2GZ5A

Human type 1 methionine aminopeptidase in complex with ovalicin at 1.1 ang
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structure of the angiogenesis inhibitor ovalicin bound to its noncognate target, human Type 1 methionine aminopeptidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gz5A00
4QR8A 2GG7A 2B3HA 5CDEA 3FM3A 5JI6A 1KP0A 3PKBA 2MATA 2Q96A 3PKCA 4IPAA 1A16A 1XGOA 2BWWA 1BOAA 2EVMA 3CTZA 4FO7A 3Q6DA 1R58A 2GG5A 3IU8A 4EGEA 1XNZA 2OKNA 2DFIA 2EVCA 2GU4A 5CDVA 2BHCA 4U6WA 4IKUA 1R5GA 4FKCA 1WL9A 1WL6A 1B6AA 3L24A 5CIKA 2BHAA 2GGBA 4JUQA 3L7GA 5FCFA 1W2MA 5D6FA 4U6ZA 4A6WA 2EVOA 2NQ7A 4OOKA 4U6CA 3TAVA 4S2TP 3IU9A 1O0XA 2EA4A 2GGCA 2Q95A 4FUKA 5JFRA 2GZ5A 2BB7A 5JHUA 1QXWA 2V6CA 3IU7A 4IKSA 1C27A 4U6JA 3RORA 2BWSA 2Q92A 2BWXA 3TB5A 4Z7MA 1C24A 2GG3A 2ADUA 2B3KA 2NQ6A 4S01A 1WN1A 1C21A 4U1BA 3MX6A 2Q94A 4IECA 2ZSGA 4IF7A 3S6BA 4FLJA 1B59A 1C22A 2GU6A 1JAWA 1XGSA 2GG0A 1KQ0A 2P99A 3PKAA 3RVAA 1YJ3A 2GTXA 1Y1NA 4U73A 3PKDA 2BWUA 4R60A 3MATA 1WBQA 1YW8A 1XGNA 4IU6A 2BWVA 1WLRA 4ZWPA 1YW7A 1WKMA 1PV9A 4U71A 4ZNGA 4IKTA 5E5BA 2Q8KA 1C23A 5CNXA 4HXXA 2V3XA 2BWYA 4RGZ1 2BHBA 4FLKA 1W7VA 2V3YA 1QXZA 2BWTA 2GG8A 1XGMA 3BITA 2BHDA 1N51A 4ZWOA 3PKEA 4FLIA 1QXYA 2G6PA 5FCHA 2P98A 1BN5A 3FMQA 4FLLA 2P9AA 2GU5A 1R5HA 5D6EA 5CE6A 1YW9A 2BH3A 2GU7A 4U69A 2GA2A 4IKRA 2Q93A 3BIPA 3CB6A 1CHMA 3D27A 4RZZA 4A6VA 2OAZA 3CB5A 4U76A 1QZYA 3FMRA 5CDLA 4U75A 4PNCA 1KQ9A 3IG4A 3MR1A 2EA2A 2IW2A 2HOWA 1M35A 4S00A 4U6EA 3BIQA 4RZYA 2GG9A 2B3LA 4MATA 4PV4A 4FO8A 1WY2A 1YVMA 4U70A 2BN7A 2V3ZA 4KM3A 4IDYA 4B28A 2GG2A 4ZWUA 4S2RP 5CLSA 1MATA
chains in the Genus database with same CATH superfamily
4QR8A 2GG7A 2B3HA 5CDEA 3FM3A 5JI6A 1KP0A 3PKBA 2MATA 2Q96A 3PKCA 4IPAA 1A16A 1XGOA 2BWWA 1BOAA 2EVMA 3CTZA 4FO7A 3Q6DA 1R58A 2GG5A 3IU8A 4EGEA 1XNZA 2OKNA 2DFIA 2EVCA 2GU4A 5CDVA 2BHCA 4U6WA 4IKUA 1R5GA 4FKCA 1WL9A 1WL6A 1B6AA 3L24A 5CIKA 2BHAA 2GGBA 4JUQA 3L7GA 5FCFA 1W2MA 5D6FA 4U6ZA 4A6WA 2EVOA 2NQ7A 4OOKA 4U6CA 3TAVA 4S2TP 3IU9A 1O0XA 2EA4A 2GGCA 2Q95A 4FUKA 5JFRA 2GZ5A 2BB7A 