2GZ5A

Human type 1 methionine aminopeptidase in complex with ovalicin at 1.1 ang
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the angiogenesis inhibitor ovalicin bound to its noncognate target, human Type 1 methionine aminopeptidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gz5A00
2GU6A 2V3YA 1KP0A 3TAVA 1KQ0A 1WL6A 2GU7A 4S2RP 2OKNA 1XGSA 2Q8KA 2P98A 2ZSGA 2BWYA 3IG4A 3Q6DA 4FLKA 2BHDA 1WN1A 2BWSA 1O0XA 1WL9A 4IKTA 1QXWA 4OOKA 4PV4A 2BHCA 1XGOA 4FUKA 2GU5A 1C21A 1N51A 2P99A 4U6CA 4U6JA 2BWUA 4IF7A 1PV9A 1W7VA 1KQ9A 4IU6A 5JHUA 3FM3A 2GGBA 4IDYA 2GG2A 2BWWA 3CB6A 4U75A 2EVMA 1YW7A 5CDVA 3PKEA 2GG8A 5JFRA 2Q93A 3MR1A 4U73A 3D27A 1YW8A 1WY2A 2DFIA 2V3ZA 4R60A 1XGMA 2BWTA 5CNXA 1C23A 2V6CA 1XNZA 1BOAA 3MX6A 1C22A 2Q92A 3PKCA 4ZWUA 3IU7A 4PNCA 2Q94A 2Q95A 1YJ3A 4S00A 2GZ5A 1MATA 4U6EA 2Q96A 3RORA 2GG9A 1QXZA 4IKSA 4U76A 2BHAA 3IU8A 4S01A 4FO7A 2GU4A 4ZNGA 4ZWOA 2GG3A 5D6EA 5FCHA 1C24A 3BIQA 2GG0A 1BN5A 3FMRA 2EVOA 4RGZ1 1A16A 3CB5A 5JI6A 2ADUA 4B28A 3L7GA 2B3HA 2MATA 4S2TP 5CE6A 4FLLA 4MATA 3PKAA 1R58A 2BH3A 4FO8A 2HOWA 4FLJA 1Y1NA 2B3LA 4FLIA 5D6FA 1YVMA 4U6WA 1QXYA 3TB5A 3IU9A 1W2MA 2BWXA 2GA2A 4Z7MA 2GG7A 1XGNA 1R5GA 1JAWA 5CLSA 3RVAA 3MATA 1R5HA 2BWVA 2GGCA 2BHBA 2IW2A 1WKMA 2P9AA 4U6ZA 4IECA 5CDLA 4U70A 1QZYA 5FCFA 2GTXA 4ZWPA 4FKCA 4IKUA 2OAZA 4QR8A 3CTZA 2EA2A 2EVCA 3PKBA 4RZYA 4U71A 5E5BA 4EGEA 4KM3A 4A6WA 4RZZA 3S6BA 1M35A 3L24A 4U1BA 2BN7A 1WLRA 2NQ7A 3FMQA 2V3XA 2G6PA 5CIKA 1YW9A 4HXXA 2GG5A 1WBQA 4A6VA 3BIPA 1B59A 3PKDA 2B3KA 4JUQA 1CHMA 4IPAA 2BB7A 4U69A 4IKRA 3BITA 1B6AA 5CDEA 2EA4A 1C27A 2NQ6A
chains in the Genus database with same CATH superfamily
2GU6A 2V3YA 1KP0A 3TAVA 1KQ0A 1WL6A 2GU7A 4S2RP 2OKNA 1XGSA 2Q8KA 2P98A 2ZSGA 2BWYA 3IG4A 3Q6DA 4FLKA 2BHDA 1WN1A 2BWSA 1O0XA 1WL9A 4IKTA 1QXWA 4OOKA 4PV4A 2BHCA 1XGOA 4FUKA 2GU5A 1C21A 1N51A 2P99A 4U6CA 4U6JA 2BWUA 4IF7A 1PV9A 1W7VA 1KQ9A 4IU6A 5JHUA 3FM3A 2GGBA 4IDYA 2GG2A 2BWWA 3CB6A 4U75A 2EVMA 1YW7A 5CDVA 3PKEA 2GG8A 5JFRA 2Q93A 3MR1A 4U73A 3D27A 1YW8A 1WY2A 2DFIA 2V3ZA 4R60A 1XGMA 2BWTA 