2GZ5A

Human type 1 methionine aminopeptidase in complex with ovalicin at 1.1 ang
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Structure of the angiogenesis inhibitor ovalicin bound to its noncognate target, human Type 1 methionine aminopeptidase.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gz5A00
4ZWOA 2EA2A 1XGSA 1R58A 1KP0A 1WN1A 2NQ7A 5CNXA 1N51A 2V6CA 4U75A 4R60A 2GU6A 4IECA 3FMRA 2GG0A 1QXYA 4HXXA 4FKCA 2GG7A 1BN5A 3CB5A 3PKDA 1WY2A 2GG8A 2Q94A 2GG5A 1B59A 2V3XA 3FM3A 2BHBA 2GGCA 4U6JA 2OAZA 2Q92A 4IKTA 2IW2A 1YW9A 4PV4A 2P9AA 1WBQA 4IDYA 3L24A 1B6AA 4QR8A 1C27A 2BWXA 4IU6A 5E5BA 2ADUA 3CTZA 3L7GA 4U6WA 3RORA 4IKSA 4B28A 4ZWUA 1R5GA 3D27A 1C21A 1WL6A 4S2TP 2GA2A 4U1BA 3MATA 2BHCA 1C22A 1C23A 2BB7A 4KM3A 2BWUA 2BWYA 3MX6A 5JFRA 5JHUA 2P98A 2GG3A 3BIQA 4S2RP 2GZ5A 2B3KA 4PNCA 5CLSA 2Q8KA 1XGMA 4U69A 4U73A 1XGOA 1QXWA 1QZYA 2EA4A 1W2MA 4U6EA 3TAVA 1KQ9A 5CE6A 5FCFA 1CHMA 2DFIA 3BITA 4FO7A 5FCHA 3PKCA 2GG9A 1PV9A 4A6WA 2GG2A 4RZYA 4A6VA 1YJ3A 2BWVA 2GTXA 2GGBA 2GU4A 2NQ6A 1W7VA 4FLJA 4IKUA 1M35A 1R5HA 4S00A 4S01A 3S6BA 2BN7A 4FUKA 4IKRA 2B3LA 4U70A 4RZZA 1BOAA 5CDLA 3BIPA 2P99A 1JAWA 1WL9A 2B3HA 3IU8A 4ZWPA 2Q96A 4FLLA 5D6FA 2EVOA 5CDEA 2Q95A 4U76A 3IU9A 1XGNA 4U71A 4FLIA 3MR1A 4MATA 2Q93A 4JUQA 4IF7A 3PKAA 1KQ0A 3CB6A 3PKEA 2BWWA 3Q6DA 1C24A 1YW7A 4EGEA 3IU7A 5JI6A 5CDVA 2V3YA 1WKMA 2HOWA 2MATA 4FO8A 2ZSGA 1O0XA 1WLRA 2BWTA 2V3ZA 4FLKA 2BH3A 2BWSA 3FMQA 3PKBA 1MATA 4U6ZA 4Z7MA 1YVMA 1A16A 2OKNA 2BHAA 3RVAA 2BHDA 3IG4A 4IPAA 5CIKA 2G6PA 2GU7A 2EVCA 4OOKA 4RGZ1 3TB5A 4ZNGA 2GU5A 4U6CA 1QXZA 1XNZA 1Y1NA 2EVMA 1YW8A 5D6EA
chains in the Genus database with same CATH superfamily
4ZWOA 2EA2A 1XGSA 1R58A 1KP0A 1WN1A 2NQ7A 5CNXA 1N51A 2V6CA 4U75A 4R60A 2GU6A 4IECA 3FMRA 2GG0A 1QXYA 4HXXA 4FKCA 2GG7A 1BN5A 3CB5A 3PKDA 1WY2A 2GG8A 2Q94A 2GG5A 1B59A 2V3XA 3FM3A 2BHBA 2GGCA 4U6JA 2OAZA 2Q92A 4IKTA 2IW2A 1YW9A 4PV4A 2P9AA 1WBQA 4IDYA 3L24A 1B6AA 4QR8A 1C27A 2BWXA 4IU6A 5E5BA 2ADUA 3CTZA 3L7GA 4U6WA 3RORA 4IKSA 4B28A 4ZWUA 1R5GA 3D27A 1C21A 1WL6A 4S2TP 2GA2A 