5JHUA 1QXWA 2V6CA 3IU7A 4IKSA 1C27A 4U6JA 3RORA 2BWSA 2Q92A 2BWXA 3TB5A 4Z7MA 1C24A 2GG3A 2ADUA 2B3KA 2NQ6A 4S01A 1WN1A 1C21A 4U1BA 3MX6A 2Q94A 4IECA 2ZSGA 4IF7A 3S6BA 4FLJA 1B59A 1C22A 2GU6A 1JAWA 1XGSA 2GG0A 1KQ0A 2P99A 3PKAA 3RVAA 1YJ3A 2GTXA 1Y1NA 4U73A 3PKDA 2BWUA 4R60A 3MATA 1WBQA 1YW8A 1XGNA 4IU6A 2BWVA 1WLRA 4ZWPA 1YW7A 1WKMA 1PV9A 4U71A 4ZNGA 4IKTA 5E5BA 2Q8KA 1C23A 5CNXA 4HXXA 2V3XA 2BWYA 4RGZ1 2BHBA 4FLKA 1W7VA 2V3YA 1QXZA 2BWTA 2GG8A 1XGMA 3BITA 2BHDA 1N51A 4ZWOA 3PKEA 4FLIA 1QXYA 2G6PA 5FCHA 2P98A 1BN5A 3FMQA 4FLLA 2P9AA 2GU5A 1R5HA 5D6EA 5CE6A 1YW9A 2BH3A 2GU7A 4U69A 2GA2A 4IKRA 2Q93A 3BIPA 3CB6A 1CHMA 3D27A 4RZZA 4A6VA 2OAZA 3CB5A 4U76A 1QZYA 3FMRA 5CDLA 4U75A 4PNCA 1KQ9A 3IG4A 3MR1A 2EA2A 2IW2A 2HOWA 1M35A 4S00A 4U6EA 3BIQA 4RZYA 2GG9A 2B3LA 4MATA 4PV4A 4FO8A 1WY2A 1YVMA 4U70A 2BN7A 2V3ZA 4KM3A 4IDYA 4B28A 2GG2A 4ZWUA 4S2RP 5CLSA 1MATA
chains in the Genus database with same CATH topology
4QR8A 2GG7A 2B3HA 5CDEA 3FM3A 5JI6A 1KP0A 3PKBA 2MATA 2Q96A 3PKCA 4IPAA 1A16A 1XGOA 2BWWA 1BOAA 2EVMA 3CTZA 4FO7A 3Q6DA 1R58A 2GG5A 3IU8A 4EGEA 1XNZA 2OKNA 2DFIA 2EVCA 2GU4A 5CDVA 2BHCA 4U6WA 4IKUA 1R5GA 4FKCA 1WL9A 1WL6A 1B6AA 3L24A 5CIKA 2BHAA 2GGBA 4JUQA 3L7GA 5FCFA 1W2MA 5D6FA 4U6ZA 4A6WA 2EVOA 2NQ7A 4OOKA 4U6CA 3TAVA 4S2TP 3IU9A 1O0XA 2EA4A 2GGCA 2Q95A 4FUKA 5JFRA 2GZ5A 2BB7A 5JHUA 1QXWA 2V6CA 3IU7A 4IKSA 1C27A 4U6JA 3RORA 2BWSA 2Q92A 2BWXA 3TB5A 4Z7MA 1C24A 2GG3A 2ADUA 2B3KA 2NQ6A 4S01A 1WN1A 1C21A 4U1BA 3MX6A 2Q94A 4IECA 2ZSGA 4IF7A 3S6BA 4FLJA 1B59A 1C22A 2GU6A 1JAWA 1XGSA 2GG0A 1KQ0A 2P99A 3PKAA 3RVAA 1YJ3A 2GTXA 1Y1NA 4U73A 3PKDA 2BWUA 4R60A 3MATA 1WBQA 1YW8A 1XGNA 4IU6A 2BWVA 1WLRA 4ZWPA 1YW7A 1WKMA 1PV9A 4U71A 4ZNGA 4IKTA 5E5BA 2Q8KA 1C23A 5CNXA 4HXXA 2V3XA 2BWYA 4RGZ1 2BHBA 4FLKA 1W7VA 2V3YA 1QXZA 2BWTA 2GG8A 1XGMA 3BITA 2BHDA 1N51A 4ZWOA 3PKEA 4FLIA 1QXYA 2G6PA 5FCHA 2P98A 1BN5A 3FMQA 4FLLA 2P9AA 2GU5A 1R5HA 5D6EA 5CE6A 1YW9A 2BH3A 2GU7A 4U69A 2GA2A 4IKRA 2Q93A 3BIPA 3CB6A 1CHMA 3D27A 4RZZA 4A6VA 2OAZA 3CB5A 4U76A 1QZYA 3FMRA 5CDLA 4U75A 4PNCA 1KQ9A 