2GZ5A

Human type 1 methionine aminopeptidase in complex with ovalicin at 1.1 ang
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the angiogenesis inhibitor ovalicin bound to its noncognate target, human Type 1 methionine aminopeptidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gz5A00
4U73A 2EVMA 3BIPA 2GZ5A 3L24A 5JFRA 4KM3A 4S01A 2GG8A 4MATA 4FUKA 1WLRA 4IKRA 4U70A 1YW7A 2BHBA 4S00A 1C27A 1WL6A 2B3HA 1N51A 2V3ZA 2BWXA 2BWWA 1YJ3A 1C22A 2V3XA 4IU6A 2MATA 1JAWA 2GTXA 2Q94A 3PKBA 4U6JA 2B3LA 2Q92A 2GG5A 4U1BA 4IDYA 2GU5A 4IPAA 4A6WA 2GG9A 2BN7A 2GG3A 1M35A 2EA4A 3IG4A 3FMRA 2BHDA 4RZZA 1XGSA 3MATA 1KQ0A 2EVOA 3BITA 4S2RP 2GG2A 3S6BA 1QZYA 4OOKA 3D27A 2GU7A 4U6ZA 4RZYA 1Y1NA 3FM3A 1W7VA 2BH3A 2GA2A 4IECA 2BHCA 2GU4A 4ZNGA 2IW2A 5D6EA 3RVAA 4FLJA 1YW8A 5CDLA 5CIKA 5CNXA 2V6CA 4R60A 2NQ6A 2BWVA 2GG0A 3PKEA 1A16A 4ZWUA 1C23A 1XNZA 4IF7A 1C24A 1CHMA 3MX6A 4ZWOA 4A6VA 1R5HA 2BHAA 2BWSA 4FLIA 4B28A 2DFIA 1O0XA 3MR1A 4IKTA 1WBQA 5FCFA 3BIQA 2GGCA 1KP0A 3CB5A 2ZSGA 2BB7A 5JHUA 2ADUA 2OAZA 3TB5A 3IU7A 2GG7A 4FO8A 3TAVA 4FKCA 5CE6A 2EA2A 1QXZA 4RGZ1 4FLKA 1WKMA 1KQ9A 1BOAA 5D6FA 4S2TP 4U6WA 2P98A 2G6PA 2BWUA 5CDEA 1QXWA 4JUQA 1C21A 2GGBA 5FCHA 1WL9A 4ZWPA 1XGNA 4PV4A 4U75A 2OKNA 3L7GA 2V3YA 3CB6A 1XGMA 4FLLA 2BWYA 2GU6A 4U69A 2Q8KA 2BWTA 4QR8A 2P9AA 4U6CA 1B6AA 2HOWA 1XGOA 1YW9A 2Q93A 3PKCA 5CDVA 2P99A 4HXXA 1W2MA 2EVCA 3IU8A 1PV9A 3IU9A 3CTZA 5E5BA 3PKDA 2NQ7A 1BN5A 1R5GA 1YVMA 1WY2A 4IKUA 4IKSA 4PNCA 3Q6DA 4U6EA 4Z7MA 2B3KA 5JI6A 3FMQA 2Q95A 1QXYA 4EGEA 1MATA 4U76A 4FO7A 2Q96A 4U71A 5CLSA 1R58A 3PKAA 1WN1A 1B59A 3RORA
chains in the Genus database with same CATH superfamily
4U73A 2EVMA 3BIPA 2GZ5A 3L24A 5JFRA 4KM3A 4S01A 2GG8A 4MATA 4FUKA 1WLRA 4IKRA 4U70A 1YW7A 2BHBA 4S00A 1C27A 1WL6A 2B3HA 1N51A 2V3ZA 2BWXA 2BWWA 1YJ3A 1C22A 2V3XA 4IU6A 2MATA 1JAWA 2GTXA 2Q94A 3PKBA 4U6JA 2B3LA 2Q92A 2GG5A 4U1BA 4IDYA 2GU5A 4IPAA 4A6WA 2GG9A 2BN7A 2GG3A 1M35A 2EA4A 3IG4A 3FMRA 2BHDA 4RZZA 1XGSA 3MATA 1KQ0A 2EVOA 3BITA 4S2RP 2GG2A 3S6BA 1QZYA 4OOKA 3D27A 2GU7A 4U6ZA 4RZYA 1Y1NA 