1QXWA

Crystal structure of staphyloccocus aureus in complex with an aminoketone inhibitor 54135.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methionyl aminopeptidase
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 82
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxwA00
1C21A 4U6EA 5FCFA 2B3LA 3BITA 1QXZA 2Q96A 3FMRA 1B6AA 2BWXA 4MATA 4RZYA 4ZWOA 2BWTA 4QR8A 2B3HA 4S2RP 3S6BA 4FUKA 2EA4A 2EVMA 1KQ0A 1BN5A 4IKSA 4U73A 3CB6A 2BHCA 1N51A 2MATA 3TB5A 2P99A 4IECA 5JHUA 1QZYA 2G6PA 4U1BA 1YW7A 1WKMA 3BIQA 3BIPA 1WBQA 3MATA 5CIKA 4A6VA 2ZSGA 1R5HA 5CLSA 2Q8KA 2HOWA 4U6WA 2V6CA 4U71A 1YW9A 2BWSA 2BWVA 3L24A 1O0XA 4IDYA 3TAVA 2GA2A 2P98A 4PV4A 4OOKA 5E5BA 3PKBA 2Q92A 3PKCA 2Q94A 2BWYA 4IF7A 2BHDA 3MR1A 1A16A 1W7VA 1BOAA 3L7GA 2BN7A 2GG9A 3Q6DA 2GG3A 2GG8A 2GU4A 4U6ZA 5CDLA 3IU7A 4JUQA 5CE6A 4RZZA 1WLRA 2EVOA 3IG4A 1C24A 1WL6A 4FO8A 5D6FA 4U76A 2BH3A 4ZWPA 4ZWUA 1C23A 2GG2A 4U75A 1JAWA 2GGBA 2DFIA 4FLJA 4U6JA 4FO7A 4IKUA 5JI6A 2ADUA 1YVMA 1Y1NA 1KQ9A 2IW2A 4B28A 4S00A 1R5GA 1MATA 4ZNGA 3CTZA 4FLLA 4FLKA 2BHAA 2Q95A 3IU8A 4FLIA 1CHMA 2GTXA 1M35A 3MX6A 2NQ7A 5CDEA 4U6CA 3PKEA 1XGOA 2V3YA 2BHBA 1YJ3A 1QXWA 2GG5A 2V3ZA 2EVCA 3CB5A 4IKTA 2GU6A 2BWUA 1B59A 1QXYA 4HXXA 4KM3A 5D6EA 5FCHA 3D27A 1YW8A 2NQ6A 2B3KA 4PNCA 4S2TP 4RGZ1 2EA2A 2GG7A 1XNZA 2GG0A 4IPAA 4IU6A 1C27A 1XGNA 2P9AA 3IU9A 5JFRA 1WN1A 4U69A 3PKDA 5CDVA 1WL9A 3PKAA 3FM3A 1PV9A 3RORA 3RVAA 1W2MA 1KP0A 4A6WA 4Z7MA 2GU7A 4FKCA 1WY2A 1R58A 2GGCA 4EGEA 1XGMA 2OAZA 4R60A 5CNXA 3FMQA 2OKNA 1C22A 4U70A 4S01A 2GZ5A 4IKRA 2V3XA 2BB7A 1XGSA 2GU5A 2Q93A 2BWWA
chains in the Genus database with same CATH superfamily
1C21A 4U6EA 5FCFA 2B3LA 3BITA 1QXZA 2Q96A 3FMRA 1B6AA 2BWXA 4MATA 4RZYA 4ZWOA 2BWTA 4QR8A 2B3HA 4S2RP 3S6BA 4FUKA 2EA4A 2EVMA 1KQ0A 1BN5A 4IKSA 4U73A 3CB6A 2BHCA 1N51A 2MATA 3TB5A 2P99A 4IECA 5JHUA 1QZYA 2G6PA 4U1BA 1YW7A 1WKMA 3BIQA 3BIPA 1WBQA 3MATA 5CIKA 4A6VA 2ZSGA 1R5HA 5CLSA 2Q8KA 2HOWA 4U6WA 2V6CA 4U71A 1YW9A 2BWSA 2BWVA 3L24A 1O0XA 4IDYA 3TAVA 2GA2A 2P98A 4PV4A 4OOKA 5E5BA 3PKBA 2Q92A 