3IG4A 3MR1A 2EA2A 2IW2A 2HOWA 1M35A 4S00A 4U6EA 3BIQA 4RZYA 2GG9A 2B3LA 4MATA 4PV4A 4FO8A 1WY2A 1YVMA 4U70A 2BN7A 2V3ZA 4KM3A 4IDYA 4B28A 2GG2A 4ZWUA 4S2RP 5CLSA 1MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QR8 A;  2GG7 A;  2B3H A;  5CDE A;  3FM3 A;  5JI6 A;  1KP0 A;  3PKB A;  2MAT A;  2Q96 A;  3PKC A;  4IPA A;  1A16 A;  1XGO A;  2BWW A;  1BOA A;  2EVM A;  3CTZ A;  4FO7 A;  3Q6D A;  1R58 A;  2GG5 A;  3IU8 A;  4EGE A;  1XNZ A;  2OKN A;  2DFI A;  2EVC A;  2GU4 A;  5CDV A;  2BHC A;  4U6W A;  4IKU A;  1R5G A;  4FKC A;  1WL9 A;  1WL6 A;  1B6A A;  3L24 A;  5CIK A;  2BHA A;  2GGB A;  4JUQ A;  3L7G A;  5FCF A;  1W2M A;  5D6F A;  4U6Z A;  4A6W A;  2EVO A;  2NQ7 A;  4OOK A;  4U6C A;  3TAV A;  4S2T P;  3IU9 A;  1O0X A;  2EA4 A;  2GGC A;  2Q95 A;  4FUK A;  5JFR A;  2GZ5 A;  2BB7 A;  5JHU A;  1QXW A;  2V6C A;  3IU7 A;  4IKS A;  1C27 A;  4U6J A;  3ROR A;  2BWS A;  2Q92 A;  2BWX A;  3TB5 A;  4Z7M A;  1C24 A;  2GG3 A;  2ADU A;  2B3K A;  2NQ6 A;  4S01 A;  1WN1 A;  1C21 A;  4U1B A;  3MX6 A;  2Q94 A;  4IEC A;  2ZSG A;  4IF7 A;  3S6B A;  4FLJ A;  1B59 A;  1C22 A;  2GU6 A;  1JAW A;  1XGS A;  2GG0 A;  1KQ0 A;  2P99 A;  3PKA A;  3RVA A;  1YJ3 A;  2GTX A;  1Y1N A;  4U73 A;  3PKD A;  2BWU A;  4R60 A;  3MAT A;  1WBQ A;  1YW8 A;  1XGN A;  4IU6 A;  2BWV A;  1WLR A;  4ZWP A;  1YW7 A;  1WKM A;  1PV9 A;  4U71 A;  4ZNG A;  4IKT A;  5E5B A;  2Q8K A;  1C23 A;  5CNX A;  4HXX A;  2V3X A;  2BWY A;  4RGZ 1;  2BHB A;  4FLK A;  1W7V A;  2V3Y A;  1QXZ A;  2BWT A;  2GG8 A;  1XGM A;  3BIT A;  2BHD A;  1N51 A;  4ZWO A;  3PKE A;  4FLI A;  1QXY A;  2G6P A;  5FCH A;  2P98 A;  1BN5 A;  3FMQ A;  4FLL A;  2P9A A;  2GU5 A;  1R5H A;  5D6E A;  5CE6 A;  1YW9 A;  2BH3 A;  2GU7 A;  4U69 A;  2GA2 A;  4IKR A;  2Q93 A;  3BIP A;  3CB6 A;  1CHM A;  3D27 A;  4RZZ A;  4A6V A;  2OAZ A;  3CB5 A;  4U76 A;  1QZY A;  3FMR A;  5CDL A;  4U75 A;  4PNC A;  1KQ9 A;  3IG4 A;  3MR1 A;  2EA2 A;  2IW2 A;  2HOW A;  1M35 A;  4S00 A;  4U6E A;  3BIQ A;  4RZY A;  2GG9 A;  2B3L A;  4MAT A;  4PV4 A;  4FO8 A;  1WY2 A;  1YVM A;  4U70 A;  2BN7 A;  2V3Z A;  4KM3 A;  4IDY A;  4B28 A;  2GG2 A;  4ZWU A;  4S2R P;  5CLS A;  1MAT A; 
