4U69A

Hsmetap complex with (1-amino-2-methylpentyl)phosphonic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u69A00
1BN5A 2EA4A 2EVOA 3BIPA 4A6VA 3IG4A 3IU8A 1O0XA 4RGZ1 2GG9A 4PNCA 2GG0A 1XNZA 2GG2A 3PKDA 1WL6A 1YW9A 2B3HA 1PV9A 5CDEA 5CIKA 2GU6A 1B59A 2GGBA 1QZYA 3RORA 2P9AA 1R58A 2EVCA 1B6AA 2HOWA 2BWTA 4FO7A 3TAVA 2BH3A 3TB5A 4FLKA 1YJ3A 2BWSA 4R60A 4RZYA 1Y1NA 4RZZA 1C24A 1YVMA 4U6EA 5JHUA 4U6ZA 1WN1A 4FO8A 2Q95A 3BIQA 3CB6A 4HXXA 3PKBA 2GZ5A 2BWVA 4IDYA 2V3YA 2BWWA 2BB7A 2GA2A 3D27A 2Q94A 1C27A 1N51A 1WL9A 5D6EA 1KQ0A 1W2MA 1C23A 3Q6DA 3PKCA 1CHMA 4U6WA 2GTXA 2P98A 2GG7A 2GGCA 3FMRA 4IECA 3PKAA 4MATA 3CTZA 5D6FA 1R5HA 2BHAA 2GG8A 3IU7A 4S01A 5E5BA 4U71A 2BWXA 2P99A 2NQ6A 4ZWUA 1XGOA 1C22A 4Z7MA 5JI6A 4IKUA 3RVAA 1W7VA 1KP0A 1WY2A 4IKRA 4U73A 2B3LA 2ADUA 2BWYA 4EGEA 1R5GA 2V3ZA 4U6CA 4KM3A 1KQ9A 4S2RP 5FCHA 5CE6A 4IPAA 2BWUA 4U76A 4IKTA 3FMQA 2BHBA 4U6JA 4FLLA 5CNXA 3CB5A 1XGMA 2IW2A 3S6BA 1JAWA 3PKEA 4ZWPA 4QR8A 5CDLA 3L24A 1C21A 1QXWA 2Q93A 3IU9A 4OOKA 4FKCA 4S00A 2Q96A 2GU4A 1QXYA 3BITA 1MATA 3L7GA 1BOAA 4FUKA 5CLSA 2GG5A 2NQ7A 2V3XA 4FLIA 4ZWOA 1WLRA 2BN7A 2B3KA 5JFRA 2EVMA 4FLJA 1M35A 2GU7A 1WBQA 1A16A 4IKSA 1XGSA 2ZSGA 4S2TP 2MATA 4PV4A 2GU5A 4IF7A 2V6CA 1YW7A 2Q92A 5CDVA 4U70A 2EA2A 4U1BA 2G6PA 4U75A 4IU6A 4ZNGA 1XGNA 4JUQA 2GG3A 1WKMA 4U69A 2Q8KA 3MR1A 3MATA 2DFIA 1YW8A 1QXZA 2OAZA 2BHDA 4B28A 4A6WA 5FCFA 3MX6A 3FM3A 2BHCA 2OKNA
chains in the Genus database with same CATH superfamily
1BN5A 2EA4A 2EVOA 3BIPA 4A6VA 3IG4A 3IU8A 1O0XA 4RGZ1 2GG9A 4PNCA 2GG0A 1XNZA 2GG2A 3PKDA 1WL6A 1YW9A 2B3HA 1PV9A 5CDEA 5CIKA 2GU6A 1B59A 2GGBA 1QZYA 3RORA 2P9AA 1R58A 2EVCA 1B6AA 2HOWA 2BWTA 4FO7A 3TAVA 2BH3A 3TB5A 4FLKA 1YJ3A 2BWSA 4R60A 4RZYA 1Y1NA 4RZZA 1C24A 1YVMA 4U6EA 5JHUA 4U6ZA 1WN1A 4FO8A 2Q95A 3BIQA 3CB6A 4HXXA 3PKBA 2GZ5A 2BWVA 4IDYA 2V3YA 2BWWA 2BB7A 2GA2A 3D27A 2Q94A 1C27A 1N51A 1WL9A 