1QXWA

Crystal structure of staphyloccocus aureus in complex with an aminoketone inhibitor 54135.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methionyl aminopeptidase
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 82
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxwA00
1WLRA 4IF7A 2BN7A 4FKCA 1C22A 1XGOA 3BIQA 2BWSA 4FLJA 2NQ6A 2BHAA 3D27A 4FLLA 4EGEA 2EA2A 5CDEA 2BHDA 3TAVA 3PKEA 1YJ3A 1WBQA 1A16A 1YW7A 3RVAA 4Z7MA 3FM3A 1WN1A 1C24A 5E5BA 1N51A 4FUKA 1PV9A 4S01A 2HOWA 2BWVA 3L7GA 3MR1A 4U6WA 1W7VA 2P9AA 2NQ7A 3FMQA 3IG4A 3IU7A 3CB6A 1R5HA 3IU8A 5D6FA 1W2MA 2GGCA 4B28A 4RZZA 2GU6A 3PKBA 2GTXA 4U6ZA 4MATA 5CDLA 4ZWPA 1QZYA 2BH3A 4IECA 5CIKA 4ZWOA 2BB7A 2BWXA 2P98A 4S00A 5JI6A 2Q95A 2OKNA 3FMRA 1R5GA 4IPAA 2EVCA 5JHUA 1YW9A 4U6CA 1KQ9A 4U69A 2GG7A 1QXYA 1BN5A 3BITA 5CNXA 2V3ZA 2V3XA 2Q96A 5FCFA 4IKSA 2DFIA 2BWUA 2GG9A 2EVMA 5JFRA 2OAZA 4IKUA 4FO7A 2GG8A 2V6CA 2GU4A 3PKDA 5CE6A 3IU9A 1XGMA 4IKRA 4ZNGA 4U75A 4A6WA 2BHCA 4U73A 4RGZ1 5CDVA 1B6AA 2G6PA 3CTZA 3L24A 1JAWA 1M35A 1O0XA 4IDYA 4U6EA 3S6BA 2B3KA 5D6EA 5FCHA 1WL9A 2GA2A 2GG3A 2B3LA 4HXXA 1BOAA 4QR8A 2Q8KA 1QXWA 4JUQA 4IU6A 2V3YA 1XGSA 3MX6A 1C21A 2EA4A 2P99A 1YVMA 1Y1NA 1WY2A 1XNZA 4U71A 3Q6DA 1KP0A 4U6JA 2Q93A 3TB5A 3CB5A 2ZSGA 2BWWA 2Q94A 2GZ5A 4ZWUA 4U1BA 4A6VA 1C27A 4U70A 3PKCA 4IKTA 2B3HA 2IW2A 1YW8A 1C23A 2GG2A 2Q92A 3PKAA 1MATA 1XGNA 3BIPA 4OOKA 2GG5A 2GG0A 1WL6A 4PV4A 1B59A 3RORA 4FLKA 2EVOA 1CHMA 2BHBA 4S2TP 3MATA 4R60A 2GU5A 4FLIA 2BWYA 5CLSA 1WKMA 2BWTA 4KM3A 2GU7A 1KQ0A 2GGBA 1R58A 2ADUA 4PNCA 4S2RP 4U76A 1QXZA 4FO8A 2MATA 4RZYA
chains in the Genus database with same CATH superfamily
1WLRA 4IF7A 2BN7A 4FKCA 1C22A 1XGOA 3BIQA 2BWSA 4FLJA 2NQ6A 2BHAA 3D27A 4FLLA 4EGEA 2EA2A 5CDEA 2BHDA 3TAVA 3PKEA 1YJ3A 1WBQA 1A16A 1YW7A 3RVAA 4Z7MA 3FM3A 1WN1A 1C24A 5E5BA 1N51A 4FUKA 1PV9A 4S01A 2HOWA 2BWVA 3L7GA 3MR1A 4U6WA 1W7VA 2P9AA 2NQ7A 3FMQA 3IG4A 3IU7A 3CB6A 1R5HA 3IU8A 5D6FA 1W2MA 2GGCA 4B28A 4RZZA 2GU6A 3PKBA 2GTXA 4U6ZA 4MATA 5CDLA 4ZWPA 1QZYA 2BH3A 4IECA 5CIKA 4ZWOA 2BB7A 2BWXA 