1QXWA

Crystal structure of staphyloccocus aureus in complex with an aminoketone inhibitor 54135.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords methionyl aminopeptidase
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 82
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxwA00
2NQ6A 1B59A 3D27A 4U71A 2B3LA 3Q6DA 4U69A 2BHBA 3PKAA 1C24A 3RVAA 5CDLA 2BHAA 5JFRA 4EGEA 2P98A 4MATA 4U6ZA 2Q94A 2P99A 2GG5A 5JHUA 4FLIA 4ZNGA 4RZYA 5CNXA 1M35A 1MATA 2GZ5A 1YVMA 5E5BA 5D6EA 3PKDA 4RZZA 4FKCA 4PV4A 2GG3A 4IKRA 2BB7A 5CDEA 1WLRA 1R5GA 2GU4A 1A16A 1PV9A 2BWWA 2GGCA 2BWSA 3FMRA 3S6BA 2Q8KA 4U6CA 4FLJA 3PKEA 2BH3A 1R58A 4U6WA 2ADUA 2EVMA 2V3XA 3IU9A 3PKBA 3MX6A 5FCHA 3IU8A 4PNCA 2GU6A 2BWUA 2GG2A 2OKNA 2EVCA 1YW7A 3CB5A 3MATA 2GA2A 1N51A 4IKUA 3BIQA 4FO7A 1W2MA 2EA2A 4IU6A 2B3HA 4A6VA 3FM3A 1WKMA 1WBQA 2BHCA 2G6PA 4U6EA 3FMQA 2HOWA 5CIKA 1YW8A 2V3ZA 2GTXA 1BOAA 2V6CA 1XGSA 3BIPA 4KM3A 4A6WA 1KQ9A 3L7GA 4U6JA 1O0XA 1WN1A 2GU5A 1C21A 2Q93A 1BN5A 2ZSGA 5CLSA 1W7VA 4ZWUA 1C23A 1YJ3A 2V3YA 4FLLA 2IW2A 4S2RP 1CHMA 2GGBA 4IKTA 3L24A 4U70A 4OOKA 1C27A 1QXZA 4JUQA 1XGMA 1QXYA 2BWTA 3BITA 1XNZA 4IKSA 2NQ7A 2BWYA 1WL9A 1JAWA 1WY2A 4ZWPA 4U75A 4U73A 1KQ0A 2GG9A 2GG7A 1KP0A 4U76A 2DFIA 3MR1A 2Q95A 5CDVA 2GU7A 3CTZA 4IECA 5FCFA 1QXWA 1XGOA 2BN7A 4S2TP 4ZWOA 1WL6A 3TAVA 5D6FA 3RORA 5CE6A 1QZYA 2GG0A 3IU7A 4IPAA 4QR8A 2EA4A 2Q92A 2Q96A 4FLKA 3TB5A 4R60A 1R5HA 4HXXA 1B6AA 2OAZA 4IDYA 2P9AA 2B3KA 2BWXA 4B28A 2GG8A 4RGZ1 4Z7MA 2MATA 4S01A 3PKCA 4U1BA 5JI6A 1Y1NA 2BWVA 3CB6A 4FO8A 4S00A 2EVOA 1YW9A 2BHDA 4FUKA 3IG4A 1C22A 4IF7A 1XGNA
chains in the Genus database with same CATH superfamily
2NQ6A 1B59A 3D27A 4U71A 2B3LA 3Q6DA 4U69A 2BHBA 3PKAA 1C24A 3RVAA 5CDLA 2BHAA 5JFRA 4EGEA 2P98A 4MATA 4U6ZA 2Q94A 2P99A 2GG5A 5JHUA 4FLIA 4ZNGA 4RZYA 5CNXA 1M35A 1MATA 2GZ5A 1YVMA 5E5BA 5D6EA 3PKDA 4RZZA 4FKCA 4PV4A 2GG3A 4IKRA 2BB7A 5CDEA 1WLRA 1R5GA 2GU4A 1A16A 1PV9A 2BWWA 2GGCA 2BWSA 3FMRA 3S6BA 2Q8KA 4U6CA 4FLJA 3PKEA 2BH3A 1R58A 4U6WA 2ADUA 2EVMA 2V3XA 3IU9A 3PKBA 3MX6A 5FCHA 3IU8A 4PNCA 