BWT A;  1WN1 A;  2P98 A;  1C21 A;  4IU6 A;  4U70 A;  2GGC A;  4U73 A;  3PKA A;  2GG3 A;  2B3L A;  2BWY A;  2EA2 A;  1R5H A;  2ZSG A;  1QXY A;  4S00 A;  1CHM A;  2ADU A;  2Q96 A;  2V3Y A;  4U76 A;  2EVM A;  1B59 A;  2EVO A;  4IKS A;  4IEC A;  3PKB A;  2BWU A;  3IU7 A;  4S2R P;  4B28 A;  4R60 A;  2Q93 A;  4U6J A;  1BOA A;  2GG8 A;  2IW2 A;  3ROR A;  5CLS A;  2GU4 A;  3RVA A;  3IG4 A;  1WL9 A;  4FLJ A;  2V3X A;  2GG5 A;  4U6C A;  2OKN A;  4FO8 A;  1B6A A;  1WBQ A;  4S2T P;  4ZNG A;  4S01 A;  1N51 A;  2BHA A;  2G6P A;  4JUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...