4U69A

Hsmetap complex with (1-amino-2-methylpentyl)phosphonic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u69A00
1N51A 4ZNGA 4FO7A 2ZSGA 4U76A 1XNZA 1KP0A 1YJ3A 4S2RP 1W7VA 1A16A 1O0XA 2GG7A 5D6FA 5E5BA 5FCFA 2EVOA 2P9AA 3TAVA 1B6AA 2GG3A 2V3YA 5JFRA 2B3HA 4HXXA 4U6JA 4FLIA 4IDYA 2V6CA 3PKEA 4IF7A 4IKUA 3PKCA 2B3LA 1M35A 1PV9A 1CHMA 2BWUA 2MATA 3PKAA 4JUQA 2IW2A 1C22A 4U75A 5FCHA 1JAWA 3L7GA 3PKBA 4U71A 1YW9A 2V3ZA 1XGNA 1QZYA 3FMQA 1WBQA 3MR1A 3IU9A 4U6CA 4U6WA 4IU6A 4OOKA 1R5GA 2GTXA 1WL6A 2GU4A 2NQ7A 2DFIA 4R60A 4ZWPA 2NQ6A 1WLRA 2BH3A 5CDLA 1XGMA 2B3KA 4S2TP 1WY2A 4FKCA 1YVMA 4FLKA 4ZWOA 3CB5A 1C23A 2EA4A 5CIKA 1Y1NA 1BOAA 4EGEA 1R58A 4RZZA 4IECA 4IKTA 5CLSA 2GG8A 5CDEA 3L24A 4A6WA 1WL9A 3BITA 2BWXA 4U6EA 2GG0A 2BWWA 3FMRA 2BWTA 2GU6A 2BN7A 2BHDA 1MATA 4FLLA 2GGBA 2GU5A 1QXWA 1BN5A 1KQ9A 1XGOA 3CTZA 1WN1A 2P99A 4U73A 5CNXA 2GA2A 2Q95A 4PNCA 2EA2A 1C24A 2ADUA 2OKNA 2BB7A 2Q8KA 2Q92A 2Q96A 3Q6DA 3MX6A 3BIPA 3TB5A 1W2MA 2EVCA 4MATA 5D6EA 2BWYA 2GZ5A 5JHUA 3FM3A 4U70A 1KQ0A 1YW7A 2BHBA 3IG4A 4FO8A 3BIQA 3RORA 1R5HA 2BHAA 2G6PA 2BWSA 4A6VA 3CB6A 5CDVA 2OAZA 4S01A 3RVAA 3MATA 3S6BA 4U6ZA 2BHCA 2BWVA 2GG9A 4FUKA 4RGZ1 1C21A 3IU8A 1YW8A 4S00A 4U1BA 2GU7A 1QXZA 4IPAA 4B28A 2Q94A 1QXYA 4QR8A 4Z7MA 2GG5A 2GGCA 4RZYA 4IKSA 1C27A 4U69A 4FLJA 4KM3A 3IU7A 2GG2A 1XGSA 1B59A 2HOWA 5CE6A 5JI6A 4IKRA 3D27A 3PKDA 4ZWUA 2V3XA 2Q93A 1WKMA 4PV4A 2EVMA 2P98A
chains in the Genus database with same CATH superfamily
1N51A 4ZNGA 4FO7A 2ZSGA 4U76A 1XNZA 1KP0A 1YJ3A 4S2RP 1W7VA 1A16A 1O0XA 2GG7A 5D6FA 5E5BA 5FCFA 2EVOA 2P9AA 3TAVA 1B6AA 2GG3A 2V3YA 5JFRA 2B3HA 4HXXA 4U6JA 4FLIA 4IDYA 2V6CA 3PKEA 4IF7A 4IKUA 3PKCA 2B3LA 1M35A 1PV9A 1CHMA 2BWUA 2MATA 3PKAA 4JUQA 2IW2A 1C22A 4U75A 5FCHA 1JAWA 3L7GA 3PKBA 4U71A 1YW9A 2V3ZA 1XGNA 1QZYA 3FMQA 1WBQA 3MR1A 3IU9A 4U6CA 4U6WA 4IU6A 4OOKA 1R5GA 2GTXA 1WL6A 2GU4A 2NQ7A 2DFIA 4R60A 4ZWPA 2NQ6A 1WLRA 2BH3A 5CDLA 1XGMA 2B3KA 4S2TP 1WY2A 4FKCA 1YVMA 4FLKA 4ZWOA 3CB5A 1C23A 2EA4A 5CIKA 1Y1NA 1BOAA 4EGEA 1R58A 