2GU6A 2BWUA 2GG2A 2OKNA 2EVCA 1YW7A 3CB5A 3MATA 2GA2A 1N51A 4IKUA 3BIQA 4FO7A 1W2MA 2EA2A 4IU6A 2B3HA 4A6VA 3FM3A 1WKMA 1WBQA 2BHCA 2G6PA 4U6EA 3FMQA 2HOWA 5CIKA 1YW8A 2V3ZA 2GTXA 1BOAA 2V6CA 1XGSA 3BIPA 4KM3A 4A6WA 1KQ9A 3L7GA 4U6JA 1O0XA 1WN1A 2GU5A 1C21A 2Q93A 1BN5A 2ZSGA 5CLSA 1W7VA 4ZWUA 1C23A 1YJ3A 2V3YA 4FLLA 2IW2A 4S2RP 1CHMA 2GGBA 4IKTA 3L24A 4U70A 4OOKA 1C27A 1QXZA 4JUQA 1XGMA 1QXYA 2BWTA 3BITA 1XNZA 4IKSA 2NQ7A 2BWYA 1WL9A 1JAWA 1WY2A 4ZWPA 4U75A 4U73A 1KQ0A 2GG9A 2GG7A 1KP0A 4U76A 2DFIA 3MR1A 2Q95A 5CDVA 2GU7A 3CTZA 4IECA 5FCFA 1QXWA 1XGOA 2BN7A 4S2TP 4ZWOA 1WL6A 3TAVA 5D6FA 3RORA 5CE6A 1QZYA 2GG0A 3IU7A 4IPAA 4QR8A 2EA4A 2Q92A 2Q96A 4FLKA 3TB5A 4R60A 1R5HA 4HXXA 1B6AA 2OAZA 4IDYA 2P9AA 2B3KA 2BWXA 4B28A 2GG8A 4RGZ1 4Z7MA 2MATA 4S01A 3PKCA 4U1BA 5JI6A 1Y1NA 2BWVA 3CB6A 4FO8A 4S00A 2EVOA 1YW9A 2BHDA 4FUKA 3IG4A 1C22A 4IF7A 1XGNA
chains in the Genus database with same CATH topology
2NQ6A 1B59A 3D27A 4U71A 2B3LA 3Q6DA 4U69A 2BHBA 3PKAA 1C24A 3RVAA 5CDLA 2BHAA 5JFRA 4EGEA 2P98A 4MATA 4U6ZA 2Q94A 2P99A 2GG5A 5JHUA 4FLIA 4ZNGA 4RZYA 5CNXA 1M35A 1MATA 2GZ5A 1YVMA 5E5BA 5D6EA 3PKDA 4RZZA 4FKCA 4PV4A 2GG3A 4IKRA 2BB7A 5CDEA 1WLRA 1R5GA 2GU4A 1A16A 1PV9A 2BWWA 2GGCA 2BWSA 3FMRA 3S6BA 2Q8KA 4U6CA 4FLJA 3PKEA 2BH3A 1R58A 4U6WA 2ADUA 2EVMA 2V3XA 3IU9A 3PKBA 3MX6A 5FCHA 3IU8A 4PNCA 2GU6A 2BWUA 2GG2A 2OKNA 2EVCA 1YW7A 3CB5A 3MATA 2GA2A 1N51A 4IKUA 3BIQA 4FO7A 1W2MA 2EA2A 4IU6A 2B3HA 4A6VA 3FM3A 1WKMA 1WBQA 2BHCA 2G6PA 4U6EA 3FMQA 2HOWA 5CIKA 1YW8A 2V3ZA 2GTXA 1BOAA 2V6CA 1XGSA 3BIPA 4KM3A 4A6WA 1KQ9A 3L7GA 4U6JA 1O0XA 1WN1A 2GU5A 1C21A 2Q93A 1BN5A 2ZSGA 5CLSA 1W7VA 4ZWUA 1C23A 1YJ3A 2V3YA 4FLLA 2IW2A 4S2RP 1CHMA 2GGBA 4IKTA 3L24A 4U70A 4OOKA 1C27A 1QXZA 4JUQA 1XGMA 1QXYA 2BWTA 3BITA 1XNZA 4IKSA 2NQ7A 2BWYA 1WL9A 1JAWA 1WY2A 4ZWPA 4U75A 4U73A 1KQ0A 2GG9A 2GG7A 1KP0A 4U76A 2DFIA 3MR1A 2Q95A 5CDVA 2GU7A 3CTZA 4IECA 5FCFA 1QXWA 1XGOA 2BN7A 4S2TP 4ZWOA 1WL6A 3TAVA 5D6FA 3RORA 5CE6A 1QZYA 2GG0A 3IU7A 4IPAA 4QR8A 2EA4A 2Q92A 2Q96A 4FLKA 3TB5A 4R60A 1R5HA 4HXXA 1B6AA 