2GZ5A

Human type 1 methionine aminopeptidase in complex with ovalicin at 1.1 ang
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structure of the angiogenesis inhibitor ovalicin bound to its noncognate target, human Type 1 methionine aminopeptidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gz5A00
1QXYA 4ZWPA 1C21A 2Q92A 4IF7A 3FM3A 2GU5A 2EVCA 2GZ5A 4IPAA 1JAWA 4U6EA 4FKCA 1M35A 4U70A 5E5BA 3FMQA 4FUKA 1QZYA 4U73A 4U1BA 1BOAA 1XGMA 1YW7A 1YW9A 4S00A 5CDLA 2NQ7A 2HOWA 4RZYA 3PKEA 1YW8A 2EVOA 4FLIA 2Q94A 1R5GA 2GG5A 4IKSA 4IDYA 1N51A 4U69A 3Q6DA 1A16A 4RZZA 4IKRA 4ZNGA 2BWVA 4B28A 3MX6A 4U6WA 2GU4A 2P99A 2ADUA 4HXXA 1WKMA 4U75A 1W2MA 4IKTA 1WN1A 3L7GA 4FLLA 1XGNA 2B3LA 2GG9A 1KQ0A 2BWWA 2BWXA 2Q95A 4IECA 5CE6A 1R5HA 2GG8A 3BIQA 3BIPA 2OKNA 5D6FA 2BWUA 2GA2A 3PKBA 3CB6A 3PKAA 2Q96A 4FLKA 4OOKA 4U6CA 2GG0A 1KQ9A 2Q93A 4FO7A 1C24A 1YVMA 4MATA 1C22A 3IU9A 4ZWUA 4KM3A 1W7VA 2BWSA 2P9AA 1WLRA 3IU8A 4QR8A 3TB5A 1C27A 3MR1A 1WY2A 3L24A 5CIKA 1O0XA 4S01A 4U6ZA 5CDEA 2BB7A 1WBQA 2GG2A 3RVAA 2V3YA 3BITA 2GU7A 4S2RP 1XGOA 1B59A 5CNXA 2Q8KA 2BHDA 2V6CA 2BHAA 2GU6A 2MATA 4A6WA 1QXZA 3MATA 5JFRA 2BN7A 2DFIA 1CHMA 4EGEA 1R58A 3D27A 2BHCA 3PKDA 4Z7MA 2BWYA 2ZSGA 2GGBA 1XNZA 4S2TP 4ZWOA 4IKUA 2GG7A 4FLJA 2NQ6A 2V3XA 3PKCA 3RORA 3IG4A 1B6AA 4PNCA 5FCFA 2BH3A 2EA2A 1C23A 4FO8A 4RGZ1 1XGSA 1KP0A 2GGCA 2B3KA 2GTXA 2IW2A 3FMRA 5FCHA 4U6JA 2BWTA 3S6BA 5CLSA 5JHUA 4A6VA 1BN5A 3CB5A 2GG3A 4U76A 5CDVA 4R60A 1YJ3A 2P98A 5JI6A 2OAZA 3TAVA 5D6EA 1MATA 4JUQA 1WL9A 4U71A 2BHBA 1WL6A 2V3ZA 1Y1NA 3CTZA 3IU7A 2B3HA 2EA4A 2EVMA 2G6PA 1PV9A 4PV4A 4IU6A 1QXWA
chains in the Genus database with same CATH superfamily
1QXYA 4ZWPA 1C21A 2Q92A 4IF7A 3FM3A 2GU5A 2EVCA 2GZ5A 4IPAA 1JAWA 4U6EA 4FKCA 1M35A 4U70A 5E5BA 3FMQA 4FUKA 1QZYA 4U73A 4U1BA 1BOAA 1XGMA 1YW7A 1YW9A 4S00A 5CDLA 2NQ7A 2HOWA 4RZYA 3PKEA 1YW8A 2EVOA 4FLIA 2Q94A 1R5GA 2GG5A 4IKSA 4IDYA 1N51A 4U69A 3Q6DA 1A16A 4RZZA 4IKRA 4ZNGA 2BWVA 4B28A 3MX6A 4U6WA 2GU4A 2P99A 2ADUA 4HXXA 1WKMA 4U75A 1W2MA 4IKTA 1WN1A 3L7GA 4FLLA 1XGNA 2B3LA 2GG9A 