5CNXA 1C23A 2V6CA 1XNZA 1BOAA 3MX6A 1C22A 2Q92A 3PKCA 4ZWUA 3IU7A 4PNCA 2Q94A 2Q95A 1YJ3A 4S00A 2GZ5A 1MATA 4U6EA 2Q96A 3RORA 2GG9A 1QXZA 4IKSA 4U76A 2BHAA 3IU8A 4S01A 4FO7A 2GU4A 4ZNGA 4ZWOA 2GG3A 5D6EA 5FCHA 1C24A 3BIQA 2GG0A 1BN5A 3FMRA 2EVOA 4RGZ1 1A16A 3CB5A 5JI6A 2ADUA 4B28A 3L7GA 2B3HA 2MATA 4S2TP 5CE6A 4FLLA 4MATA 3PKAA 1R58A 2BH3A 4FO8A 2HOWA 4FLJA 1Y1NA 2B3LA 4FLIA 5D6FA 1YVMA 4U6WA 1QXYA 3TB5A 3IU9A 1W2MA 2BWXA 2GA2A 4Z7MA 2GG7A 1XGNA 1R5GA 1JAWA 5CLSA 3RVAA 3MATA 1R5HA 2BWVA 2GGCA 2BHBA 2IW2A 1WKMA 2P9AA 4U6ZA 4IECA 5CDLA 4U70A 1QZYA 5FCFA 2GTXA 4ZWPA 4FKCA 4IKUA 2OAZA 4QR8A 3CTZA 2EA2A 2EVCA 3PKBA 4RZYA 4U71A 5E5BA 4EGEA 4KM3A 4A6WA 4RZZA 3S6BA 1M35A 3L24A 4U1BA 2BN7A 1WLRA 2NQ7A 3FMQA 2V3XA 2G6PA 5CIKA 1YW9A 4HXXA 2GG5A 1WBQA 4A6VA 3BIPA 1B59A 3PKDA 2B3KA 4JUQA 1CHMA 4IPAA 2BB7A 4U69A 4IKRA 3BITA 1B6AA 5CDEA 2EA4A 1C27A 2NQ6A
chains in the Genus database with same CATH topology
2GU6A 2V3YA 1KP0A 3TAVA 1KQ0A 1WL6A 2GU7A 4S2RP 2OKNA 1XGSA 2Q8KA 2P98A 2ZSGA 2BWYA 3IG4A 3Q6DA 4FLKA 2BHDA 1WN1A 2BWSA 1O0XA 1WL9A 4IKTA 1QXWA 4OOKA 4PV4A 2BHCA 1XGOA 4FUKA 2GU5A 1C21A 1N51A 2P99A 4U6CA 4U6JA 2BWUA 4IF7A 1PV9A 1W7VA 1KQ9A 4IU6A 5JHUA 3FM3A 2GGBA 4IDYA 2GG2A 2BWWA 3CB6A 4U75A 2EVMA 1YW7A 5CDVA 3PKEA 2GG8A 5JFRA 2Q93A 3MR1A 4U73A 3D27A 1YW8A 1WY2A 2DFIA 2V3ZA 4R60A 1XGMA 2BWTA 5CNXA 1C23A 2V6CA 1XNZA 1BOAA 3MX6A 1C22A 2Q92A 3PKCA 4ZWUA 3IU7A 4PNCA 2Q94A 2Q95A 1YJ3A 4S00A 2GZ5A 1MATA 4U6EA 2Q96A 3RORA 2GG9A 1QXZA 4IKSA 4U76A 2BHAA 3IU8A 4S01A 4FO7A 2GU4A 4ZNGA 4ZWOA 2GG3A 5D6EA 5FCHA 1C24A 3BIQA 2GG0A 1BN5A 3FMRA 2EVOA 4RGZ1 1A16A 3CB5A 5JI6A 2ADUA 4B28A 3L7GA 2B3HA 2MATA 4S2TP 5CE6A 4FLLA 4MATA 3PKAA 1R58A 2BH3A 4FO8A 2HOWA 4FLJA 1Y1NA 2B3LA 4FLIA 5D6FA 1YVMA 4U6WA 1QXYA 3TB5A 3IU9A 1W2MA 2BWXA 2GA2A 4Z7MA 2GG7A 1XGNA 1R5GA 1JAWA 5CLSA 3RVAA 3MATA 1R5HA 2BWVA 2GGCA 2BHBA 2IW2A 1WKMA 2P9AA 4U6ZA 4IECA 5CDLA 4U70A 1QZYA 5FCFA 2GTXA 4ZWPA 4FKCA 4IKUA 2OAZA 4QR8A 3CTZA 2EA2A 2EVCA 3PKBA 4RZYA 4U71A 5E5BA 4EGEA 4KM3A 4A6WA 4RZZA 3S6BA 1M35A 3L24A 4U1BA 2BN7A 