2P98A 4S00A 5JI6A 2Q95A 2OKNA 3FMRA 1R5GA 4IPAA 2EVCA 5JHUA 1YW9A 4U6CA 1KQ9A 4U69A 2GG7A 1QXYA 1BN5A 3BITA 5CNXA 2V3ZA 2V3XA 2Q96A 5FCFA 4IKSA 2DFIA 2BWUA 2GG9A 2EVMA 5JFRA 2OAZA 4IKUA 4FO7A 2GG8A 2V6CA 2GU4A 3PKDA 5CE6A 3IU9A 1XGMA 4IKRA 4ZNGA 4U75A 4A6WA 2BHCA 4U73A 4RGZ1 5CDVA 1B6AA 2G6PA 3CTZA 3L24A 1JAWA 1M35A 1O0XA 4IDYA 4U6EA 3S6BA 2B3KA 5D6EA 5FCHA 1WL9A 2GA2A 2GG3A 2B3LA 4HXXA 1BOAA 4QR8A 2Q8KA 1QXWA 4JUQA 4IU6A 2V3YA 1XGSA 3MX6A 1C21A 2EA4A 2P99A 1YVMA 1Y1NA 1WY2A 1XNZA 4U71A 3Q6DA 1KP0A 4U6JA 2Q93A 3TB5A 3CB5A 2ZSGA 2BWWA 2Q94A 2GZ5A 4ZWUA 4U1BA 4A6VA 1C27A 4U70A 3PKCA 4IKTA 2B3HA 2IW2A 1YW8A 1C23A 2GG2A 2Q92A 3PKAA 1MATA 1XGNA 3BIPA 4OOKA 2GG5A 2GG0A 1WL6A 4PV4A 1B59A 3RORA 4FLKA 2EVOA 1CHMA 2BHBA 4S2TP 3MATA 4R60A 2GU5A 4FLIA 2BWYA 5CLSA 1WKMA 2BWTA 4KM3A 2GU7A 1KQ0A 2GGBA 1R58A 2ADUA 4PNCA 4S2RP 4U76A 1QXZA 4FO8A 2MATA 4RZYA
chains in the Genus database with same CATH topology
1WLRA 4IF7A 2BN7A 4FKCA 1C22A 1XGOA 3BIQA 2BWSA 4FLJA 2NQ6A 2BHAA 3D27A 4FLLA 4EGEA 2EA2A 5CDEA 2BHDA 3TAVA 3PKEA 1YJ3A 1WBQA 1A16A 1YW7A 3RVAA 4Z7MA 3FM3A 1WN1A 1C24A 5E5BA 1N51A 4FUKA 1PV9A 4S01A 2HOWA 2BWVA 3L7GA 3MR1A 4U6WA 1W7VA 2P9AA 2NQ7A 3FMQA 3IG4A 3IU7A 3CB6A 1R5HA 3IU8A 5D6FA 1W2MA 2GGCA 4B28A 4RZZA 2GU6A 3PKBA 2GTXA 4U6ZA 4MATA 5CDLA 4ZWPA 1QZYA 2BH3A 4IECA 5CIKA 4ZWOA 2BB7A 2BWXA 2P98A 4S00A 5JI6A 2Q95A 2OKNA 3FMRA 1R5GA 4IPAA 2EVCA 5JHUA 1YW9A 4U6CA 1KQ9A 4U69A 2GG7A 1QXYA 1BN5A 3BITA 5CNXA 2V3ZA 2V3XA 2Q96A 5FCFA 4IKSA 2DFIA 2BWUA 2GG9A 2EVMA 5JFRA 2OAZA 4IKUA 4FO7A 2GG8A 2V6CA 2GU4A 3PKDA 5CE6A 3IU9A 1XGMA 4IKRA 4ZNGA 4U75A 4A6WA 2BHCA 4U73A 4RGZ1 5CDVA 1B6AA 2G6PA 3CTZA 3L24A 1JAWA 1M35A 1O0XA 4IDYA 4U6EA 3S6BA 2B3KA 5D6EA 5FCHA 1WL9A 2GA2A 2GG3A 2B3LA 4HXXA 1BOAA 4QR8A 2Q8KA 1QXWA 4JUQA 4IU6A 2V3YA 1XGSA 3MX6A 1C21A 2EA4A 2P99A 1YVMA 1Y1NA 1WY2A 1XNZA 4U71A 3Q6DA 1KP0A 4U6JA 2Q93A 3TB5A 3CB5A 2ZSGA 2BWWA 2Q94A 2GZ5A 4ZWUA 4U1BA 4A6VA 1C27A 4U70A 3PKCA 4IKTA 2B3HA 2IW2A 1YW8A 1C23A 2GG2A 2Q92A 3PKAA 1MATA 1XGNA 3BIPA 4OOKA 2GG5A 2GG0A 1WL6A 4PV4A 1B59A 3RORA 