1KQ0A 2BWWA 2BWXA 2Q95A 4IECA 5CE6A 1R5HA 2GG8A 3BIQA 3BIPA 2OKNA 5D6FA 2BWUA 2GA2A 3PKBA 3CB6A 3PKAA 2Q96A 4FLKA 4OOKA 4U6CA 2GG0A 1KQ9A 2Q93A 4FO7A 1C24A 1YVMA 4MATA 1C22A 3IU9A 4ZWUA 4KM3A 1W7VA 2BWSA 2P9AA 1WLRA 3IU8A 4QR8A 3TB5A 1C27A 3MR1A 1WY2A 3L24A 5CIKA 1O0XA 4S01A 4U6ZA 5CDEA 2BB7A 1WBQA 2GG2A 3RVAA 2V3YA 3BITA 2GU7A 4S2RP 1XGOA 1B59A 5CNXA 2Q8KA 2BHDA 2V6CA 2BHAA 2GU6A 2MATA 4A6WA 1QXZA 3MATA 5JFRA 2BN7A 2DFIA 1CHMA 4EGEA 1R58A 3D27A 2BHCA 3PKDA 4Z7MA 2BWYA 2ZSGA 2GGBA 1XNZA 4S2TP 4ZWOA 4IKUA 2GG7A 4FLJA 2NQ6A 2V3XA 3PKCA 3RORA 3IG4A 1B6AA 4PNCA 5FCFA 2BH3A 2EA2A 1C23A 4FO8A 4RGZ1 1XGSA 1KP0A 2GGCA 2B3KA 2GTXA 2IW2A 3FMRA 5FCHA 4U6JA 2BWTA 3S6BA 5CLSA 5JHUA 4A6VA 1BN5A 3CB5A 2GG3A 4U76A 5CDVA 4R60A 1YJ3A 2P98A 5JI6A 2OAZA 3TAVA 5D6EA 1MATA 4JUQA 1WL9A 4U71A 2BHBA 1WL6A 2V3ZA 1Y1NA 3CTZA 3IU7A 2B3HA 2EA4A 2EVMA 2G6PA 1PV9A 4PV4A 4IU6A 1QXWA
chains in the Genus database with same CATH topology
1QXYA 4ZWPA 1C21A 2Q92A 4IF7A 3FM3A 2GU5A 2EVCA 2GZ5A 4IPAA 1JAWA 4U6EA 4FKCA 1M35A 4U70A 5E5BA 3FMQA 4FUKA 1QZYA 4U73A 4U1BA 1BOAA 1XGMA 1YW7A 1YW9A 4S00A 5CDLA 2NQ7A 2HOWA 4RZYA 3PKEA 1YW8A 2EVOA 4FLIA 2Q94A 1R5GA 2GG5A 4IKSA 4IDYA 1N51A 4U69A 3Q6DA 1A16A 4RZZA 4IKRA 4ZNGA 2BWVA 4B28A 3MX6A 4U6WA 2GU4A 2P99A 2ADUA 4HXXA 1WKMA 4U75A 1W2MA 4IKTA 1WN1A 3L7GA 4FLLA 1XGNA 2B3LA 2GG9A 1KQ0A 2BWWA 2BWXA 2Q95A 4IECA 5CE6A 1R5HA 2GG8A 3BIQA 3BIPA 2OKNA 5D6FA 2BWUA 2GA2A 3PKBA 3CB6A 3PKAA 2Q96A 4FLKA 4OOKA 4U6CA 2GG0A 1KQ9A 2Q93A 4FO7A 1C24A 1YVMA 4MATA 1C22A 3IU9A 4ZWUA 4KM3A 1W7VA 2BWSA 2P9AA 1WLRA 3IU8A 4QR8A 3TB5A 1C27A 3MR1A 1WY2A 3L24A 5CIKA 1O0XA 4S01A 4U6ZA 5CDEA 2BB7A 1WBQA 2GG2A 3RVAA 2V3YA 3BITA 2GU7A 4S2RP 1XGOA 1B59A 5CNXA 2Q8KA 2BHDA 2V6CA 2BHAA 2GU6A 2MATA 4A6WA 1QXZA 3MATA 5JFRA 2BN7A 2DFIA 1CHMA 4EGEA 1R58A 3D27A 2BHCA 3PKDA 4Z7MA 2BWYA 2ZSGA 2GGBA 1XNZA 4S2TP 4ZWOA 4IKUA 2GG7A 4FLJA 2NQ6A 2V3XA 3PKCA 3RORA 3IG4A 1B6AA 4PNCA 5FCFA 2BH3A 2EA2A 1C23A 4FO8A 4RGZ1 1XGSA 1KP0A 2GGCA 2B3KA 2GTXA 2IW2A 3FMRA 5FCHA 4U6JA 2BWTA 3S6BA 5CLSA 5JHUA 4A6VA 1BN5A 3CB5A 