4U1BA 3MATA 2BHCA 1C22A 1C23A 2BB7A 4KM3A 2BWUA 2BWYA 3MX6A 5JFRA 5JHUA 2P98A 2GG3A 3BIQA 4S2RP 2GZ5A 2B3KA 4PNCA 5CLSA 2Q8KA 1XGMA 4U69A 4U73A 1XGOA 1QXWA 1QZYA 2EA4A 1W2MA 4U6EA 3TAVA 1KQ9A 5CE6A 5FCFA 1CHMA 2DFIA 3BITA 4FO7A 5FCHA 3PKCA 2GG9A 1PV9A 4A6WA 2GG2A 4RZYA 4A6VA 1YJ3A 2BWVA 2GTXA 2GGBA 2GU4A 2NQ6A 1W7VA 4FLJA 4IKUA 1M35A 1R5HA 4S00A 4S01A 3S6BA 2BN7A 4FUKA 4IKRA 2B3LA 4U70A 4RZZA 1BOAA 5CDLA 3BIPA 2P99A 1JAWA 1WL9A 2B3HA 3IU8A 4ZWPA 2Q96A 4FLLA 5D6FA 2EVOA 5CDEA 2Q95A 4U76A 3IU9A 1XGNA 4U71A 4FLIA 3MR1A 4MATA 2Q93A 4JUQA 4IF7A 3PKAA 1KQ0A 3CB6A 3PKEA 2BWWA 3Q6DA 1C24A 1YW7A 4EGEA 3IU7A 5JI6A 5CDVA 2V3YA 1WKMA 2HOWA 2MATA 4FO8A 2ZSGA 1O0XA 1WLRA 2BWTA 2V3ZA 4FLKA 2BH3A 2BWSA 3FMQA 3PKBA 1MATA 4U6ZA 4Z7MA 1YVMA 1A16A 2OKNA 2BHAA 3RVAA 2BHDA 3IG4A 4IPAA 5CIKA 2G6PA 2GU7A 2EVCA 4OOKA 4RGZ1 3TB5A 4ZNGA 2GU5A 4U6CA 1QXZA 1XNZA 1Y1NA 2EVMA 1YW8A 5D6EA
chains in the Genus database with same CATH topology
4ZWOA 2EA2A 1XGSA 1R58A 1KP0A 1WN1A 2NQ7A 5CNXA 1N51A 2V6CA 4U75A 4R60A 2GU6A 4IECA 3FMRA 2GG0A 1QXYA 4HXXA 4FKCA 2GG7A 1BN5A 3CB5A 3PKDA 1WY2A 2GG8A 2Q94A 2GG5A 1B59A 2V3XA 3FM3A 2BHBA 2GGCA 4U6JA 2OAZA 2Q92A 4IKTA 2IW2A 1YW9A 4PV4A 2P9AA 1WBQA 4IDYA 3L24A 1B6AA 4QR8A 1C27A 2BWXA 4IU6A 5E5BA 2ADUA 3CTZA 3L7GA 4U6WA 3RORA 4IKSA 4B28A 4ZWUA 1R5GA 3D27A 1C21A 1WL6A 4S2TP 2GA2A 4U1BA 3MATA 2BHCA 1C22A 1C23A 2BB7A 4KM3A 2BWUA 2BWYA 3MX6A 5JFRA 5JHUA 2P98A 2GG3A 3BIQA 4S2RP 2GZ5A 2B3KA 4PNCA 5CLSA 2Q8KA 1XGMA 4U69A 4U73A 1XGOA 1QXWA 1QZYA 2EA4A 1W2MA 4U6EA 3TAVA 1KQ9A 5CE6A 5FCFA 1CHMA 2DFIA 3BITA 4FO7A 5FCHA 3PKCA 2GG9A 1PV9A 4A6WA 2GG2A 4RZYA 4A6VA 1YJ3A 2BWVA 2GTXA 2GGBA 2GU4A 2NQ6A 1W7VA 4FLJA 4IKUA 1M35A 1R5HA 4S00A 4S01A 3S6BA 2BN7A 4FUKA 4IKRA 2B3LA 4U70A 4RZZA 1BOAA 5CDLA 3BIPA 2P99A 1JAWA 1WL9A 2B3HA 3IU8A 4ZWPA 2Q96A 4FLLA 5D6FA 2EVOA 5CDEA 2Q95A 4U76A 3IU9A 1XGNA 4U71A 4FLIA 3MR1A 4MATA 2Q93A 4JUQA 4IF7A 3PKAA 1KQ0A 3CB6A 3PKEA 2BWWA 3Q6DA 1C24A 1YW7A 4EGEA 3IU7A 5JI6A 5CDVA 2V3YA 1WKMA 2HOWA 2MATA 4FO8A 2ZSGA 1O0XA 1WLRA 2BWTA 2V3ZA 4FLKA 2BH3A 2BWSA 