2OAZA 4IDYA 2P9AA 2B3KA 2BWXA 4B28A 2GG8A 4RGZ1 4Z7MA 2MATA 4S01A 3PKCA 4U1BA 5JI6A 1Y1NA 2BWVA 3CB6A 4FO8A 4S00A 2EVOA 1YW9A 2BHDA 4FUKA 3IG4A 1C22A 4IF7A 1XGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQ6 A;  1B59 A;  3D27 A;  4U71 A;  2B3L A;  3Q6D A;  4U69 A;  2BHB A;  3PKA A;  1C24 A;  3RVA A;  5CDL A;  2BHA A;  5JFR A;  4EGE A;  2P98 A;  4MAT A;  4U6Z A;  2Q94 A;  2P99 A;  2GG5 A;  5JHU A;  4FLI A;  4ZNG A;  4RZY A;  5CNX A;  1M35 A;  1MAT A;  2GZ5 A;  1YVM A;  5E5B A;  5D6E A;  3PKD A;  4RZZ A;  4FKC A;  4PV4 A;  2GG3 A;  4IKR A;  2BB7 A;  5CDE A;  1WLR A;  1R5G A;  2GU4 A;  1A16 A;  1PV9 A;  2BWW A;  2GGC A;  2BWS A;  3FMR A;  3S6B A;  2Q8K A;  4U6C A;  4FLJ A;  3PKE A;  2BH3 A;  1R58 A;  4U6W A;  2ADU A;  2EVM A;  2V3X A;  3IU9 A;  3PKB A;  3MX6 A;  5FCH A;  3IU8 A;  4PNC A;  2GU6 A;  2BWU A;  2GG2 A;  2OKN A;  2EVC A;  1YW7 A;  3CB5 A;  3MAT A;  2GA2 A;  1N51 A;  4IKU A;  3BIQ A;  4FO7 A;  1W2M A;  2EA2 A;  4IU6 A;  2B3H A;  4A6V A;  3FM3 A;  1WKM A;  1WBQ A;  2BHC A;  2G6P A;  4U6E A;  3FMQ A;  2HOW A;  5CIK A;  1YW8 A;  2V3Z A;  2GTX A;  1BOA A;  2V6C A;  1XGS A;  3BIP A;  4KM3 A;  4A6W A;  1KQ9 A;  3L7G A;  4U6J A;  1O0X A;  1WN1 A;  2GU5 A;  1C21 A;  2Q93 A;  1BN5 A;  2ZSG A;  5CLS A;  1W7V A;  4ZWU A;  1C23 A;  1YJ3 A;  2V3Y A;  4FLL A;  2IW2 A;  4S2R P;  1CHM A;  2GGB A;  4IKT A;  3L24 A;  4U70 A;  4OOK A;  1C27 A;  1QXZ A;  4JUQ A;  1XGM A;  1QXY A;  2BWT A;  3BIT A;  1XNZ A;  4IKS A;  2NQ7 A;  2BWY A;  1WL9 A;  1JAW A;  1WY2 A;  4ZWP A;  4U75 A;  4U73 A;  1KQ0 A;  2GG9 A;  2GG7 A;  1KP0 A;  4U76 A;  2DFI A;  3MR1 A;  2Q95 A;  5CDV A;  2GU7 A;  3CTZ A;  4IEC A;  5FCF A;  1QXW A;  1XGO A;  2BN7 A;  4S2T P;  4ZWO A;  1WL6 A;  3TAV A;  5D6F A;  3ROR A;  5CE6 A;  1QZY A;  2GG0 A;  3IU7 A;  4IPA A;  4QR8 A;  2EA4 A;  2Q92 A;  2Q96 A;  4FLK A;  3TB5 A;  4R60 A;  1R5H A;  4HXX A;  1B6A A;  2OAZ A;  4IDY A;  2P9A A;  2B3K A;  2BWX A;  4B28 A;  2GG8 A;  4RGZ 1;  4Z7M A;  2MAT A;  4S01 A;  3PKC A;  4U1B A;  5JI6 A;  1Y1N A;  2BWV A;  3CB6 A;  4FO8 A;  4S00 A;  2EVO A;  1YW9 A;  2BHD A;  4FUK A;  3IG4 A;  1C22 A;  4IF7 A;  1XGN A; 