5D6EA 1KQ0A 1W2MA 1C23A 3Q6DA 3PKCA 1CHMA 4U6WA 2GTXA 2P98A 2GG7A 2GGCA 3FMRA 4IECA 3PKAA 4MATA 3CTZA 5D6FA 1R5HA 2BHAA 2GG8A 3IU7A 4S01A 5E5BA 4U71A 2BWXA 2P99A 2NQ6A 4ZWUA 1XGOA 1C22A 4Z7MA 5JI6A 4IKUA 3RVAA 1W7VA 1KP0A 1WY2A 4IKRA 4U73A 2B3LA 2ADUA 2BWYA 4EGEA 1R5GA 2V3ZA 4U6CA 4KM3A 1KQ9A 4S2RP 5FCHA 5CE6A 4IPAA 2BWUA 4U76A 4IKTA 3FMQA 2BHBA 4U6JA 4FLLA 5CNXA 3CB5A 1XGMA 2IW2A 3S6BA 1JAWA 3PKEA 4ZWPA 4QR8A 5CDLA 3L24A 1C21A 1QXWA 2Q93A 3IU9A 4OOKA 4FKCA 4S00A 2Q96A 2GU4A 1QXYA 3BITA 1MATA 3L7GA 1BOAA 4FUKA 5CLSA 2GG5A 2NQ7A 2V3XA 4FLIA 4ZWOA 1WLRA 2BN7A 2B3KA 5JFRA 2EVMA 4FLJA 1M35A 2GU7A 1WBQA 1A16A 4IKSA 1XGSA 2ZSGA 4S2TP 2MATA 4PV4A 2GU5A 4IF7A 2V6CA 1YW7A 2Q92A 5CDVA 4U70A 2EA2A 4U1BA 2G6PA 4U75A 4IU6A 4ZNGA 1XGNA 4JUQA 2GG3A 1WKMA 4U69A 2Q8KA 3MR1A 3MATA 2DFIA 1YW8A 1QXZA 2OAZA 2BHDA 4B28A 4A6WA 5FCFA 3MX6A 3FM3A 2BHCA 2OKNA
chains in the Genus database with same CATH topology
1BN5A 2EA4A 2EVOA 3BIPA 4A6VA 3IG4A 3IU8A 1O0XA 4RGZ1 2GG9A 4PNCA 2GG0A 1XNZA 2GG2A 3PKDA 1WL6A 1YW9A 2B3HA 1PV9A 5CDEA 5CIKA 2GU6A 1B59A 2GGBA 1QZYA 3RORA 2P9AA 1R58A 2EVCA 1B6AA 2HOWA 2BWTA 4FO7A 3TAVA 2BH3A 3TB5A 4FLKA 1YJ3A 2BWSA 4R60A 4RZYA 1Y1NA 4RZZA 1C24A 1YVMA 4U6EA 5JHUA 4U6ZA 1WN1A 4FO8A 2Q95A 3BIQA 3CB6A 4HXXA 3PKBA 2GZ5A 2BWVA 4IDYA 2V3YA 2BWWA 2BB7A 2GA2A 3D27A 2Q94A 1C27A 1N51A 1WL9A 5D6EA 1KQ0A 1W2MA 1C23A 3Q6DA 3PKCA 1CHMA 4U6WA 2GTXA 2P98A 2GG7A 2GGCA 3FMRA 4IECA 3PKAA 4MATA 3CTZA 5D6FA 1R5HA 2BHAA 2GG8A 3IU7A 4S01A 5E5BA 4U71A 2BWXA 2P99A 2NQ6A 4ZWUA 1XGOA 1C22A 4Z7MA 5JI6A 4IKUA 3RVAA 1W7VA 1KP0A 1WY2A 4IKRA 4U73A 2B3LA 2ADUA 2BWYA 4EGEA 1R5GA 2V3ZA 4U6CA 4KM3A 1KQ9A 4S2RP 5FCHA 5CE6A 4IPAA 2BWUA 4U76A 4IKTA 3FMQA 2BHBA 4U6JA 4FLLA 5CNXA 3CB5A 1XGMA 2IW2A 3S6BA 1JAWA 3PKEA 4ZWPA 4QR8A 5CDLA 3L24A 1C21A 1QXWA 2Q93A 3IU9A 4OOKA 4FKCA 4S00A 2Q96A 2GU4A 1QXYA 3BITA 1MATA 3L7GA 1BOAA 4FUKA 5CLSA 2GG5A 