3FMQA 3PKBA 1MATA 4U6ZA 4Z7MA 1YVMA 1A16A 2OKNA 2BHAA 3RVAA 2BHDA 3IG4A 4IPAA 5CIKA 2G6PA 2GU7A 2EVCA 4OOKA 4RGZ1 3TB5A 4ZNGA 2GU5A 4U6CA 1QXZA 1XNZA 1Y1NA 2EVMA 1YW8A 5D6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWO A;  2EA2 A;  1XGS A;  1R58 A;  1KP0 A;  1WN1 A;  2NQ7 A;  5CNX A;  1N51 A;  2V6C A;  4U75 A;  4R60 A;  2GU6 A;  4IEC A;  3FMR A;  2GG0 A;  1QXY A;  4HXX A;  4FKC A;  2GG7 A;  1BN5 A;  3CB5 A;  3PKD A;  1WY2 A;  2GG8 A;  2Q94 A;  2GG5 A;  1B59 A;  2V3X A;  3FM3 A;  2BHB A;  2GGC A;  4U6J A;  2OAZ A;  2Q92 A;  4IKT A;  2IW2 A;  1YW9 A;  4PV4 A;  2P9A A;  1WBQ A;  4IDY A;  3L24 A;  1B6A A;  4QR8 A;  1C27 A;  2BWX A;  4IU6 A;  5E5B A;  2ADU A;  3CTZ A;  3L7G A;  4U6W A;  3ROR A;  4IKS A;  4B28 A;  4ZWU A;  1R5G A;  3D27 A;  1C21 A;  1WL6 A;  4S2T P;  2GA2 A;  4U1B A;  3MAT A;  2BHC A;  1C22 A;  1C23 A;  2BB7 A;  4KM3 A;  2BWU A;  2BWY A;  3MX6 A;  5JFR A;  5JHU A;  2P98 A;  2GG3 A;  3BIQ A;  4S2R P;  2GZ5 A;  2B3K A;  4PNC A;  5CLS A;  2Q8K A;  1XGM A;  4U69 A;  4U73 A;  1XGO A;  1QXW A;  1QZY A;  2EA4 A;  1W2M A;  4U6E A;  3TAV A;  1KQ9 A;  5CE6 A;  5FCF A;  1CHM A;  2DFI A;  3BIT A;  4FO7 A;  5FCH A;  3PKC A;  2GG9 A;  1PV9 A;  4A6W A;  2GG2 A;  4RZY A;  4A6V A;  1YJ3 A;  2BWV A;  2GTX A;  2GGB A;  2GU4 A;  2NQ6 A;  1W7V A;  4FLJ A;  4IKU A;  1M35 A;  1R5H A;  4S00 A;  4S01 A;  3S6B A;  2BN7 A;  4FUK A;  4IKR A;  2B3L A;  4U70 A;  4RZZ A;  1BOA A;  5CDL A;  3BIP A;  2P99 A;  1JAW A;  1WL9 A;  2B3H A;  3IU8 A;  4ZWP A;  2Q96 A;  4FLL A;  5D6F A;  2EVO A;  5CDE A;  2Q95 A;  4U76 A;  3IU9 A;  1XGN A;  4U71 A;  4FLI A;  3MR1 A;  4MAT A;  2Q93 A;  4JUQ A;  4IF7 A;  3PKA A;  1KQ0 A;  3CB6 A;  3PKE A;  2BWW A;  3Q6D A;  1C24 A;  1YW7 A;  4EGE A;  3IU7 A;  5JI6 A;  5CDV A;  2V3Y A;  1WKM A;  2HOW A;  2MAT A;  4FO8 A;  2ZSG A;  1O0X A;  1WLR A;  2BWT A;  2V3Z A;  4FLK A;  2BH3 A;  2BWS A;  3FMQ A;  3PKB A;  1MAT A;  4U6Z A;  4Z7M A;  1YVM A;  1A16 A;  2OKN A;  2BHA A;  3RVA A;  2BHD A;  3IG4 A;  4IPA A;  5CIK A;  2G6P A;  2GU7 A;  2EVC A;  4OOK A;  4RGZ 1;  3TB5 A;  4ZNG A;  2GU5 A;  4U6C A;  1QXZ A;  1XNZ A;  1Y1N A;  2EVM A;  1YW8 A;  5D6E A; 