3FM3A 1W7VA 2BH3A 2GA2A 4IECA 2BHCA 2GU4A 4ZNGA 2IW2A 5D6EA 3RVAA 4FLJA 1YW8A 5CDLA 5CIKA 5CNXA 2V6CA 4R60A 2NQ6A 2BWVA 2GG0A 3PKEA 1A16A 4ZWUA 1C23A 1XNZA 4IF7A 1C24A 1CHMA 3MX6A 4ZWOA 4A6VA 1R5HA 2BHAA 2BWSA 4FLIA 4B28A 2DFIA 1O0XA 3MR1A 4IKTA 1WBQA 5FCFA 3BIQA 2GGCA 1KP0A 3CB5A 2ZSGA 2BB7A 5JHUA 2ADUA 2OAZA 3TB5A 3IU7A 2GG7A 4FO8A 3TAVA 4FKCA 5CE6A 2EA2A 1QXZA 4RGZ1 4FLKA 1WKMA 1KQ9A 1BOAA 5D6FA 4S2TP 4U6WA 2P98A 2G6PA 2BWUA 5CDEA 1QXWA 4JUQA 1C21A 2GGBA 5FCHA 1WL9A 4ZWPA 1XGNA 4PV4A 4U75A 2OKNA 3L7GA 2V3YA 3CB6A 1XGMA 4FLLA 2BWYA 2GU6A 4U69A 2Q8KA 2BWTA 4QR8A 2P9AA 4U6CA 1B6AA 2HOWA 1XGOA 1YW9A 2Q93A 3PKCA 5CDVA 2P99A 4HXXA 1W2MA 2EVCA 3IU8A 1PV9A 3IU9A 3CTZA 5E5BA 3PKDA 2NQ7A 1BN5A 1R5GA 1YVMA 1WY2A 4IKUA 4IKSA 4PNCA 3Q6DA 4U6EA 4Z7MA 2B3KA 5JI6A 3FMQA 2Q95A 1QXYA 4EGEA 1MATA 4U76A 4FO7A 2Q96A 4U71A 5CLSA 1R58A 3PKAA 1WN1A 1B59A 3RORA
chains in the Genus database with same CATH topology
4U73A 2EVMA 3BIPA 2GZ5A 3L24A 5JFRA 4KM3A 4S01A 2GG8A 4MATA 4FUKA 1WLRA 4IKRA 4U70A 1YW7A 2BHBA 4S00A 1C27A 1WL6A 2B3HA 1N51A 2V3ZA 2BWXA 2BWWA 1YJ3A 1C22A 2V3XA 4IU6A 2MATA 1JAWA 2GTXA 2Q94A 3PKBA 4U6JA 2B3LA 2Q92A 2GG5A 4U1BA 4IDYA 2GU5A 4IPAA 4A6WA 2GG9A 2BN7A 2GG3A 1M35A 2EA4A 3IG4A 3FMRA 2BHDA 4RZZA 1XGSA 3MATA 1KQ0A 2EVOA 3BITA 4S2RP 2GG2A 3S6BA 1QZYA 4OOKA 3D27A 2GU7A 4U6ZA 4RZYA 1Y1NA 3FM3A 1W7VA 2BH3A 2GA2A 4IECA 2BHCA 2GU4A 4ZNGA 2IW2A 5D6EA 3RVAA 4FLJA 1YW8A 5CDLA 5CIKA 5CNXA 2V6CA 4R60A 2NQ6A 2BWVA 2GG0A 3PKEA 1A16A 4ZWUA 1C23A 1XNZA 4IF7A 1C24A 1CHMA 3MX6A 4ZWOA 4A6VA 1R5HA 2BHAA 2BWSA 4FLIA 4B28A 2DFIA 1O0XA 3MR1A 4IKTA 1WBQA 5FCFA 3BIQA 2GGCA 1KP0A 3CB5A 2ZSGA 2BB7A 5JHUA 2ADUA 2OAZA 3TB5A 3IU7A 2GG7A 4FO8A 3TAVA 4FKCA 5CE6A 2EA2A 1QXZA 4RGZ1 4FLKA 1WKMA 1KQ9A 1BOAA 5D6FA 4S2TP 4U6WA 2P98A 2G6PA 2BWUA 5CDEA 1QXWA 4JUQA 1C21A 2GGBA 5FCHA 1WL9A 4ZWPA 1XGNA 4PV4A 4U75A 2OKNA 3L7GA 2V3YA 3CB6A 1XGMA 4FLLA 2BWYA 2GU6A 4U69A 2Q8KA 2BWTA 4QR8A 2P9AA 4U6CA 1B6AA 2HOWA 1XGOA 1YW9A 2Q93A 3PKCA 5CDVA 2P99A 4HXXA 1W2MA 2EVCA 3IU8A 1PV9A 3IU9A 3CTZA 5E5BA 3PKDA 2NQ7A 