#chains in the Genus database with same CATH topology
 4QR8 A;  2GG7 A;  2B3H A;  5CDE A;  3FM3 A;  5JI6 A;  1KP0 A;  3PKB A;  2MAT A;  2Q96 A;  3PKC A;  4IPA A;  1A16 A;  1XGO A;  2BWW A;  1BOA A;  2EVM A;  3CTZ A;  4FO7 A;  3Q6D A;  1R58 A;  2GG5 A;  3IU8 A;  4EGE A;  1XNZ A;  2OKN A;  2DFI A;  2EVC A;  2GU4 A;  5CDV A;  2BHC A;  4U6W A;  4IKU A;  1R5G A;  4FKC A;  1WL9 A;  1WL6 A;  1B6A A;  3L24 A;  5CIK A;  2BHA A;  2GGB A;  4JUQ A;  3L7G A;  5FCF A;  1W2M A;  5D6F A;  4U6Z A;  4A6W A;  2EVO A;  2NQ7 A;  4OOK A;  4U6C A;  3TAV A;  4S2T P;  3IU9 A;  1O0X A;  2EA4 A;  2GGC A;  2Q95 A;  4FUK A;  5JFR A;  2GZ5 A;  2BB7 A;  5JHU A;  1QXW A;  2V6C A;  3IU7 A;  4IKS A;  1C27 A;  4U6J A;  3ROR A;  2BWS A;  2Q92 A;  2BWX A;  3TB5 A;  4Z7M A;  1C24 A;  2GG3 A;  2ADU A;  2B3K A;  2NQ6 A;  4S01 A;  1WN1 A;  1C21 A;  4U1B A;  3MX6 A;  2Q94 A;  4IEC A;  2ZSG A;  4IF7 A;  3S6B A;  4FLJ A;  1B59 A;  1C22 A;  2GU6 A;  1JAW A;  1XGS A;  2GG0 A;  1KQ0 A;  2P99 A;  3PKA A;  3RVA A;  1YJ3 A;  2GTX A;  1Y1N A;  4U73 A;  3PKD A;  2BWU A;  4R60 A;  3MAT A;  1WBQ A;  1YW8 A;  1XGN A;  4IU6 A;  2BWV A;  1WLR A;  4ZWP A;  1YW7 A;  1WKM A;  1PV9 A;  4U71 A;  4ZNG A;  4IKT A;  5E5B A;  2Q8K A;  1C23 A;  5CNX A;  4HXX A;  2V3X A;  2BWY A;  4RGZ 1;  2BHB A;  4FLK A;  1W7V A;  2V3Y A;  1QXZ A;  2BWT A;  2GG8 A;  1XGM A;  3BIT A;  2BHD A;  1N51 A;  4ZWO A;  3PKE A;  4FLI A;  1QXY A;  2G6P A;  5FCH A;  2P98 A;  1BN5 A;  3FMQ A;  4FLL A;  2P9A A;  2GU5 A;  1R5H A;  5D6E A;  5CE6 A;  1YW9 A;  2BH3 A;  2GU7 A;  4U69 A;  2GA2 A;  4IKR A;  2Q93 A;  3BIP A;  3CB6 A;  1CHM A;  3D27 A;  4RZZ A;  4A6V A;  2OAZ A;  3CB5 A;  4U76 A;  1QZY A;  3FMR A;  5CDL A;  4U75 A;  4PNC A;  1KQ9 A;  3IG4 A;  3MR1 A;  2EA2 A;  2IW2 A;  2HOW A;  1M35 A;  4S00 A;  4U6E A;  3BIQ A;  4RZY A;  2GG9 A;  2B3L A;  4MAT A;  4PV4 A;  4FO8 A;  1WY2 A;  1YVM A;  4U70 A;  2BN7 A;  2V3Z A;  4KM3 A;  4IDY A;  4B28 A;  2GG2 A;  4ZWU A;  4S2R P;  5CLS A;  1MAT A; 