#chains in the Genus database with same CATH topology
 4ZWO A;  2EA2 A;  1XGS A;  1R58 A;  1KP0 A;  1WN1 A;  2NQ7 A;  5CNX A;  1N51 A;  2V6C A;  4U75 A;  4R60 A;  2GU6 A;  4IEC A;  3FMR A;  2GG0 A;  1QXY A;  4HXX A;  4FKC A;  2GG7 A;  1BN5 A;  3CB5 A;  3PKD A;  1WY2 A;  2GG8 A;  2Q94 A;  2GG5 A;  1B59 A;  2V3X A;  3FM3 A;  2BHB A;  2GGC A;  4U6J A;  2OAZ A;  2Q92 A;  4IKT A;  2IW2 A;  1YW9 A;  4PV4 A;  2P9A A;  1WBQ A;  4IDY A;  3L24 A;  1B6A A;  4QR8 A;  1C27 A;  2BWX A;  4IU6 A;  5E5B A;  2ADU A;  3CTZ A;  3L7G A;  4U6W A;  3ROR A;  4IKS A;  4B28 A;  4ZWU A;  1R5G A;  3D27 A;  1C21 A;  1WL6 A;  4S2T P;  2GA2 A;  4U1B A;  3MAT A;  2BHC A;  1C22 A;  1C23 A;  2BB7 A;  4KM3 A;  2BWU A;  2BWY A;  3MX6 A;  5JFR A;  5JHU A;  2P98 A;  2GG3 A;  3BIQ A;  4S2R P;  2GZ5 A;  2B3K A;  4PNC A;  5CLS A;  2Q8K A;  1XGM A;  4U69 A;  4U73 A;  1XGO A;  1QXW A;  1QZY A;  2EA4 A;  1W2M A;  4U6E A;  3TAV A;  1KQ9 A;  5CE6 A;  5FCF A;  1CHM A;  2DFI A;  3BIT A;  4FO7 A;  5FCH A;  3PKC A;  2GG9 A;  1PV9 A;  4A6W A;  2GG2 A;  4RZY A;  4A6V A;  1YJ3 A;  2BWV A;  2GTX A;  2GGB A;  2GU4 A;  2NQ6 A;  1W7V A;  4FLJ A;  4IKU A;  1M35 A;  1R5H A;  4S00 A;  4S01 A;  3S6B A;  2BN7 A;  4FUK A;  4IKR A;  2B3L A;  4U70 A;  4RZZ A;  1BOA A;  5CDL A;  3BIP A;  2P99 A;  1JAW A;  1WL9 A;  2B3H A;  3IU8 A;  4ZWP A;  2Q96 A;  4FLL A;  5D6F A;  2EVO A;  5CDE A;  2Q95 A;  4U76 A;  3IU9 A;  1XGN A;  4U71 A;  4FLI A;  3MR1 A;  4MAT A;  2Q93 A;  4JUQ A;  4IF7 A;  3PKA A;  1KQ0 A;  3CB6 A;  3PKE A;  2BWW A;  3Q6D A;  1C24 A;  1YW7 A;  4EGE A;  3IU7 A;  5JI6 A;  5CDV A;  2V3Y A;  1WKM A;  2HOW A;  2MAT A;  4FO8 A;  2ZSG A;  1O0X A;  1WLR A;  2BWT A;  2V3Z A;  4FLK A;  2BH3 A;  2BWS A;  3FMQ A;  3PKB A;  1MAT A;  4U6Z A;  4Z7M A;  1YVM A;  1A16 A;  2OKN A;  2BHA A;  3RVA A;  2BHD A;  3IG4 A;  4IPA A;  5CIK A;  2G6P A;  2GU7 A;  2EVC A;  4OOK A;  4RGZ 1;  3TB5 A;  4ZNG A;  2GU5 A;  4U6C A;  1QXZ A;  1XNZ A;  1Y1N A;  2EVM A;  1YW8 A;  5D6E A; 