1WLRA 2NQ7A 3FMQA 2V3XA 2G6PA 5CIKA 1YW9A 4HXXA 2GG5A 1WBQA 4A6VA 3BIPA 1B59A 3PKDA 2B3KA 4JUQA 1CHMA 4IPAA 2BB7A 4U69A 4IKRA 3BITA 1B6AA 5CDEA 2EA4A 1C27A 2NQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GU6 A;  2V3Y A;  1KP0 A;  3TAV A;  1KQ0 A;  1WL6 A;  2GU7 A;  4S2R P;  2OKN A;  1XGS A;  2Q8K A;  2P98 A;  2ZSG A;  2BWY A;  3IG4 A;  3Q6D A;  4FLK A;  2BHD A;  1WN1 A;  2BWS A;  1O0X A;  1WL9 A;  4IKT A;  1QXW A;  4OOK A;  4PV4 A;  2BHC A;  1XGO A;  4FUK A;  2GU5 A;  1C21 A;  1N51 A;  2P99 A;  4U6C A;  4U6J A;  2BWU A;  4IF7 A;  1PV9 A;  1W7V A;  1KQ9 A;  4IU6 A;  5JHU A;  3FM3 A;  2GGB A;  4IDY A;  2GG2 A;  2BWW A;  3CB6 A;  4U75 A;  2EVM A;  1YW7 A;  5CDV A;  3PKE A;  2GG8 A;  5JFR A;  2Q93 A;  3MR1 A;  4U73 A;  3D27 A;  1YW8 A;  1WY2 A;  2DFI A;  2V3Z A;  4R60 A;  1XGM A;  2BWT A;  5CNX A;  1C23 A;  2V6C A;  1XNZ A;  1BOA A;  3MX6 A;  1C22 A;  2Q92 A;  3PKC A;  4ZWU A;  3IU7 A;  4PNC A;  2Q94 A;  2Q95 A;  1YJ3 A;  4S00 A;  2GZ5 A;  1MAT A;  4U6E A;  2Q96 A;  3ROR A;  2GG9 A;  1QXZ A;  4IKS A;  4U76 A;  2BHA A;  3IU8 A;  4S01 A;  4FO7 A;  2GU4 A;  4ZNG A;  4ZWO A;  2GG3 A;  5D6E A;  5FCH A;  1C24 A;  3BIQ A;  2GG0 A;  1BN5 A;  3FMR A;  2EVO A;  4RGZ 1;  1A16 A;  3CB5 A;  5JI6 A;  2ADU A;  4B28 A;  3L7G A;  2B3H A;  2MAT A;  4S2T P;  5CE6 A;  4FLL A;  4MAT A;  3PKA A;  1R58 A;  2BH3 A;  4FO8 A;  2HOW A;  4FLJ A;  1Y1N A;  2B3L A;  4FLI A;  5D6F A;  1YVM A;  4U6W A;  1QXY A;  3TB5 A;  3IU9 A;  1W2M A;  2BWX A;  2GA2 A;  4Z7M A;  2GG7 A;  1XGN A;  1R5G A;  1JAW A;  5CLS A;  3RVA A;  3MAT A;  1R5H A;  2BWV A;  2GGC A;  2BHB A;  2IW2 A;  1WKM A;  2P9A A;  4U6Z A;  4IEC A;  5CDL A;  4U70 A;  1QZY A;  5FCF A;  2GTX A;  4ZWP A;  4FKC A;  4IKU A;  2OAZ A;  4QR8 A;  3CTZ A;  2EA2 A;  2EVC A;  3PKB A;  4RZY A;  4U71 A;  5E5B A;  4EGE A;  4KM3 A;  4A6W A;  4RZZ A;  3S6B A;  1M35 A;  3L24 A;  4U1B A;  2BN7 A;  1WLR A;  2NQ7 A;  3FMQ A;  2V3X A;  2G6P A;  5CIK A;  1YW9 A;  4HXX A;  2GG5 A;  1WBQ A;  4A6V A;  3BIP A;  1B59 A;  3PKD A;  2B3K A;  4JUQ A;  1CHM A;  4IPA A;  2BB7 A;  4U69 A;  4IKR A;  3BIT A;  1B6A A;  5CDE A;  2EA4 A;  1C27 A;  2NQ6 A; 