4RZZA 4IECA 4IKTA 5CLSA 2GG8A 5CDEA 3L24A 4A6WA 1WL9A 3BITA 2BWXA 4U6EA 2GG0A 2BWWA 3FMRA 2BWTA 2GU6A 2BN7A 2BHDA 1MATA 4FLLA 2GGBA 2GU5A 1QXWA 1BN5A 1KQ9A 1XGOA 3CTZA 1WN1A 2P99A 4U73A 5CNXA 2GA2A 2Q95A 4PNCA 2EA2A 1C24A 2ADUA 2OKNA 2BB7A 2Q8KA 2Q92A 2Q96A 3Q6DA 3MX6A 3BIPA 3TB5A 1W2MA 2EVCA 4MATA 5D6EA 2BWYA 2GZ5A 5JHUA 3FM3A 4U70A 1KQ0A 1YW7A 2BHBA 3IG4A 4FO8A 3BIQA 3RORA 1R5HA 2BHAA 2G6PA 2BWSA 4A6VA 3CB6A 5CDVA 2OAZA 4S01A 3RVAA 3MATA 3S6BA 4U6ZA 2BHCA 2BWVA 2GG9A 4FUKA 4RGZ1 1C21A 3IU8A 1YW8A 4S00A 4U1BA 2GU7A 1QXZA 4IPAA 4B28A 2Q94A 1QXYA 4QR8A 4Z7MA 2GG5A 2GGCA 4RZYA 4IKSA 1C27A 4U69A 4FLJA 4KM3A 3IU7A 2GG2A 1XGSA 1B59A 2HOWA 5CE6A 5JI6A 4IKRA 3D27A 3PKDA 4ZWUA 2V3XA 2Q93A 1WKMA 4PV4A 2EVMA 2P98A
chains in the Genus database with same CATH topology
1N51A 4ZNGA 4FO7A 2ZSGA 4U76A 1XNZA 1KP0A 1YJ3A 4S2RP 1W7VA 1A16A 1O0XA 2GG7A 5D6FA 5E5BA 5FCFA 2EVOA 2P9AA 3TAVA 1B6AA 2GG3A 2V3YA 5JFRA 2B3HA 4HXXA 4U6JA 4FLIA 4IDYA 2V6CA 3PKEA 4IF7A 4IKUA 3PKCA 2B3LA 1M35A 1PV9A 1CHMA 2BWUA 2MATA 3PKAA 4JUQA 2IW2A 1C22A 4U75A 5FCHA 1JAWA 3L7GA 3PKBA 4U71A 1YW9A 2V3ZA 1XGNA 1QZYA 3FMQA 1WBQA 3MR1A 3IU9A 4U6CA 4U6WA 4IU6A 4OOKA 1R5GA 2GTXA 1WL6A 2GU4A 2NQ7A 2DFIA 4R60A 4ZWPA 2NQ6A 1WLRA 2BH3A 5CDLA 1XGMA 2B3KA 4S2TP 1WY2A 4FKCA 1YVMA 4FLKA 4ZWOA 3CB5A 1C23A 2EA4A 5CIKA 1Y1NA 1BOAA 4EGEA 1R58A 4RZZA 4IECA 4IKTA 5CLSA 2GG8A 5CDEA 3L24A 4A6WA 1WL9A 3BITA 2BWXA 4U6EA 2GG0A 2BWWA 3FMRA 2BWTA 2GU6A 2BN7A 2BHDA 1MATA 4FLLA 2GGBA 2GU5A 1QXWA 1BN5A 1KQ9A 1XGOA 3CTZA 1WN1A 2P99A 4U73A 5CNXA 2GA2A 2Q95A 4PNCA 2EA2A 1C24A 2ADUA 2OKNA 2BB7A 2Q8KA 2Q92A 2Q96A 3Q6DA 3MX6A 3BIPA 3TB5A 1W2MA 2EVCA 4MATA 5D6EA 2BWYA 2GZ5A 5JHUA 3FM3A 4U70A 1KQ0A 1YW7A 2BHBA 3IG4A 4FO8A 3BIQA 3RORA 1R5HA 2BHAA 2G6PA 2BWSA 4A6VA 3CB6A 5CDVA 2OAZA 4S01A 3RVAA 3MATA 3S6BA 4U6ZA 2BHCA 2BWVA 2GG9A 4FUKA 4RGZ1 1C21A 3IU8A 1YW8A 4S00A 4U1BA 2GU7A 1QXZA 4IPAA 4B28A 2Q94A 1QXYA 4QR8A 4Z7MA 2GG5A 2GGCA 4RZYA 4IKSA 1C27A 4U69A 4FLJA 4KM3A 3IU7A 2GG2A 1XGSA 1B59A 2HOWA 5CE6A 5JI6A 4IKRA 