#chains in the Genus database with same CATH homology
 4ZWO A;  2EA2 A;  1XGS A;  1R58 A;  1KP0 A;  1WN1 A;  2NQ7 A;  5CNX A;  1N51 A;  2V6C A;  4U75 A;  4R60 A;  2GU6 A;  4IEC A;  3FMR A;  2GG0 A;  1QXY A;  4HXX A;  4FKC A;  2GG7 A;  1BN5 A;  3CB5 A;  3PKD A;  1WY2 A;  2GG8 A;  2Q94 A;  2GG5 A;  1B59 A;  2V3X A;  3FM3 A;  2BHB A;  2GGC A;  4U6J A;  2OAZ A;  2Q92 A;  4IKT A;  2IW2 A;  1YW9 A;  4PV4 A;  2P9A A;  1WBQ A;  4IDY A;  3L24 A;  1B6A A;  4QR8 A;  1C27 A;  2BWX A;  4IU6 A;  5E5B A;  2ADU A;  3CTZ A;  3L7G A;  4U6W A;  3ROR A;  4IKS A;  4B28 A;  4ZWU A;  1R5G A;  3D27 A;  1C21 A;  1WL6 A;  4S2T P;  2GA2 A;  4U1B A;  3MAT A;  2BHC A;  1C22 A;  1C23 A;  2BB7 A;  4KM3 A;  2BWU A;  2BWY A;  3MX6 A;  5JFR A;  5JHU A;  2P98 A;  2GG3 A;  3BIQ A;  4S2R P;  2GZ5 A;  2B3K A;  4PNC A;  5CLS A;  2Q8K A;  1XGM A;  4U69 A;  4U73 A;  1XGO A;  1QXW A;  1QZY A;  2EA4 A;  1W2M A;  4U6E A;  3TAV A;  1KQ9 A;  5CE6 A;  5FCF A;  1CHM A;  2DFI A;  3BIT A;  4FO7 A;  5FCH A;  3PKC A;  2GG9 A;  1PV9 A;  4A6W A;  2GG2 A;  4RZY A;  4A6V A;  1YJ3 A;  2BWV A;  2GTX A;  2GGB A;  2GU4 A;  2NQ6 A;  1W7V A;  4FLJ A;  4IKU A;  1M35 A;  1R5H A;  4S00 A;  4S01 A;  3S6B A;  2BN7 A;  4FUK A;  4IKR A;  2B3L A;  4U70 A;  4RZZ A;  1BOA A;  5CDL A;  3BIP A;  2P99 A;  1JAW A;  1WL9 A;  2B3H A;  3IU8 A;  4ZWP A;  2Q96 A;  4FLL A;  5D6F A;  2EVO A;  5CDE A;  2Q95 A;  4U76 A;  3IU9 A;  1XGN A;  4U71 A;  4FLI A;  3MR1 A;  4MAT A;  2Q93 A;  4JUQ A;  4IF7 A;  3PKA A;  1KQ0 A;  3CB6 A;  3PKE A;  2BWW A;  3Q6D A;  1C24 A;  1YW7 A;  4EGE A;  3IU7 A;  5JI6 A;  5CDV A;  2V3Y A;  1WKM A;  2HOW A;  2MAT A;  4FO8 A;  2ZSG A;  1O0X A;  1WLR A;  2BWT A;  2V3Z A;  4FLK A;  2BH3 A;  2BWS A;  3FMQ A;  3PKB A;  1MAT A;  4U6Z A;  4Z7M A;  1YVM A;  1A16 A;  2OKN A;  2BHA A;  3RVA A;  2BHD A;  3IG4 A;  4IPA A;  5CIK A;  2G6P A;  2GU7 A;  2EVC A;  4OOK A;  4RGZ 1;  3TB5 A;  4ZNG A;  2GU5 A;  4U6C A;  1QXZ A;  1XNZ A;  1Y1N A;  2EVM A;  1YW8 A;  5D6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...