#chains in the Genus database with same CATH topology
 2GU6 A;  2V3Y A;  1KP0 A;  3TAV A;  1KQ0 A;  1WL6 A;  2GU7 A;  4S2R P;  2OKN A;  1XGS A;  2Q8K A;  2P98 A;  2ZSG A;  2BWY A;  3IG4 A;  3Q6D A;  4FLK A;  2BHD A;  1WN1 A;  2BWS A;  1O0X A;  1WL9 A;  4IKT A;  1QXW A;  4OOK A;  4PV4 A;  2BHC A;  1XGO A;  4FUK A;  2GU5 A;  1C21 A;  1N51 A;  2P99 A;  4U6C A;  4U6J A;  2BWU A;  4IF7 A;  1PV9 A;  1W7V A;  1KQ9 A;  4IU6 A;  5JHU A;  3FM3 A;  2GGB A;  4IDY A;  2GG2 A;  2BWW A;  3CB6 A;  4U75 A;  2EVM A;  1YW7 A;  5CDV A;  3PKE A;  2GG8 A;  5JFR A;  2Q93 A;  3MR1 A;  4U73 A;  3D27 A;  1YW8 A;  1WY2 A;  2DFI A;  2V3Z A;  4R60 A;  1XGM A;  2BWT A;  5CNX A;  1C23 A;  2V6C A;  1XNZ A;  1BOA A;  3MX6 A;  1C22 A;  2Q92 A;  3PKC A;  4ZWU A;  3IU7 A;  4PNC A;  2Q94 A;  2Q95 A;  1YJ3 A;  4S00 A;  2GZ5 A;  1MAT A;  4U6E A;  2Q96 A;  3ROR A;  2GG9 A;  1QXZ A;  4IKS A;  4U76 A;  2BHA A;  3IU8 A;  4S01 A;  4FO7 A;  2GU4 A;  4ZNG A;  4ZWO A;  2GG3 A;  5D6E A;  5FCH A;  1C24 A;  3BIQ A;  2GG0 A;  1BN5 A;  3FMR A;  2EVO A;  4RGZ 1;  1A16 A;  3CB5 A;  5JI6 A;  2ADU A;  4B28 A;  3L7G A;  2B3H A;  2MAT A;  4S2T P;  5CE6 A;  4FLL A;  4MAT A;  3PKA A;  1R58 A;  2BH3 A;  4FO8 A;  2HOW A;  4FLJ A;  1Y1N A;  2B3L A;  4FLI A;  5D6F A;  1YVM A;  4U6W A;  1QXY A;  3TB5 A;  3IU9 A;  1W2M A;  2BWX A;  2GA2 A;  4Z7M A;  2GG7 A;  1XGN A;  1R5G A;  1JAW A;  5CLS A;  3RVA A;  3MAT A;  1R5H A;  2BWV A;  2GGC A;  2BHB A;  2IW2 A;  1WKM A;  2P9A A;  4U6Z A;  4IEC A;  5CDL A;  4U70 A;  1QZY A;  5FCF A;  2GTX A;  4ZWP A;  4FKC A;  4IKU A;  2OAZ A;  4QR8 A;  3CTZ A;  2EA2 A;  2EVC A;  3PKB A;  4RZY A;  4U71 A;  5E5B A;  4EGE A;  4KM3 A;  4A6W A;  4RZZ A;  3S6B A;  1M35 A;  3L24 A;  4U1B A;  2BN7 A;  1WLR A;  2NQ7 A;  3FMQ A;  2V3X A;  2G6P A;  5CIK A;  1YW9 A;  4HXX A;  2GG5 A;  1WBQ A;  4A6V A;  3BIP A;  1B59 A;  3PKD A;  2B3K A;  4JUQ A;  1CHM A;  4IPA A;  2BB7 A;  4U69 A;  4IKR A;  3BIT A;  1B6A A;  5CDE A;  2EA4 A;  1C27 A;  2NQ6 A; 