2GG3A 4U76A 5CDVA 4R60A 1YJ3A 2P98A 5JI6A 2OAZA 3TAVA 5D6EA 1MATA 4JUQA 1WL9A 4U71A 2BHBA 1WL6A 2V3ZA 1Y1NA 3CTZA 3IU7A 2B3HA 2EA4A 2EVMA 2G6PA 1PV9A 4PV4A 4IU6A 1QXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXY A;  4ZWP A;  1C21 A;  2Q92 A;  4IF7 A;  3FM3 A;  2GU5 A;  2EVC A;  2GZ5 A;  4IPA A;  1JAW A;  4U6E A;  4FKC A;  1M35 A;  4U70 A;  5E5B A;  3FMQ A;  4FUK A;  1QZY A;  4U73 A;  4U1B A;  1BOA A;  1XGM A;  1YW7 A;  1YW9 A;  4S00 A;  5CDL A;  2NQ7 A;  2HOW A;  4RZY A;  3PKE A;  1YW8 A;  2EVO A;  4FLI A;  2Q94 A;  1R5G A;  2GG5 A;  4IKS A;  4IDY A;  1N51 A;  4U69 A;  3Q6D A;  1A16 A;  4RZZ A;  4IKR A;  4ZNG A;  2BWV A;  4B28 A;  3MX6 A;  4U6W A;  2GU4 A;  2P99 A;  2ADU A;  4HXX A;  1WKM A;  4U75 A;  1W2M A;  4IKT A;  1WN1 A;  3L7G A;  4FLL A;  1XGN A;  2B3L A;  2GG9 A;  1KQ0 A;  2BWW A;  2BWX A;  2Q95 A;  4IEC A;  5CE6 A;  1R5H A;  2GG8 A;  3BIQ A;  3BIP A;  2OKN A;  5D6F A;  2BWU A;  2GA2 A;  3PKB A;  3CB6 A;  3PKA A;  2Q96 A;  4FLK A;  4OOK A;  4U6C A;  2GG0 A;  1KQ9 A;  2Q93 A;  4FO7 A;  1C24 A;  1YVM A;  4MAT A;  1C22 A;  3IU9 A;  4ZWU A;  4KM3 A;  1W7V A;  2BWS A;  2P9A A;  1WLR A;  3IU8 A;  4QR8 A;  3TB5 A;  1C27 A;  3MR1 A;  1WY2 A;  3L24 A;  5CIK A;  1O0X A;  4S01 A;  4U6Z A;  5CDE A;  2BB7 A;  1WBQ A;  2GG2 A;  3RVA A;  2V3Y A;  3BIT A;  2GU7 A;  4S2R P;  1XGO A;  1B59 A;  5CNX A;  2Q8K A;  2BHD A;  2V6C A;  2BHA A;  2GU6 A;  2MAT A;  4A6W A;  1QXZ A;  3MAT A;  5JFR A;  2BN7 A;  2DFI A;  1CHM A;  4EGE A;  1R58 A;  3D27 A;  2BHC A;  3PKD A;  4Z7M A;  2BWY A;  2ZSG A;  2GGB A;  1XNZ A;  4S2T P;  4ZWO A;  4IKU A;  2GG7 A;  4FLJ A;  2NQ6 A;  2V3X A;  3PKC A;  3ROR A;  3IG4 A;  1B6A A;  4PNC A;  5FCF A;  2BH3 A;  2EA2 A;  1C23 A;  4FO8 A;  4RGZ 1;  1XGS A;  1KP0 A;  2GGC A;  2B3K A;  2GTX A;  2IW2 A;  3FMR A;  5FCH A;  4U6J A;  2BWT A;  3S6B A;  5CLS A;  5JHU A;  4A6V A;  1BN5 A;  3CB5 A;  2GG3 A;  4U76 A;  5CDV A;  4R60 A;  1YJ3 A;  2P98 A;  5JI6 A;  2OAZ A;  3TAV A;  5D6E A;  1MAT A;  4JUQ A;  1WL9 A;  4U71 A;  2BHB A;  1WL6 A;  2V3Z A;  1Y1N A;  3CTZ A;  3IU7 A;  2B3H A;  2EA4 A;  2EVM A;  2G6P A;  1PV9 A;  4PV4 A;  4IU6 A;  1QXW A; 