1BN5A 1R5GA 1YVMA 1WY2A 4IKUA 4IKSA 4PNCA 3Q6DA 4U6EA 4Z7MA 2B3KA 5JI6A 3FMQA 2Q95A 1QXYA 4EGEA 1MATA 4U76A 4FO7A 2Q96A 4U71A 5CLSA 1R58A 3PKAA 1WN1A 1B59A 3RORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U73 A;  2EVM A;  3BIP A;  2GZ5 A;  3L24 A;  5JFR A;  4KM3 A;  4S01 A;  2GG8 A;  4MAT A;  4FUK A;  1WLR A;  4IKR A;  4U70 A;  1YW7 A;  2BHB A;  4S00 A;  1C27 A;  1WL6 A;  2B3H A;  1N51 A;  2V3Z A;  2BWX A;  2BWW A;  1YJ3 A;  1C22 A;  2V3X A;  4IU6 A;  2MAT A;  1JAW A;  2GTX A;  2Q94 A;  3PKB A;  4U6J A;  2B3L A;  2Q92 A;  2GG5 A;  4U1B A;  4IDY A;  2GU5 A;  4IPA A;  4A6W A;  2GG9 A;  2BN7 A;  2GG3 A;  1M35 A;  2EA4 A;  3IG4 A;  3FMR A;  2BHD A;  4RZZ A;  1XGS A;  3MAT A;  1KQ0 A;  2EVO A;  3BIT A;  4S2R P;  2GG2 A;  3S6B A;  1QZY A;  4OOK A;  3D27 A;  2GU7 A;  4U6Z A;  4RZY A;  1Y1N A;  3FM3 A;  1W7V A;  2BH3 A;  2GA2 A;  4IEC A;  2BHC A;  2GU4 A;  4ZNG A;  2IW2 A;  5D6E A;  3RVA A;  4FLJ A;  1YW8 A;  5CDL A;  5CIK A;  5CNX A;  2V6C A;  4R60 A;  2NQ6 A;  2BWV A;  2GG0 A;  3PKE A;  1A16 A;  4ZWU A;  1C23 A;  1XNZ A;  4IF7 A;  1C24 A;  1CHM A;  3MX6 A;  4ZWO A;  4A6V A;  1R5H A;  2BHA A;  2BWS A;  4FLI A;  4B28 A;  2DFI A;  1O0X A;  3MR1 A;  4IKT A;  1WBQ A;  5FCF A;  3BIQ A;  2GGC A;  1KP0 A;  3CB5 A;  2ZSG A;  2BB7 A;  5JHU A;  2ADU A;  2OAZ A;  3TB5 A;  3IU7 A;  2GG7 A;  4FO8 A;  3TAV A;  4FKC A;  5CE6 A;  2EA2 A;  1QXZ A;  4RGZ 1;  4FLK A;  1WKM A;  1KQ9 A;  1BOA A;  5D6F A;  4S2T P;  4U6W A;  2P98 A;  2G6P A;  2BWU A;  5CDE A;  1QXW A;  4JUQ A;  1C21 A;  2GGB A;  5FCH A;  1WL9 A;  4ZWP A;  1XGN A;  4PV4 A;  4U75 A;  2OKN A;  3L7G A;  2V3Y A;  3CB6 A;  1XGM A;  4FLL A;  2BWY A;  2GU6 A;  4U69 A;  2Q8K A;  2BWT A;  4QR8 A;  2P9A A;  4U6C A;  1B6A A;  2HOW A;  1XGO A;  1YW9 A;  2Q93 A;  3PKC A;  5CDV A;  2P99 A;  4HXX A;  1W2M A;  2EVC A;  3IU8 A;  1PV9 A;  3IU9 A;  3CTZ A;  5E5B A;  3PKD A;  2NQ7 A;  1BN5 A;  1R5G A;  1YVM A;  1WY2 A;  4IKU A;  4IKS A;  4PNC A;  3Q6D A;  4U6E A;  4Z7M A;  2B3K A;  5JI6 A;  3FMQ A;  2Q95 A;  1QXY A;  4EGE A;  1MAT A;  4U76 A;  4FO7 A;  2Q96 A;  4U71 A;  5CLS A;  1R58 A;  3PKA A;  1WN1 A;  1B59 A;  3ROR A; 