2NQ7A 2V3XA 4FLIA 4ZWOA 1WLRA 2BN7A 2B3KA 5JFRA 2EVMA 4FLJA 1M35A 2GU7A 1WBQA 1A16A 4IKSA 1XGSA 2ZSGA 4S2TP 2MATA 4PV4A 2GU5A 4IF7A 2V6CA 1YW7A 2Q92A 5CDVA 4U70A 2EA2A 4U1BA 2G6PA 4U75A 4IU6A 4ZNGA 1XGNA 4JUQA 2GG3A 1WKMA 4U69A 2Q8KA 3MR1A 3MATA 2DFIA 1YW8A 1QXZA 2OAZA 2BHDA 4B28A 4A6WA 5FCFA 3MX6A 3FM3A 2BHCA 2OKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN5 A;  2EA4 A;  2EVO A;  3BIP A;  4A6V A;  3IG4 A;  3IU8 A;  1O0X A;  4RGZ 1;  2GG9 A;  4PNC A;  2GG0 A;  1XNZ A;  2GG2 A;  3PKD A;  1WL6 A;  1YW9 A;  2B3H A;  1PV9 A;  5CDE A;  5CIK A;  2GU6 A;  1B59 A;  2GGB A;  1QZY A;  3ROR A;  2P9A A;  1R58 A;  2EVC A;  1B6A A;  2HOW A;  2BWT A;  4FO7 A;  3TAV A;  2BH3 A;  3TB5 A;  4FLK A;  1YJ3 A;  2BWS A;  4R60 A;  4RZY A;  1Y1N A;  4RZZ A;  1C24 A;  1YVM A;  4U6E A;  5JHU A;  4U6Z A;  1WN1 A;  4FO8 A;  2Q95 A;  3BIQ A;  3CB6 A;  4HXX A;  3PKB A;  2GZ5 A;  2BWV A;  4IDY A;  2V3Y A;  2BWW A;  2BB7 A;  2GA2 A;  3D27 A;  2Q94 A;  1C27 A;  1N51 A;  1WL9 A;  5D6E A;  1KQ0 A;  1W2M A;  1C23 A;  3Q6D A;  3PKC A;  1CHM A;  4U6W A;  2GTX A;  2P98 A;  2GG7 A;  2GGC A;  3FMR A;  4IEC A;  3PKA A;  4MAT A;  3CTZ A;  5D6F A;  1R5H A;  2BHA A;  2GG8 A;  3IU7 A;  4S01 A;  5E5B A;  4U71 A;  2BWX A;  2P99 A;  2NQ6 A;  4ZWU A;  1XGO A;  1C22 A;  4Z7M A;  5JI6 A;  4IKU A;  3RVA A;  1W7V A;  1KP0 A;  1WY2 A;  4IKR A;  4U73 A;  2B3L A;  2ADU A;  2BWY A;  4EGE A;  1R5G A;  2V3Z A;  4U6C A;  4KM3 A;  1KQ9 A;  4S2R P;  5FCH A;  5CE6 A;  4IPA A;  2BWU A;  4U76 A;  4IKT A;  3FMQ A;  2BHB A;  4U6J A;  4FLL A;  5CNX A;  3CB5 A;  1XGM A;  2IW2 A;  3S6B A;  1JAW A;  3PKE A;  4ZWP A;  4QR8 A;  5CDL A;  3L24 A;  1C21 A;  1QXW A;  2Q93 A;  3IU9 A;  4OOK A;  4FKC A;  4S00 A;  2Q96 A;  2GU4 A;  1QXY A;  3BIT A;  1MAT A;  3L7G A;  1BOA A;  4FUK A;  5CLS A;  2GG5 A;  2NQ7 A;  2V3X A;  4FLI A;  4ZWO A;  1WLR A;  2BN7 A;  2B3K A;  5JFR