#chains in the Genus database with same CATH topology
 1QXY A;  4ZWP A;  1C21 A;  2Q92 A;  4IF7 A;  3FM3 A;  2GU5 A;  2EVC A;  2GZ5 A;  4IPA A;  1JAW A;  4U6E A;  4FKC A;  1M35 A;  4U70 A;  5E5B A;  3FMQ A;  4FUK A;  1QZY A;  4U73 A;  4U1B A;  1BOA A;  1XGM A;  1YW7 A;  1YW9 A;  4S00 A;  5CDL A;  2NQ7 A;  2HOW A;  4RZY A;  3PKE A;  1YW8 A;  2EVO A;  4FLI A;  2Q94 A;  1R5G A;  2GG5 A;  4IKS A;  4IDY A;  1N51 A;  4U69 A;  3Q6D A;  1A16 A;  4RZZ A;  4IKR A;  4ZNG A;  2BWV A;  4B28 A;  3MX6 A;  4U6W A;  2GU4 A;  2P99 A;  2ADU A;  4HXX A;  1WKM A;  4U75 A;  1W2M A;  4IKT A;  1WN1 A;  3L7G A;  4FLL A;  1XGN A;  2B3L A;  2GG9 A;  1KQ0 A;  2BWW A;  2BWX A;  2Q95 A;  4IEC A;  5CE6 A;  1R5H A;  2GG8 A;  3BIQ A;  3BIP A;  2OKN A;  5D6F A;  2BWU A;  2GA2 A;  3PKB A;  3CB6 A;  3PKA A;  2Q96 A;  4FLK A;  4OOK A;  4U6C A;  2GG0 A;  1KQ9 A;  2Q93 A;  4FO7 A;  1C24 A;  1YVM A;  4MAT A;  1C22 A;  3IU9 A;  4ZWU A;  4KM3 A;  1W7V A;  2BWS A;  2P9A A;  1WLR A;  3IU8 A;  4QR8 A;  3TB5 A;  1C27 A;  3MR1 A;  1WY2 A;  3L24 A;  5CIK A;  1O0X A;  4S01 A;  4U6Z A;  5CDE A;  2BB7 A;  1WBQ A;  2GG2 A;  3RVA A;  2V3Y A;  3BIT A;  2GU7 A;  4S2R P;  1XGO A;  1B59 A;  5CNX A;  2Q8K A;  2BHD A;  2V6C A;  2BHA A;  2GU6 A;  2MAT A;  4A6W A;  1QXZ A;  3MAT A;  5JFR A;  2BN7 A;  2DFI A;  1CHM A;  4EGE A;  1R58 A;  3D27 A;  2BHC A;  3PKD A;  4Z7M A;  2BWY A;  2ZSG A;  2GGB A;  1XNZ A;  4S2T P;  4ZWO A;  4IKU A;  2GG7 A;  4FLJ A;  2NQ6 A;  2V3X A;  3PKC A;  3ROR A;  3IG4 A;  1B6A A;  4PNC A;  5FCF A;  2BH3 A;  2EA2 A;  1C23 A;  4FO8 A;  4RGZ 1;  1XGS A;  1KP0 A;  2GGC A;  2B3K A;  2GTX A;  2IW2 A;  3FMR A;  5FCH A;  4U6J A;  2BWT A;  3S6B A;  5CLS A;  5JHU A;  4A6V A;  1BN5 A;  3CB5 A;  2GG3 A;  4U76 A;  5CDV A;  4R60 A;  1YJ3 A;  2P98 A;  5JI6 A;  2OAZ A;  3TAV A;  5D6E A;  1MAT A;  4JUQ A;  1WL9 A;  4U71 A;  2BHB A;  1WL6 A;  2V3Z A;  1Y1N A;  3CTZ A;  3IU7 A;  2B3H A;  2EA4 A;  2EVM A;  2G6P A;  1PV9 A;  4PV4 A;  4IU6 A;  1QXW A; 