#chains in the Genus database with same CATH homology
 2GU6 A;  2V3Y A;  1KP0 A;  3TAV A;  1KQ0 A;  1WL6 A;  2GU7 A;  4S2R P;  2OKN A;  1XGS A;  2Q8K A;  2P98 A;  2ZSG A;  2BWY A;  3IG4 A;  3Q6D A;  4FLK A;  2BHD A;  1WN1 A;  2BWS A;  1O0X A;  1WL9 A;  4IKT A;  1QXW A;  4OOK A;  4PV4 A;  2BHC A;  1XGO A;  4FUK A;  2GU5 A;  1C21 A;  1N51 A;  2P99 A;  4U6C A;  4U6J A;  2BWU A;  4IF7 A;  1PV9 A;  1W7V A;  1KQ9 A;  4IU6 A;  5JHU A;  3FM3 A;  2GGB A;  4IDY A;  2GG2 A;  2BWW A;  3CB6 A;  4U75 A;  2EVM A;  1YW7 A;  5CDV A;  3PKE A;  2GG8 A;  5JFR A;  2Q93 A;  3MR1 A;  4U73 A;  3D27 A;  1YW8 A;  1WY2 A;  2DFI A;  2V3Z A;  4R60 A;  1XGM A;  2BWT A;  5CNX A;  1C23 A;  2V6C A;  1XNZ A;  1BOA A;  3MX6 A;  1C22 A;  2Q92 A;  3PKC A;  4ZWU A;  3IU7 A;  4PNC A;  2Q94 A;  2Q95 A;  1YJ3 A;  4S00 A;  2GZ5 A;  1MAT A;  4U6E A;  2Q96 A;  3ROR A;  2GG9 A;  1QXZ A;  4IKS A;  4U76 A;  2BHA A;  3IU8 A;  4S01 A;  4FO7 A;  2GU4 A;  4ZNG A;  4ZWO A;  2GG3 A;  5D6E A;  5FCH A;  1C24 A;  3BIQ A;  2GG0 A;  1BN5 A;  3FMR A;  2EVO A;  4RGZ 1;  1A16 A;  3CB5 A;  5JI6 A;  2ADU A;  4B28 A;  3L7G A;  2B3H A;  2MAT A;  4S2T P;  5CE6 A;  4FLL A;  4MAT A;  3PKA A;  1R58 A;  2BH3 A;  4FO8 A;  2HOW A;  4FLJ A;  1Y1N A;  2B3L A;  4FLI A;  5D6F A;  1YVM A;  4U6W A;  1QXY A;  3TB5 A;  3IU9 A;  1W2M A;  2BWX A;  2GA2 A;  4Z7M A;  2GG7 A;  1XGN A;  1R5G A;  1JAW A;  5CLS A;  3RVA A;  3MAT A;  1R5H A;  2BWV A;  2GGC A;  2BHB A;  2IW2 A;  1WKM A;  2P9A A;  4U6Z A;  4IEC A;  5CDL A;  4U70 A;  1QZY A;  5FCF A;  2GTX A;  4ZWP A;  4FKC A;  4IKU A;  2OAZ A;  4QR8 A;  3CTZ A;  2EA2 A;  2EVC A;  3PKB A;  4RZY A;  4U71 A;  5E5B A;  4EGE A;  4KM3 A;  4A6W A;  4RZZ A;  3S6B A;  1M35 A;  3L24 A;  4U1B A;  2BN7 A;  1WLR A;  2NQ7 A;  3FMQ A;  2V3X A;  2G6P A;  5CIK A;  1YW9 A;  4HXX A;  2GG5 A;  1WBQ A;  4A6V A;  3BIP A;  1B59 A;  3PKD A;  2B3K A;  4JUQ A;  1CHM A;  4IPA A;  2BB7 A;  4U69 A;  4IKR A;  3BIT A;  1B6A A;  5CDE A;  2EA4 A;  1C27 A;  2NQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...