3D27A 3PKDA 4ZWUA 2V3XA 2Q93A 1WKMA 4PV4A 2EVMA 2P98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N51 A;  4ZNG A;  4FO7 A;  2ZSG A;  4U76 A;  1XNZ A;  1KP0 A;  1YJ3 A;  4S2R P;  1W7V A;  1A16 A;  1O0X A;  2GG7 A;  5D6F A;  5E5B A;  5FCF A;  2EVO A;  2P9A A;  3TAV A;  1B6A A;  2GG3 A;  2V3Y A;  5JFR A;  2B3H A;  4HXX A;  4U6J A;  4FLI A;  4IDY A;  2V6C A;  3PKE A;  4IF7 A;  4IKU A;  3PKC A;  2B3L A;  1M35 A;  1PV9 A;  1CHM A;  2BWU A;  2MAT A;  3PKA A;  4JUQ A;  2IW2 A;  1C22 A;  4U75 A;  5FCH A;  1JAW A;  3L7G A;  3PKB A;  4U71 A;  1YW9 A;  2V3Z A;  1XGN A;  1QZY A;  3FMQ A;  1WBQ A;  3MR1 A;  3IU9 A;  4U6C A;  4U6W A;  4IU6 A;  4OOK A;  1R5G A;  2GTX A;  1WL6 A;  2GU4 A;  2NQ7 A;  2DFI A;  4R60 A;  4ZWP A;  2NQ6 A;  1WLR A;  2BH3 A;  5CDL A;  1XGM A;  2B3K A;  4S2T P;  1WY2 A;  4FKC A;  1YVM A;  4FLK A;  4ZWO A;  3CB5 A;  1C23 A;  2EA4 A;  5CIK A;  1Y1N A;  1BOA A;  4EGE A;  1R58 A;  4RZZ A;  4IEC A;  4IKT A;  5CLS A;  2GG8 A;  5CDE A;  3L24 A;  4A6W A;  1WL9 A;  3BIT A;  2BWX A;  4U6E A;  2GG0 A;  2BWW A;  3FMR A;  2BWT A;  2GU6 A;  2BN7 A;  2BHD A;  1MAT A;  4FLL A;  2GGB A;  2GU5 A;  1QXW A;  1BN5 A;  1KQ9 A;  1XGO A;  3CTZ A;  1WN1 A;  2P99 A;  4U73 A;  5CNX A;  2GA2 A;  2Q95 A;  4PNC A;  2EA2 A;  1C24 A;  2ADU A;  2OKN A;  2BB7 A;  2Q8K A;  2Q92 A;  2Q96 A;  3Q6D A;  3MX6 A;  3BIP A;  3TB5 A;  1W2M A;  2EVC A;  4MAT A;  5D6E A;  2BWY A;  2GZ5 A;  5JHU A;  3FM3 A;  4U70 A;  1KQ0 A;  1YW7 A;  2BHB A;  3IG4 A;  4FO8 A;  3BIQ A;  3ROR A;  1R5H A;  2BHA A;  2G6P A;  2BWS A;  4A6V A;  3CB6 A;  5CDV A;  2OAZ A;  4S01 A;  3RVA A;  3MAT A;  3S6B A;  4U6Z A;  2BHC A;  2BWV A;  2GG9 A;  4FUK A;  4RGZ 1;  1C21 A;  3IU8 A;  1YW8 A;  4S00 A;  4U1B A;  2GU7 A;  1QXZ A;  4IPA A;  4B28 A;  2Q94 A;  1QXY A;  4QR8 A;  4Z7M A;  2GG5 A;  2GGC A;  4RZY A;  4IKS A;  1C27 A;  4U69 A;  4FLJ A;  4KM3 A;  3IU7 A;  2GG2 A;  1XGS A;  1B59 A;  2HOW A;  5CE6 A;  5JI6 A;  4IKR A;  3D27 A;  3PKD A;  4ZWU A;  2V3X A;  2Q93 A;  1WKM A;  4PV4 A;  2EVM A;  2P98 A; 