#chains in the Genus database with same CATH homology
 1QXY A;  4ZWP A;  1C21 A;  2Q92 A;  4IF7 A;  3FM3 A;  2GU5 A;  2EVC A;  2GZ5 A;  4IPA A;  1JAW A;  4U6E A;  4FKC A;  1M35 A;  4U70 A;  5E5B A;  3FMQ A;  4FUK A;  1QZY A;  4U73 A;  4U1B A;  1BOA A;  1XGM A;  1YW7 A;  1YW9 A;  4S00 A;  5CDL A;  2NQ7 A;  2HOW A;  4RZY A;  3PKE A;  1YW8 A;  2EVO A;  4FLI A;  2Q94 A;  1R5G A;  2GG5 A;  4IKS A;  4IDY A;  1N51 A;  4U69 A;  3Q6D A;  1A16 A;  4RZZ A;  4IKR A;  4ZNG A;  2BWV A;  4B28 A;  3MX6 A;  4U6W A;  2GU4 A;  2P99 A;  2ADU A;  4HXX A;  1WKM A;  4U75 A;  1W2M A;  4IKT A;  1WN1 A;  3L7G A;  4FLL A;  1XGN A;  2B3L A;  2GG9 A;  1KQ0 A;  2BWW A;  2BWX A;  2Q95 A;  4IEC A;  5CE6 A;  1R5H A;  2GG8 A;  3BIQ A;  3BIP A;  2OKN A;  5D6F A;  2BWU A;  2GA2 A;  3PKB A;  3CB6 A;  3PKA A;  2Q96 A;  4FLK A;  4OOK A;  4U6C A;  2GG0 A;  1KQ9 A;  2Q93 A;  4FO7 A;  1C24 A;  1YVM A;  4MAT A;  1C22 A;  3IU9 A;  4ZWU A;  4KM3 A;  1W7V A;  2BWS A;  2P9A A;  1WLR A;  3IU8 A;  4QR8 A;  3TB5 A;  1C27 A;  3MR1 A;  1WY2 A;  3L24 A;  5CIK A;  1O0X A;  4S01 A;  4U6Z A;  5CDE A;  2BB7 A;  1WBQ A;  2GG2 A;  3RVA A;  2V3Y A;  3BIT A;  2GU7 A;  4S2R P;  1XGO A;  1B59 A;  5CNX A;  2Q8K A;  2BHD A;  2V6C A;  2BHA A;  2GU6 A;  2MAT A;  4A6W A;  1QXZ A;  3MAT A;  5JFR A;  2BN7 A;  2DFI A;  1CHM A;  4EGE A;  1R58 A;  3D27 A;  2BHC A;  3PKD A;  4Z7M A;  2BWY A;  2ZSG A;  2GGB A;  1XNZ A;  4S2T P;  4ZWO A;  4IKU A;  2GG7 A;  4FLJ A;  2NQ6 A;  2V3X A;  3PKC A;  3ROR A;  3IG4 A;  1B6A A;  4PNC A;  5FCF A;  2BH3 A;  2EA2 A;  1C23 A;  4FO8 A;  4RGZ 1;  1XGS A;  1KP0 A;  2GGC A;  2B3K A;  2GTX A;  2IW2 A;  3FMR A;  5FCH A;  4U6J A;  2BWT A;  3S6B A;  5CLS A;  5JHU A;  4A6V A;  1BN5 A;  3CB5 A;  2GG3 A;  4U76 A;  5CDV A;  4R60 A;  1YJ3 A;  2P98 A;  5JI6 A;  2OAZ A;  3TAV A;  5D6E A;  1MAT A;  4JUQ A;  1WL9 A;  4U71 A;  2BHB A;  1WL6 A;  2V3Z A;  1Y1N A;  3CTZ A;  3IU7 A;  2B3H A;  2EA4 A;  2EVM A;  2G6P A;  1PV9 A;  4PV4 A;  4IU6 A;  1QXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...