#chains in the Genus database with same CATH topology
 2NQ6 A;  1B59 A;  3D27 A;  4U71 A;  2B3L A;  3Q6D A;  4U69 A;  2BHB A;  3PKA A;  1C24 A;  3RVA A;  5CDL A;  2BHA A;  5JFR A;  4EGE A;  2P98 A;  4MAT A;  4U6Z A;  2Q94 A;  2P99 A;  2GG5 A;  5JHU A;  4FLI A;  4ZNG A;  4RZY A;  5CNX A;  1M35 A;  1MAT A;  2GZ5 A;  1YVM A;  5E5B A;  5D6E A;  3PKD A;  4RZZ A;  4FKC A;  4PV4 A;  2GG3 A;  4IKR A;  2BB7 A;  5CDE A;  1WLR A;  1R5G A;  2GU4 A;  1A16 A;  1PV9 A;  2BWW A;  2GGC A;  2BWS A;  3FMR A;  3S6B A;  2Q8K A;  4U6C A;  4FLJ A;  3PKE A;  2BH3 A;  1R58 A;  4U6W A;  2ADU A;  2EVM A;  2V3X A;  3IU9 A;  3PKB A;  3MX6 A;  5FCH A;  3IU8 A;  4PNC A;  2GU6 A;  2BWU A;  2GG2 A;  2OKN A;  2EVC A;  1YW7 A;  3CB5 A;  3MAT A;  2GA2 A;  1N51 A;  4IKU A;  3BIQ A;  4FO7 A;  1W2M A;  2EA2 A;  4IU6 A;  2B3H A;  4A6V A;  3FM3 A;  1WKM A;  1WBQ A;  2BHC A;  2G6P A;  4U6E A;  3FMQ A;  2HOW A;  5CIK A;  1YW8 A;  2V3Z A;  2GTX A;  1BOA A;  2V6C A;  1XGS A;  3BIP A;  4KM3 A;  4A6W A;  1KQ9 A;  3L7G A;  4U6J A;  1O0X A;  1WN1 A;  2GU5 A;  1C21 A;  2Q93 A;  1BN5 A;  2ZSG A;  5CLS A;  1W7V A;  4ZWU A;  1C23 A;  1YJ3 A;  2V3Y A;  4FLL A;  2IW2 A;  4S2R P;  1CHM A;  2GGB A;  4IKT A;  3L24 A;  4U70 A;  4OOK A;  1C27 A;  1QXZ A;  4JUQ A;  1XGM A;  1QXY A;  2BWT A;  3BIT A;  1XNZ A;  4IKS A;  2NQ7 A;  2BWY A;  1WL9 A;  1JAW A;  1WY2 A;  4ZWP A;  4U75 A;  4U73 A;  1KQ0 A;  2GG9 A;  2GG7 A;  1KP0 A;  4U76 A;  2DFI A;  3MR1 A;  2Q95 A;  5CDV A;  2GU7 A;  3CTZ A;  4IEC A;  5FCF A;  1QXW A;  1XGO A;  2BN7 A;  4S2T P;  4ZWO A;  1WL6 A;  3TAV A;  5D6F A;  3ROR A;  5CE6 A;  1QZY A;  2GG0 A;  3IU7 A;  4IPA A;  4QR8 A;  2EA4 A;  2Q92 A;  2Q96 A;  4FLK A;  3TB5 A;  4R60 A;  1R5H A;  4HXX A;  1B6A A;  2OAZ A;  4IDY A;  2P9A A;  2B3K A;  2BWX A;  4B28 A;  2GG8 A;  4RGZ 1;  4Z7M A;  2MAT A;  4S01 A;  3PKC A;  4U1B A;  5JI6 A;  1Y1N A;  2BWV A;  3CB6 A;  4FO8 A;  4S00 A;  2EVO A;  1YW9 A;  2BHD A;  4FUK A;  3IG4 A;  1C22 A;  4IF7 A;  1XGN A; 