4FLKA 2EVOA 1CHMA 2BHBA 4S2TP 3MATA 4R60A 2GU5A 4FLIA 2BWYA 5CLSA 1WKMA 2BWTA 4KM3A 2GU7A 1KQ0A 2GGBA 1R58A 2ADUA 4PNCA 4S2RP 4U76A 1QXZA 4FO8A 2MATA 4RZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLR A;  4IF7 A;  2BN7 A;  4FKC A;  1C22 A;  1XGO A;  3BIQ A;  2BWS A;  4FLJ A;  2NQ6 A;  2BHA A;  3D27 A;  4FLL A;  4EGE A;  2EA2 A;  5CDE A;  2BHD A;  3TAV A;  3PKE A;  1YJ3 A;  1WBQ A;  1A16 A;  1YW7 A;  3RVA A;  4Z7M A;  3FM3 A;  1WN1 A;  1C24 A;  5E5B A;  1N51 A;  4FUK A;  1PV9 A;  4S01 A;  2HOW A;  2BWV A;  3L7G A;  3MR1 A;  4U6W A;  1W7V A;  2P9A A;  2NQ7 A;  3FMQ A;  3IG4 A;  3IU7 A;  3CB6 A;  1R5H A;  3IU8 A;  5D6F A;  1W2M A;  2GGC A;  4B28 A;  4RZZ A;  2GU6 A;  3PKB A;  2GTX A;  4U6Z A;  4MAT A;  5CDL A;  4ZWP A;  1QZY A;  2BH3 A;  4IEC A;  5CIK A;  4ZWO A;  2BB7 A;  2BWX A;  2P98 A;  4S00 A;  5JI6 A;  2Q95 A;  2OKN A;  3FMR A;  1R5G A;  4IPA A;  2EVC A;  5JHU A;  1YW9 A;  4U6C A;  1KQ9 A;  4U69 A;  2GG7 A;  1QXY A;  1BN5 A;  3BIT A;  5CNX A;  2V3Z A;  2V3X A;  2Q96 A;  5FCF A;  4IKS A;  2DFI A;  2BWU A;  2GG9 A;  2EVM A;  5JFR A;  2OAZ A;  4IKU A;  4FO7 A;  2GG8 A;  2V6C A;  2GU4 A;  3PKD A;  5CE6 A;  3IU9 A;  1XGM A;  4IKR A;  4ZNG A;  4U75 A;  4A6W A;  2BHC A;  4U73 A;  4RGZ 1;  5CDV A;  1B6A A;  2G6P A;  3CTZ A;  3L24 A;  1JAW A;  1M35 A;  1O0X A;  4IDY A;  4U6E A;  3S6B A;  2B3K A;  5D6E A;  5FCH A;  1WL9 A;  2GA2 A;  2GG3 A;  2B3L A;  4HXX A;  1BOA A;  4QR8 A;  2Q8K A;  1QXW A;  4JUQ A;  4IU6 A;  2V3Y A;  1XGS A;  3MX6 A;  1C21 A;  2EA4 A;  2P99 A;  1YVM A;  1Y1N A;  1WY2 A;  1XNZ A;  4U71 A;  3Q6D A;  1KP0 A;  4U6J A;  2Q93 A;  3TB5 A;  3CB5 A;  2ZSG A;  2BWW A;  2Q94 A;  2GZ5 A;  4ZWU A;  4U1B A;  4A6V A;  1C27 A;  4U70 A;  3PKC A;  4IKT A;  2B3H A;  2IW2 A;  1YW8 A;  1C23 A;  2GG2 A;  2Q92 A;  3PKA A;  1MAT A;  1XGN A;  3BIP A;  4OOK A;  2GG5 A;  2GG0 A;  1WL6 A;  4PV4 A;  1B59 A;  3ROR A;  4FLK A;  2EVO A;  1CHM A;  2BHB A;  4S2T P;  3MAT A;  4R60 A;  2GU5 A;  4FLI A;  2BWY A;  5CLS A;  1WKM A;  2BWT A;  4KM3 A;  2GU7 A;  1KQ0 A;  2GGB A;  1R58 A;  2ADU A;  4PNC A;  4S2R P;  4U76 A;  1QXZ A;  4FO8 A;  2MAT A;  4RZY A; 