3PKCA 2Q94A 2BWYA 4IF7A 2BHDA 3MR1A 1A16A 1W7VA 1BOAA 3L7GA 2BN7A 2GG9A 3Q6DA 2GG3A 2GG8A 2GU4A 4U6ZA 5CDLA 3IU7A 4JUQA 5CE6A 4RZZA 1WLRA 2EVOA 3IG4A 1C24A 1WL6A 4FO8A 5D6FA 4U76A 2BH3A 4ZWPA 4ZWUA 1C23A 2GG2A 4U75A 1JAWA 2GGBA 2DFIA 4FLJA 4U6JA 4FO7A 4IKUA 5JI6A 2ADUA 1YVMA 1Y1NA 1KQ9A 2IW2A 4B28A 4S00A 1R5GA 1MATA 4ZNGA 3CTZA 4FLLA 4FLKA 2BHAA 2Q95A 3IU8A 4FLIA 1CHMA 2GTXA 1M35A 3MX6A 2NQ7A 5CDEA 4U6CA 3PKEA 1XGOA 2V3YA 2BHBA 1YJ3A 1QXWA 2GG5A 2V3ZA 2EVCA 3CB5A 4IKTA 2GU6A 2BWUA 1B59A 1QXYA 4HXXA 4KM3A 5D6EA 5FCHA 3D27A 1YW8A 2NQ6A 2B3KA 4PNCA 4S2TP 4RGZ1 2EA2A 2GG7A 1XNZA 2GG0A 4IPAA 4IU6A 1C27A 1XGNA 2P9AA 3IU9A 5JFRA 1WN1A 4U69A 3PKDA 5CDVA 1WL9A 3PKAA 3FM3A 1PV9A 3RORA 3RVAA 1W2MA 1KP0A 4A6WA 4Z7MA 2GU7A 4FKCA 1WY2A 1R58A 2GGCA 4EGEA 1XGMA 2OAZA 4R60A 5CNXA 3FMQA 2OKNA 1C22A 4U70A 4S01A 2GZ5A 4IKRA 2V3XA 2BB7A 1XGSA 2GU5A 2Q93A 2BWWA
chains in the Genus database with same CATH topology
1C21A 4U6EA 5FCFA 2B3LA 3BITA 1QXZA 2Q96A 3FMRA 1B6AA 2BWXA 4MATA 4RZYA 4ZWOA 2BWTA 4QR8A 2B3HA 4S2RP 3S6BA 4FUKA 2EA4A 2EVMA 1KQ0A 1BN5A 4IKSA 4U73A 3CB6A 2BHCA 1N51A 2MATA 3TB5A 2P99A 4IECA 5JHUA 1QZYA 2G6PA 4U1BA 1YW7A 1WKMA 3BIQA 3BIPA 1WBQA 3MATA 5CIKA 4A6VA 2ZSGA 1R5HA 5CLSA 2Q8KA 2HOWA 4U6WA 2V6CA 4U71A 1YW9A 2BWSA 2BWVA 3L24A 1O0XA 4IDYA 3TAVA 2GA2A 2P98A 4PV4A 4OOKA 5E5BA 3PKBA 2Q92A 3PKCA 2Q94A 2BWYA 4IF7A 2BHDA 3MR1A 1A16A 1W7VA 1BOAA 3L7GA 2BN7A 2GG9A 3Q6DA 2GG3A 2GG8A 2GU4A 4U6ZA 5CDLA 3IU7A 4JUQA 5CE6A 4RZZA 1WLRA 2EVOA 3IG4A 1C24A 1WL6A 4FO8A 5D6FA 4U76A 2BH3A 4ZWPA 4ZWUA 1C23A 2GG2A 4U75A 1JAWA 2GGBA 2DFIA 4FLJA 4U6JA 4FO7A 4IKUA 5JI6A 2ADUA 1YVMA 1Y1NA 1KQ9A 2IW2A 4B28A 4S00A 1R5GA 1MATA 4ZNGA 3CTZA 4FLLA 4FLKA 2BHAA 2Q95A 3IU8A 4FLIA 1CHMA 2GTXA 1M35A 3MX6A 2NQ7A 5CDEA 4U6CA 3PKEA 1XGOA 2V3YA 2BHBA 1YJ3A 1QXWA 2GG5A 2V3ZA 2EVCA 3CB5A 4IKTA 2GU6A 2BWUA 1B59A 1QXYA 4HXXA 4KM3A 5D6EA 5FCHA 3D27A 1YW8A 2NQ6A 2B3KA 4PNCA 4S2TP 4RGZ1 2EA2A 2GG7A 1XNZA 2GG0A 4IPAA 4IU6A 1C27A 1XGNA 2P9AA 3IU9A 5JFRA 1WN1A 4U69A 3PKDA 5CDVA 1WL9A 3PKAA 3FM3A 1PV9A 3RORA 3RVAA 1W2MA 