#chains in the Genus database with same CATH topology
 1N51 A;  4ZNG A;  4FO7 A;  2ZSG A;  4U76 A;  1XNZ A;  1KP0 A;  1YJ3 A;  4S2R P;  1W7V A;  1A16 A;  1O0X A;  2GG7 A;  5D6F A;  5E5B A;  5FCF A;  2EVO A;  2P9A A;  3TAV A;  1B6A A;  2GG3 A;  2V3Y A;  5JFR A;  2B3H A;  4HXX A;  4U6J A;  4FLI A;  4IDY A;  2V6C A;  3PKE A;  4IF7 A;  4IKU A;  3PKC A;  2B3L A;  1M35 A;  1PV9 A;  1CHM A;  2BWU A;  2MAT A;  3PKA A;  4JUQ A;  2IW2 A;  1C22 A;  4U75 A;  5FCH A;  1JAW A;  3L7G A;  3PKB A;  4U71 A;  1YW9 A;  2V3Z A;  1XGN A;  1QZY A;  3FMQ A;  1WBQ A;  3MR1 A;  3IU9 A;  4U6C A;  4U6W A;  4IU6 A;  4OOK A;  1R5G A;  2GTX A;  1WL6 A;  2GU4 A;  2NQ7 A;  2DFI A;  4R60 A;  4ZWP A;  2NQ6 A;  1WLR A;  2BH3 A;  5CDL A;  1XGM A;  2B3K A;  4S2T P;  1WY2 A;  4FKC A;  1YVM A;  4FLK A;  4ZWO A;  3CB5 A;  1C23 A;  2EA4 A;  5CIK A;  1Y1N A;  1BOA A;  4EGE A;  1R58 A;  4RZZ A;  4IEC A;  4IKT A;  5CLS A;  2GG8 A;  5CDE A;  3L24 A;  4A6W A;  1WL9 A;  3BIT A;  2BWX A;  4U6E A;  2GG0 A;  2BWW A;  3FMR A;  2BWT A;  2GU6 A;  2BN7 A;  2BHD A;  1MAT A;  4FLL A;  2GGB A;  2GU5 A;  1QXW A;  1BN5 A;  1KQ9 A;  1XGO A;  3CTZ A;  1WN1 A;  2P99 A;  4U73 A;  5CNX A;  2GA2 A;  2Q95 A;  4PNC A;  2EA2 A;  1C24 A;  2ADU A;  2OKN A;  2BB7 A;  2Q8K A;  2Q92 A;  2Q96 A;  3Q6D A;  3MX6 A;  3BIP A;  3TB5 A;  1W2M A;  2EVC A;  4MAT A;  5D6E A;  2BWY A;  2GZ5 A;  5JHU A;  3FM3 A;  4U70 A;  1KQ0 A;  1YW7 A;  2BHB A;  3IG4 A;  4FO8 A;  3BIQ A;  3ROR A;  1R5H A;  2BHA A;  2G6P A;  2BWS A;  4A6V A;  3CB6 A;  5CDV A;  2OAZ A;  4S01 A;  3RVA A;  3MAT A;  3S6B A;  4U6Z A;  2BHC A;  2BWV A;  2GG9 A;  4FUK A;  4RGZ 1;  1C21 A;  3IU8 A;  1YW8 A;  4S00 A;  4U1B A;  2GU7 A;  1QXZ A;  4IPA A;  4B28 A;  2Q94 A;  1QXY A;  4QR8 A;  4Z7M A;  2GG5 A;  2GGC A;  4RZY A;  4IKS A;  1C27 A;  4U69 A;  4FLJ A;  4KM3 A;  3IU7 A;  2GG2 A;  1XGS A;  1B59 A;  2HOW A;  5CE6 A;  5JI6 A;  4IKR A;  3D27 A;  3PKD A;  4ZWU A;  2V3X A;  2Q93 A;  1WKM A;  4PV4 A;  2EVM A;  2P98 A; 