#chains in the Genus database with same CATH topology
 4U73 A;  2EVM A;  3BIP A;  2GZ5 A;  3L24 A;  5JFR A;  4KM3 A;  4S01 A;  2GG8 A;  4MAT A;  4FUK A;  1WLR A;  4IKR A;  4U70 A;  1YW7 A;  2BHB A;  4S00 A;  1C27 A;  1WL6 A;  2B3H A;  1N51 A;  2V3Z A;  2BWX A;  2BWW A;  1YJ3 A;  1C22 A;  2V3X A;  4IU6 A;  2MAT A;  1JAW A;  2GTX A;  2Q94 A;  3PKB A;  4U6J A;  2B3L A;  2Q92 A;  2GG5 A;  4U1B A;  4IDY A;  2GU5 A;  4IPA A;  4A6W A;  2GG9 A;  2BN7 A;  2GG3 A;  1M35 A;  2EA4 A;  3IG4 A;  3FMR A;  2BHD A;  4RZZ A;  1XGS A;  3MAT A;  1KQ0 A;  2EVO A;  3BIT A;  4S2R P;  2GG2 A;  3S6B A;  1QZY A;  4OOK A;  3D27 A;  2GU7 A;  4U6Z A;  4RZY A;  1Y1N A;  3FM3 A;  1W7V A;  2BH3 A;  2GA2 A;  4IEC A;  2BHC A;  2GU4 A;  4ZNG A;  2IW2 A;  5D6E A;  3RVA A;  4FLJ A;  1YW8 A;  5CDL A;  5CIK A;  5CNX A;  2V6C A;  4R60 A;  2NQ6 A;  2BWV A;  2GG0 A;  3PKE A;  1A16 A;  4ZWU A;  1C23 A;  1XNZ A;  4IF7 A;  1C24 A;  1CHM A;  3MX6 A;  4ZWO A;  4A6V A;  1R5H A;  2BHA A;  2BWS A;  4FLI A;  4B28 A;  2DFI A;  1O0X A;  3MR1 A;  4IKT A;  1WBQ A;  5FCF A;  3BIQ A;  2GGC A;  1KP0 A;  3CB5 A;  2ZSG A;  2BB7 A;  5JHU A;  2ADU A;  2OAZ A;  3TB5 A;  3IU7 A;  2GG7 A;  4FO8 A;  3TAV A;  4FKC A;  5CE6 A;  2EA2 A;  1QXZ A;  4RGZ 1;  4FLK A;  1WKM A;  1KQ9 A;  1BOA A;  5D6F A;  4S2T P;  4U6W A;  2P98 A;  2G6P A;  2BWU A;  5CDE A;  1QXW A;  4JUQ A;  1C21 A;  2GGB A;  5FCH A;  1WL9 A;  4ZWP A;  1XGN A;  4PV4 A;  4U75 A;  2OKN A;  3L7G A;  2V3Y A;  3CB6 A;  1XGM A;  4FLL A;  2BWY A;  2GU6 A;  4U69 A;  2Q8K A;  2BWT A;  4QR8 A;  2P9A A;  4U6C A;  1B6A A;  2HOW A;  1XGO A;  1YW9 A;  2Q93 A;  3PKC A;  5CDV A;  2P99 A;  4HXX A;  1W2M A;  2EVC A;  3IU8 A;  1PV9 A;  3IU9 A;  3CTZ A;  5E5B A;  3PKD A;  2NQ7 A;  1BN5 A;  1R5G A;  1YVM A;  1WY2 A;  4IKU A;  4IKS A;  4PNC A;  3Q6D A;  4U6E A;  4Z7M A;  2B3K A;  5JI6 A;  3FMQ A;  2Q95 A;  1QXY A;  4EGE A;  1MAT A;  4U76 A;  4FO7 A;  2Q96 A;  4U71 A;  5CLS A;  1R58 A;  3PKA A;  1WN1 A;  1B59 A;  3ROR A; 