1KP0A 4A6WA 4Z7MA 2GU7A 4FKCA 1WY2A 1R58A 2GGCA 4EGEA 1XGMA 2OAZA 4R60A 5CNXA 3FMQA 2OKNA 1C22A 4U70A 4S01A 2GZ5A 4IKRA 2V3XA 2BB7A 1XGSA 2GU5A 2Q93A 2BWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C21 A;  4U6E A;  5FCF A;  2B3L A;  3BIT A;  1QXZ A;  2Q96 A;  3FMR A;  1B6A A;  2BWX A;  4MAT A;  4RZY A;  4ZWO A;  2BWT A;  4QR8 A;  2B3H A;  4S2R P;  3S6B A;  4FUK A;  2EA4 A;  2EVM A;  1KQ0 A;  1BN5 A;  4IKS A;  4U73 A;  3CB6 A;  2BHC A;  1N51 A;  2MAT A;  3TB5 A;  2P99 A;  4IEC A;  5JHU A;  1QZY A;  2G6P A;  4U1B A;  1YW7 A;  1WKM A;  3BIQ A;  3BIP A;  1WBQ A;  3MAT A;  5CIK A;  4A6V A;  2ZSG A;  1R5H A;  5CLS A;  2Q8K A;  2HOW A;  4U6W A;  2V6C A;  4U71 A;  1YW9 A;  2BWS A;  2BWV A;  3L24 A;  1O0X A;  4IDY A;  3TAV A;  2GA2 A;  2P98 A;  4PV4 A;  4OOK A;  5E5B A;  3PKB A;  2Q92 A;  3PKC A;  2Q94 A;  2BWY A;  4IF7 A;  2BHD A;  3MR1 A;  1A16 A;  1W7V A;  1BOA A;  3L7G A;  2BN7 A;  2GG9 A;  3Q6D A;  2GG3 A;  2GG8 A;  2GU4 A;  4U6Z A;  5CDL A;  3IU7 A;  4JUQ A;  5CE6 A;  4RZZ A;  1WLR A;  2EVO A;  3IG4 A;  1C24 A;  1WL6 A;  4FO8 A;  5D6F A;  4U76 A;  2BH3 A;  4ZWP A;  4ZWU A;  1C23 A;  2GG2 A;  4U75 A;  1JAW A;  2GGB A;  2DFI A;  4FLJ A;  4U6J A;  4FO7 A;  4IKU A;  5JI6 A;  2ADU A;  1YVM A;  1Y1N A;  1KQ9 A;  2IW2 A;  4B28 A;  4S00 A;  1R5G A;  1MAT A;  4ZNG A;  3CTZ A;  4FLL A;  4FLK A;  2BHA A;  2Q95 A;  3IU8 A;  4FLI A;  1CHM A;  2GTX A;  1M35 A;  3MX6 A;  2NQ7 A;  5CDE A;  4U6C A;  3PKE A;  1XGO A;  2V3Y A;  2BHB A;  1YJ3 A;  1QXW A;  2GG5 A;  2V3Z A;  2EVC A;  3CB5 A;  4IKT A;  2GU6 A;  2BWU A;  1B59 A;  1QXY A;  4HXX A;  4KM3 A;  5D6E A;  5FCH A;  3D27 A;  1YW8 A;  2NQ6 A;  2B3K A;  4PNC A;  4S2T P;  4RGZ 1;  2EA2 A;  2GG7 A;  1XNZ A;  2GG0 A;  4IPA A;  4IU6 A;  1C27 A;  1XGN A;  2P9A A;  3IU9 A;  5JFR A;  1WN1 A;  4U69 A;  3PKD A;  5CDV A;  1WL9 A;  3PKA A;  3FM3 A;  1PV9 A;  3ROR A;  3RVA A;  1W2M A;  1KP0 A;  4A6W A;  4Z7M A;  2GU7 A;  4FKC A;  1WY2 A;  1R58 A;  2GGC A;  4EGE A;  1XGM A;  2OAZ A;  4R60 A;  5CNX A;  3FMQ A;  2OKN A;  1C22 A;  4U70 A;  4S01 A;  2GZ5 A;  4IKR A;  2V3X A;  2BB7 A;  1XGS A;  2GU5 A;  2Q93 A;  2BWW A; 