#chains in the Genus database with same CATH topology
 1WLR A;  4IF7 A;  2BN7 A;  4FKC A;  1C22 A;  1XGO A;  3BIQ A;  2BWS A;  4FLJ A;  2NQ6 A;  2BHA A;  3D27 A;  4FLL A;  4EGE A;  2EA2 A;  5CDE A;  2BHD A;  3TAV A;  3PKE A;  1YJ3 A;  1WBQ A;  1A16 A;  1YW7 A;  3RVA A;  4Z7M A;  3FM3 A;  1WN1 A;  1C24 A;  5E5B A;  1N51 A;  4FUK A;  1PV9 A;  4S01 A;  2HOW A;  2BWV A;  3L7G A;  3MR1 A;  4U6W A;  1W7V A;  2P9A A;  2NQ7 A;  3FMQ A;  3IG4 A;  3IU7 A;  3CB6 A;  1R5H A;  3IU8 A;  5D6F A;  1W2M A;  2GGC A;  4B28 A;  4RZZ A;  2GU6 A;  3PKB A;  2GTX A;  4U6Z A;  4MAT A;  5CDL A;  4ZWP A;  1QZY A;  2BH3 A;  4IEC A;  5CIK A;  4ZWO A;  2BB7 A;  2BWX A;  2P98 A;  4S00 A;  5JI6 A;  2Q95 A;  2OKN A;  3FMR A;  1R5G A;  4IPA A;  2EVC A;  5JHU A;  1YW9 A;  4U6C A;  1KQ9 A;  4U69 A;  2GG7 A;  1QXY A;  1BN5 A;  3BIT A;  5CNX A;  2V3Z A;  2V3X A;  2Q96 A;  5FCF A;  4IKS A;  2DFI A;  2BWU A;  2GG9 A;  2EVM A;  5JFR A;  2OAZ A;  4IKU A;  4FO7 A;  2GG8 A;  2V6C A;  2GU4 A;  3PKD A;  5CE6 A;  3IU9 A;  1XGM A;  4IKR A;  4ZNG A;  4U75 A;  4A6W A;  2BHC A;  4U73 A;  4RGZ 1;  5CDV A;  1B6A A;  2G6P A;  3CTZ A;  3L24 A;  1JAW A;  1M35 A;  1O0X A;  4IDY A;  4U6E A;  3S6B A;  2B3K A;  5D6E A;  5FCH A;  1WL9 A;  2GA2 A;  2GG3 A;  2B3L A;  4HXX A;  1BOA A;  4QR8 A;  2Q8K A;  1QXW A;  4JUQ A;  4IU6 A;  2V3Y A;  1XGS A;  3MX6 A;  1C21 A;  2EA4 A;  2P99 A;  1YVM A;  1Y1N A;  1WY2 A;  1XNZ A;  4U71 A;  3Q6D A;  1KP0 A;  4U6J A;  2Q93 A;  3TB5 A;  3CB5 A;  2ZSG A;  2BWW A;  2Q94 A;  2GZ5 A;  4ZWU A;  4U1B A;  4A6V A;  1C27 A;  4U70 A;  3PKC A;  4IKT A;  2B3H A;  2IW2 A;  1YW8 A;  1C23 A;  2GG2 A;  2Q92 A;  3PKA A;  1MAT A;  1XGN A;  3BIP A;  4OOK A;  2GG5 A;  2GG0 A;  1WL6 A;  4PV4 A;  1B59 A;  3ROR A;  4FLK A;  2EVO A;  1CHM A;  2BHB A;  4S2T P;  3MAT A;  4R60 A;  2GU5 A;  4FLI A;  2BWY A;  5CLS A;  1WKM A;  2BWT A;  4KM3 A;  2GU7 A;  1KQ0 A;  2GGB A;  1R58 A;  2ADU A;  4PNC A;  4S2R P;  4U76 A;  1QXZ A;  4FO8 A;  2MAT A;  4RZY A; 