#chains in the Genus database with same CATH homology
 4U73 A;  2EVM A;  3BIP A;  2GZ5 A;  3L24 A;  5JFR A;  4KM3 A;  4S01 A;  2GG8 A;  4MAT A;  4FUK A;  1WLR A;  4IKR A;  4U70 A;  1YW7 A;  2BHB A;  4S00 A;  1C27 A;  1WL6 A;  2B3H A;  1N51 A;  2V3Z A;  2BWX A;  2BWW A;  1YJ3 A;  1C22 A;  2V3X A;  4IU6 A;  2MAT A;  1JAW A;  2GTX A;  2Q94 A;  3PKB A;  4U6J A;  2B3L A;  2Q92 A;  2GG5 A;  4U1B A;  4IDY A;  2GU5 A;  4IPA A;  4A6W A;  2GG9 A;  2BN7 A;  2GG3 A;  1M35 A;  2EA4 A;  3IG4 A;  3FMR A;  2BHD A;  4RZZ A;  1XGS A;  3MAT A;  1KQ0 A;  2EVO A;  3BIT A;  4S2R P;  2GG2 A;  3S6B A;  1QZY A;  4OOK A;  3D27 A;  2GU7 A;  4U6Z A;  4RZY A;  1Y1N A;  3FM3 A;  1W7V A;  2BH3 A;  2GA2 A;  4IEC A;  2BHC A;  2GU4 A;  4ZNG A;  2IW2 A;  5D6E A;  3RVA A;  4FLJ A;  1YW8 A;  5CDL A;  5CIK A;  5CNX A;  2V6C A;  4R60 A;  2NQ6 A;  2BWV A;  2GG0 A;  3PKE A;  1A16 A;  4ZWU A;  1C23 A;  1XNZ A;  4IF7 A;  1C24 A;  1CHM A;  3MX6 A;  4ZWO A;  4A6V A;  1R5H A;  2BHA A;  2BWS A;  4FLI A;  4B28 A;  2DFI A;  1O0X A;  3MR1 A;  4IKT A;  1WBQ A;  5FCF A;  3BIQ A;  2GGC A;  1KP0 A;  3CB5 A;  2ZSG A;  2BB7 A;  5JHU A;  2ADU A;  2OAZ A;  3TB5 A;  3IU7 A;  2GG7 A;  4FO8 A;  3TAV A;  4FKC A;  5CE6 A;  2EA2 A;  1QXZ A;  4RGZ 1;  4FLK A;  1WKM A;  1KQ9 A;  1BOA A;  5D6F A;  4S2T P;  4U6W A;  2P98 A;  2G6P A;  2BWU A;  5CDE A;  1QXW A;  4JUQ A;  1C21 A;  2GGB A;  5FCH A;  1WL9 A;  4ZWP A;  1XGN A;  4PV4 A;  4U75 A;  2OKN A;  3L7G A;  2V3Y A;  3CB6 A;  1XGM A;  4FLL A;  2BWY A;  2GU6 A;  4U69 A;  2Q8K A;  2BWT A;  4QR8 A;  2P9A A;  4U6C A;  1B6A A;  2HOW A;  1XGO A;  1YW9 A;  2Q93 A;  3PKC A;  5CDV A;  2P99 A;  4HXX A;  1W2M A;  2EVC A;  3IU8 A;  1PV9 A;  3IU9 A;  3CTZ A;  5E5B A;  3PKD A;  2NQ7 A;  1BN5 A;  1R5G A;  1YVM A;  1WY2 A;  4IKU A;  4IKS A;  4PNC A;  3Q6D A;  4U6E A;  4Z7M A;  2B3K A;  5JI6 A;  3FMQ A;  2Q95 A;  1QXY A;  4EGE A;  1MAT A;  4U76 A;  4FO7 A;  2Q96 A;  4U71 A;  5CLS A;  1R58 A;  3PKA A;  1WN1 A;  1B59 A;  3ROR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...