#chains in the Genus database with same CATH topology
 1C21 A;  4U6E A;  5FCF A;  2B3L A;  3BIT A;  1QXZ A;  2Q96 A;  3FMR A;  1B6A A;  2BWX A;  4MAT A;  4RZY A;  4ZWO A;  2BWT A;  4QR8 A;  2B3H A;  4S2R P;  3S6B A;  4FUK A;  2EA4 A;  2EVM A;  1KQ0 A;  1BN5 A;  4IKS A;  4U73 A;  3CB6 A;  2BHC A;  1N51 A;  2MAT A;  3TB5 A;  2P99 A;  4IEC A;  5JHU A;  1QZY A;  2G6P A;  4U1B A;  1YW7 A;  1WKM A;  3BIQ A;  3BIP A;  1WBQ A;  3MAT A;  5CIK A;  4A6V A;  2ZSG A;  1R5H A;  5CLS A;  2Q8K A;  2HOW A;  4U6W A;  2V6C A;  4U71 A;  1YW9 A;  2BWS A;  2BWV A;  3L24 A;  1O0X A;  4IDY A;  3TAV A;  2GA2 A;  2P98 A;  4PV4 A;  4OOK A;  5E5B A;  3PKB A;  2Q92 A;  3PKC A;  2Q94 A;  2BWY A;  4IF7 A;  2BHD A;  3MR1 A;  1A16 A;  1W7V A;  1BOA A;  3L7G A;  2BN7 A;  2GG9 A;  3Q6D A;  2GG3 A;  2GG8 A;  2GU4 A;  4U6Z A;  5CDL A;  3IU7 A;  4JUQ A;  5CE6 A;  4RZZ A;  1WLR A;  2EVO A;  3IG4 A;  1C24 A;  1WL6 A;  4FO8 A;  5D6F A;  4U76 A;  2BH3 A;  4ZWP A;  4ZWU A;  1C23 A;  2GG2 A;  4U75 A;  1JAW A;  2GGB A;  2DFI A;  4FLJ A;  4U6J A;  4FO7 A;  4IKU A;  5JI6 A;  2ADU A;  1YVM A;  1Y1N A;  1KQ9 A;  2IW2 A;  4B28 A;  4S00 A;  1R5G A;  1MAT A;  4ZNG A;  3CTZ A;  4FLL A;  4FLK A;  2BHA A;  2Q95 A;  3IU8 A;  4FLI A;  1CHM A;  2GTX A;  1M35 A;  3MX6 A;  2NQ7 A;  5CDE A;  4U6C A;  3PKE A;  1XGO A;  2V3Y A;  2BHB A;  1YJ3 A;  1QXW A;  2GG5 A;  2V3Z A;  2EVC A;  3CB5 A;  4IKT A;  2GU6 A;  2BWU A;  1B59 A;  1QXY A;  4HXX A;  4KM3 A;  5D6E A;  5FCH A;  3D27 A;  1YW8 A;  2NQ6 A;  2B3K A;  4PNC A;  4S2T P;  4RGZ 1;  2EA2 A;  2GG7 A;  1XNZ A;  2GG0 A;  4IPA A;  4IU6 A;  1C27 A;  1XGN A;  2P9A A;  3IU9 A;  5JFR A;  1WN1 A;  4U69 A;  3PKD A;  5CDV A;  1WL9 A;  3PKA A;  3FM3 A;  1PV9 A;  3ROR A;  3RVA A;  1W2M A;  1KP0 A;  4A6W A;  4Z7M A;  2GU7 A;  4FKC A;  1WY2 A;  1R58 A;  2GGC A;  4EGE A;  1XGM A;  2OAZ A;  4R60 A;  5CNX A;  3FMQ A;  2OKN A;  1C22 A;  4U70 A;  4S01 A;  2GZ5 A;  4IKR A;  2V3X A;  2BB7 A;  1XGS A;  2GU5 A;  2Q93 A;  2BWW A; 