#chains in the Genus database with same CATH homology
 1N51 A;  4ZNG A;  4FO7 A;  2ZSG A;  4U76 A;  1XNZ A;  1KP0 A;  1YJ3 A;  4S2R P;  1W7V A;  1A16 A;  1O0X A;  2GG7 A;  5D6F A;  5E5B A;  5FCF A;  2EVO A;  2P9A A;  3TAV A;  1B6A A;  2GG3 A;  2V3Y A;  5JFR A;  2B3H A;  4HXX A;  4U6J A;  4FLI A;  4IDY A;  2V6C A;  3PKE A;  4IF7 A;  4IKU A;  3PKC A;  2B3L A;  1M35 A;  1PV9 A;  1CHM A;  2BWU A;  2MAT A;  3PKA A;  4JUQ A;  2IW2 A;  1C22 A;  4U75 A;  5FCH A;  1JAW A;  3L7G A;  3PKB A;  4U71 A;  1YW9 A;  2V3Z A;  1XGN A;  1QZY A;  3FMQ A;  1WBQ A;  3MR1 A;  3IU9 A;  4U6C A;  4U6W A;  4IU6 A;  4OOK A;  1R5G A;  2GTX A;  1WL6 A;  2GU4 A;  2NQ7 A;  2DFI A;  4R60 A;  4ZWP A;  2NQ6 A;  1WLR A;  2BH3 A;  5CDL A;  1XGM A;  2B3K A;  4S2T P;  1WY2 A;  4FKC A;  1YVM A;  4FLK A;  4ZWO A;  3CB5 A;  1C23 A;  2EA4 A;  5CIK A;  1Y1N A;  1BOA A;  4EGE A;  1R58 A;  4RZZ A;  4IEC A;  4IKT A;  5CLS A;  2GG8 A;  5CDE A;  3L24 A;  4A6W A;  1WL9 A;  3BIT A;  2BWX A;  4U6E A;  2GG0 A;  2BWW A;  3FMR A;  2BWT A;  2GU6 A;  2BN7 A;  2BHD A;  1MAT A;  4FLL A;  2GGB A;  2GU5 A;  1QXW A;  1BN5 A;  1KQ9 A;  1XGO A;  3CTZ A;  1WN1 A;  2P99 A;  4U73 A;  5CNX A;  2GA2 A;  2Q95 A;  4PNC A;  2EA2 A;  1C24 A;  2ADU A;  2OKN A;  2BB7 A;  2Q8K A;  2Q92 A;  2Q96 A;  3Q6D A;  3MX6 A;  3BIP A;  3TB5 A;  1W2M A;  2EVC A;  4MAT A;  5D6E A;  2BWY A;  2GZ5 A;  5JHU A;  3FM3 A;  4U70 A;  1KQ0 A;  1YW7 A;  2BHB A;  3IG4 A;  4FO8 A;  3BIQ A;  3ROR A;  1R5H A;  2BHA A;  2G6P A;  2BWS A;  4A6V A;  3CB6 A;  5CDV A;  2OAZ A;  4S01 A;  3RVA A;  3MAT A;  3S6B A;  4U6Z A;  2BHC A;  2BWV A;  2GG9 A;  4FUK A;  4RGZ 1;  1C21 A;  3IU8 A;  1YW8 A;  4S00 A;  4U1B A;  2GU7 A;  1QXZ A;  4IPA A;  4B28 A;  2Q94 A;  1QXY A;  4QR8 A;  4Z7M A;  2GG5 A;  2GGC A;  4RZY A;  4IKS A;  1C27 A;  4U69 A;  4FLJ A;  4KM3 A;  3IU7 A;  2GG2 A;  1XGS A;  1B59 A;  2HOW A;  5CE6 A;  5JI6 A;  4IKR A;  3D27 A;  3PKD A;  4ZWU A;  2V3X A;  2Q93 A;  1WKM A;  4PV4 A;  2EVM A;  2P98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...