#chains in the Genus database with same CATH homology
 2NQ6 A;  1B59 A;  3D27 A;  4U71 A;  2B3L A;  3Q6D A;  4U69 A;  2BHB A;  3PKA A;  1C24 A;  3RVA A;  5CDL A;  2BHA A;  5JFR A;  4EGE A;  2P98 A;  4MAT A;  4U6Z A;  2Q94 A;  2P99 A;  2GG5 A;  5JHU A;  4FLI A;  4ZNG A;  4RZY A;  5CNX A;  1M35 A;  1MAT A;  2GZ5 A;  1YVM A;  5E5B A;  5D6E A;  3PKD A;  4RZZ A;  4FKC A;  4PV4 A;  2GG3 A;  4IKR A;  2BB7 A;  5CDE A;  1WLR A;  1R5G A;  2GU4 A;  1A16 A;  1PV9 A;  2BWW A;  2GGC A;  2BWS A;  3FMR A;  3S6B A;  2Q8K A;  4U6C A;  4FLJ A;  3PKE A;  2BH3 A;  1R58 A;  4U6W A;  2ADU A;  2EVM A;  2V3X A;  3IU9 A;  3PKB A;  3MX6 A;  5FCH A;  3IU8 A;  4PNC A;  2GU6 A;  2BWU A;  2GG2 A;  2OKN A;  2EVC A;  1YW7 A;  3CB5 A;  3MAT A;  2GA2 A;  1N51 A;  4IKU A;  3BIQ A;  4FO7 A;  1W2M A;  2EA2 A;  4IU6 A;  2B3H A;  4A6V A;  3FM3 A;  1WKM A;  1WBQ A;  2BHC A;  2G6P A;  4U6E A;  3FMQ A;  2HOW A;  5CIK A;  1YW8 A;  2V3Z A;  2GTX A;  1BOA A;  2V6C A;  1XGS A;  3BIP A;  4KM3 A;  4A6W A;  1KQ9 A;  3L7G A;  4U6J A;  1O0X A;  1WN1 A;  2GU5 A;  1C21 A;  2Q93 A;  1BN5 A;  2ZSG A;  5CLS A;  1W7V A;  4ZWU A;  1C23 A;  1YJ3 A;  2V3Y A;  4FLL A;  2IW2 A;  4S2R P;  1CHM A;  2GGB A;  4IKT A;  3L24 A;  4U70 A;  4OOK A;  1C27 A;  1QXZ A;  4JUQ A;  1XGM A;  1QXY A;  2BWT A;  3BIT A;  1XNZ A;  4IKS A;  2NQ7 A;  2BWY A;  1WL9 A;  1JAW A;  1WY2 A;  4ZWP A;  4U75 A;  4U73 A;  1KQ0 A;  2GG9 A;  2GG7 A;  1KP0 A;  4U76 A;  2DFI A;  3MR1 A;  2Q95 A;  5CDV A;  2GU7 A;  3CTZ A;  4IEC A;  5FCF A;  1QXW A;  1XGO A;  2BN7 A;  4S2T P;  4ZWO A;  1WL6 A;  3TAV A;  5D6F A;  3ROR A;  5CE6 A;  1QZY A;  2GG0 A;  3IU7 A;  4IPA A;  4QR8 A;  2EA4 A;  2Q92 A;  2Q96 A;  4FLK A;  3TB5 A;  4R60 A;  1R5H A;  4HXX A;  1B6A A;  2OAZ A;  4IDY A;  2P9A A;  2B3K A;  2BWX A;  4B28 A;  2GG8 A;  4RGZ 1;  4Z7M A;  2MAT A;  4S01 A;  3PKC A;  4U1B A;  5JI6 A;  1Y1N A;  2BWV A;  3CB6 A;  4FO8 A;  4S00 A;  2EVO A;  1YW9 A;  2BHD A;  4FUK A;  3IG4 A;  1C22 A;  4IF7 A;  1XGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...