#chains in the Genus database with same CATH homology
 1C21 A;  4U6E A;  5FCF A;  2B3L A;  3BIT A;  1QXZ A;  2Q96 A;  3FMR A;  1B6A A;  2BWX A;  4MAT A;  4RZY A;  4ZWO A;  2BWT A;  4QR8 A;  2B3H A;  4S2R P;  3S6B A;  4FUK A;  2EA4 A;  2EVM A;  1KQ0 A;  1BN5 A;  4IKS A;  4U73 A;  3CB6 A;  2BHC A;  1N51 A;  2MAT A;  3TB5 A;  2P99 A;  4IEC A;  5JHU A;  1QZY A;  2G6P A;  4U1B A;  1YW7 A;  1WKM A;  3BIQ A;  3BIP A;  1WBQ A;  3MAT A;  5CIK A;  4A6V A;  2ZSG A;  1R5H A;  5CLS A;  2Q8K A;  2HOW A;  4U6W A;  2V6C A;  4U71 A;  1YW9 A;  2BWS A;  2BWV A;  3L24 A;  1O0X A;  4IDY A;  3TAV A;  2GA2 A;  2P98 A;  4PV4 A;  4OOK A;  5E5B A;  3PKB A;  2Q92 A;  3PKC A;  2Q94 A;  2BWY A;  4IF7 A;  2BHD A;  3MR1 A;  1A16 A;  1W7V A;  1BOA A;  3L7G A;  2BN7 A;  2GG9 A;  3Q6D A;  2GG3 A;  2GG8 A;  2GU4 A;  4U6Z A;  5CDL A;  3IU7 A;  4JUQ A;  5CE6 A;  4RZZ A;  1WLR A;  2EVO A;  3IG4 A;  1C24 A;  1WL6 A;  4FO8 A;  5D6F A;  4U76 A;  2BH3 A;  4ZWP A;  4ZWU A;  1C23 A;  2GG2 A;  4U75 A;  1JAW A;  2GGB A;  2DFI A;  4FLJ A;  4U6J A;  4FO7 A;  4IKU A;  5JI6 A;  2ADU A;  1YVM A;  1Y1N A;  1KQ9 A;  2IW2 A;  4B28 A;  4S00 A;  1R5G A;  1MAT A;  4ZNG A;  3CTZ A;  4FLL A;  4FLK A;  2BHA A;  2Q95 A;  3IU8 A;  4FLI A;  1CHM A;  2GTX A;  1M35 A;  3MX6 A;  2NQ7 A;  5CDE A;  4U6C A;  3PKE A;  1XGO A;  2V3Y A;  2BHB A;  1YJ3 A;  1QXW A;  2GG5 A;  2V3Z A;  2EVC A;  3CB5 A;  4IKT A;  2GU6 A;  2BWU A;  1B59 A;  1QXY A;  4HXX A;  4KM3 A;  5D6E A;  5FCH A;  3D27 A;  1YW8 A;  2NQ6 A;  2B3K A;  4PNC A;  4S2T P;  4RGZ 1;  2EA2 A;  2GG7 A;  1XNZ A;  2GG0 A;  4IPA A;  4IU6 A;  1C27 A;  1XGN A;  2P9A A;  3IU9 A;  5JFR A;  1WN1 A;  4U69 A;  3PKD A;  5CDV A;  1WL9 A;  3PKA A;  3FM3 A;  1PV9 A;  3ROR A;  3RVA A;  1W2M A;  1KP0 A;  4A6W A;  4Z7M A;  2GU7 A;  4FKC A;  1WY2 A;  1R58 A;  2GGC A;  4EGE A;  1XGM A;  2OAZ A;  4R60 A;  5CNX A;  3FMQ A;  2OKN A;  1C22 A;  4U70 A;  4S01 A;  2GZ5 A;  4IKR A;  2V3X A;  2BB7 A;  1XGS A;  2GU5 A;  2Q93 A;  2BWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...