#chains in the Genus database with same CATH homology
 4QR8 A;  2GG7 A;  2B3H A;  5CDE A;  3FM3 A;  5JI6 A;  1KP0 A;  3PKB A;  2MAT A;  2Q96 A;  3PKC A;  4IPA A;  1A16 A;  1XGO A;  2BWW A;  1BOA A;  2EVM A;  3CTZ A;  4FO7 A;  3Q6D A;  1R58 A;  2GG5 A;  3IU8 A;  4EGE A;  1XNZ A;  2OKN A;  2DFI A;  2EVC A;  2GU4 A;  5CDV A;  2BHC A;  4U6W A;  4IKU A;  1R5G A;  4FKC A;  1WL9 A;  1WL6 A;  1B6A A;  3L24 A;  5CIK A;  2BHA A;  2GGB A;  4JUQ A;  3L7G A;  5FCF A;  1W2M A;  5D6F A;  4U6Z A;  4A6W A;  2EVO A;  2NQ7 A;  4OOK A;  4U6C A;  3TAV A;  4S2T P;  3IU9 A;  1O0X A;  2EA4 A;  2GGC A;  2Q95 A;  4FUK A;  5JFR A;  2GZ5 A;  2BB7 A;  5JHU A;  1QXW A;  2V6C A;  3IU7 A;  4IKS A;  1C27 A;  4U6J A;  3ROR A;  2BWS A;  2Q92 A;  2BWX A;  3TB5 A;  4Z7M A;  1C24 A;  2GG3 A;  2ADU A;  2B3K A;  2NQ6 A;  4S01 A;  1WN1 A;  1C21 A;  4U1B A;  3MX6 A;  2Q94 A;  4IEC A;  2ZSG A;  4IF7 A;  3S6B A;  4FLJ A;  1B59 A;  1C22 A;  2GU6 A;  1JAW A;  1XGS A;  2GG0 A;  1KQ0 A;  2P99 A;  3PKA A;  3RVA A;  1YJ3 A;  2GTX A;  1Y1N A;  4U73 A;  3PKD A;  2BWU A;  4R60 A;  3MAT A;  1WBQ A;  1YW8 A;  1XGN A;  4IU6 A;  2BWV A;  1WLR A;  4ZWP A;  1YW7 A;  1WKM A;  1PV9 A;  4U71 A;  4ZNG A;  4IKT A;  5E5B A;  2Q8K A;  1C23 A;  5CNX A;  4HXX A;  2V3X A;  2BWY A;  4RGZ 1;  2BHB A;  4FLK A;  1W7V A;  2V3Y A;  1QXZ A;  2BWT A;  2GG8 A;  1XGM A;  3BIT A;  2BHD A;  1N51 A;  4ZWO A;  3PKE A;  4FLI A;  1QXY A;  2G6P A;  5FCH A;  2P98 A;  1BN5 A;  3FMQ A;  4FLL A;  2P9A A;  2GU5 A;  1R5H A;  5D6E A;  5CE6 A;  1YW9 A;  2BH3 A;  2GU7 A;  4U69 A;  2GA2 A;  4IKR A;  2Q93 A;  3BIP A;  3CB6 A;  1CHM A;  3D27 A;  4RZZ A;  4A6V A;  2OAZ A;  3CB5 A;  4U76 A;  1QZY A;  3FMR A;  5CDL A;  4U75 A;  4PNC A;  1KQ9 A;  3IG4 A;  3MR1 A;  2EA2 A;  2IW2 A;  2HOW A;  1M35 A;  4S00 A;  4U6E A;  3BIQ A;  4RZY A;  2GG9 A;  2B3L A;  4MAT A;  4PV4 A;  4FO8 A;  1WY2 A;  1YVM A;  4U70 A;  2BN7 A;  2V3Z A;  4KM3 A;  4IDY A;  4B28 A;  2GG2 A;  4ZWU A;  4S2R P;  5CLS A;  1MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...