#chains in the Genus database with same CATH homology
 1WLR A;  4IF7 A;  2BN7 A;  4FKC A;  1C22 A;  1XGO A;  3BIQ A;  2BWS A;  4FLJ A;  2NQ6 A;  2BHA A;  3D27 A;  4FLL A;  4EGE A;  2EA2 A;  5CDE A;  2BHD A;  3TAV A;  3PKE A;  1YJ3 A;  1WBQ A;  1A16 A;  1YW7 A;  3RVA A;  4Z7M A;  3FM3 A;  1WN1 A;  1C24 A;  5E5B A;  1N51 A;  4FUK A;  1PV9 A;  4S01 A;  2HOW A;  2BWV A;  3L7G A;  3MR1 A;  4U6W A;  1W7V A;  2P9A A;  2NQ7 A;  3FMQ A;  3IG4 A;  3IU7 A;  3CB6 A;  1R5H A;  3IU8 A;  5D6F A;  1W2M A;  2GGC A;  4B28 A;  4RZZ A;  2GU6 A;  3PKB A;  2GTX A;  4U6Z A;  4MAT A;  5CDL A;  4ZWP A;  1QZY A;  2BH3 A;  4IEC A;  5CIK A;  4ZWO A;  2BB7 A;  2BWX A;  2P98 A;  4S00 A;  5JI6 A;  2Q95 A;  2OKN A;  3FMR A;  1R5G A;  4IPA A;  2EVC A;  5JHU A;  1YW9 A;  4U6C A;  1KQ9 A;  4U69 A;  2GG7 A;  1QXY A;  1BN5 A;  3BIT A;  5CNX A;  2V3Z A;  2V3X A;  2Q96 A;  5FCF A;  4IKS A;  2DFI A;  2BWU A;  2GG9 A;  2EVM A;  5JFR A;  2OAZ A;  4IKU A;  4FO7 A;  2GG8 A;  2V6C A;  2GU4 A;  3PKD A;  5CE6 A;  3IU9 A;  1XGM A;  4IKR A;  4ZNG A;  4U75 A;  4A6W A;  2BHC A;  4U73 A;  4RGZ 1;  5CDV A;  1B6A A;  2G6P A;  3CTZ A;  3L24 A;  1JAW A;  1M35 A;  1O0X A;  4IDY A;  4U6E A;  3S6B A;  2B3K A;  5D6E A;  5FCH A;  1WL9 A;  2GA2 A;  2GG3 A;  2B3L A;  4HXX A;  1BOA A;  4QR8 A;  2Q8K A;  1QXW A;  4JUQ A;  4IU6 A;  2V3Y A;  1XGS A;  3MX6 A;  1C21 A;  2EA4 A;  2P99 A;  1YVM A;  1Y1N A;  1WY2 A;  1XNZ A;  4U71 A;  3Q6D A;  1KP0 A;  4U6J A;  2Q93 A;  3TB5 A;  3CB5 A;  2ZSG A;  2BWW A;  2Q94 A;  2GZ5 A;  4ZWU A;  4U1B A;  4A6V A;  1C27 A;  4U70 A;  3PKC A;  4IKT A;  2B3H A;  2IW2 A;  1YW8 A;  1C23 A;  2GG2 A;  2Q92 A;  3PKA A;  1MAT A;  1XGN A;  3BIP A;  4OOK A;  2GG5 A;  2GG0 A;  1WL6 A;  4PV4 A;  1B59 A;  3ROR A;  4FLK A;  2EVO A;  1CHM A;  2BHB A;  4S2T P;  3MAT A;  4R60 A;  2GU5 A;  4FLI A;  2BWY A;  5CLS A;  1WKM A;  2BWT A;  4KM3 A;  2GU7 A;  1KQ0 A;  2GGB A;  1R58 A;  2ADU A;  4PNC A;  4S2R P;  4U76 A;  1QXZ A;  4FO8 A;  2MAT A;  4RZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...