A;  2EVM A;  4FLJ A;  1M35 A;  2GU7 A;  1WBQ A;  1A16 A;  4IKS A;  1XGS A;  2ZSG A;  4S2T P;  2MAT A;  4PV4 A;  2GU5 A;  4IF7 A;  2V6C A;  1YW7 A;  2Q92 A;  5CDV A;  4U70 A;  2EA2 A;  4U1B A;  2G6P A;  4U75 A;  4IU6 A;  4ZNG A;  1XGN A;  4JUQ A;  2GG3 A;  1WKM A;  4U69 A;  2Q8K A;  3MR1 A;  3MAT A;  2DFI A;  1YW8 A;  1QXZ A;  2OAZ A;  2BHD A;  4B28 A;  4A6W A;  5FCF A;  3MX6 A;  3FM3 A;  2BHC A;  2OKN A; 
#chains in the Genus database with same CATH topology
 1BN5 A;  2EA4 A;  2EVO A;  3BIP A;  4A6V A;  3IG4 A;  3IU8 A;  1O0X A;  4RGZ 1;  2GG9 A;  4PNC A;  2GG0 A;  1XNZ A;  2GG2 A;  3PKD A;  1WL6 A;  1YW9 A;  2B3H A;  1PV9 A;  5CDE A;  5CIK A;  2GU6 A;  1B59 A;  2GGB A;  1QZY A;  3ROR A;  2P9A A;  1R58 A;  2EVC A;  1B6A A;  2HOW A;  2BWT A;  4FO7 A;  3TAV A;  2BH3 A;  3TB5 A;  4FLK A;  1YJ3 A;  2BWS A;  4R60 A;  4RZY A;  1Y1N A;  4RZZ A;  1C24 A;  1YVM A;  4U6E A;  5JHU A;  4U6Z A;  1WN1 A;  4FO8 A;  2Q95 A;  3BIQ A;  3CB6 A;  4HXX A;  3PKB A;  2GZ5 A;  2BWV A;  4IDY A;  2V3Y A;  2BWW A;  2BB7 A;  2GA2 A;  3D27 A;  2Q94 A;  1C27 A;  1N51 A;  1WL9 A;  5D6E A;  1KQ0 A;  1W2M A;  1C23 A;  3Q6D A;  3PKC A;  1CHM A;  4U6W A;  2GTX A;  2P98 A;  2GG7 A;  2GGC A;  3FMR A;  4IEC A;  3PKA A;  4MAT A;  3CTZ A;  5D6F A;  1R5H A;  2BHA A;  2GG8 A;  3IU7 A;  4S01 A;  5E5B A;  4U71 A;  2BWX A;  2P99 A;  2NQ6 A;  4ZWU A;  1XGO A;  1C22 A;  4Z7M A;  5JI6 A;  4IKU A;  3RVA A;  1W7V A;  1KP0 A;  1WY2 A;  4IKR A;  4U73 A;  2B3L A;  2ADU A;  2BWY A;  4EGE A;  1R5G A;  2V3Z A;  4U6C A;  4KM3 A;  1KQ9 A;  4S2R P;  5FCH A;  5CE6 A;  4IPA A;  2BWU A;  4U76 A;  4IKT A;  3FMQ A;  2BHB A;  4U6J A;  4FLL A;  5CNX A;  3CB5 A;  1XGM A;  2IW2 A;  3S6B A;  1JAW A;  3PKE A;  4ZWP A;  4QR8 A;  5CDL A;  3L24 A;  1C21 A;  1QXW A;  2Q93 A;  3IU9 A;  4OOK A;  4FKC A;  4S00 A;  2Q96 A;  2GU4 A;  1QXY A;  3BIT A;  1MAT A;  3L7G A;  1BOA A;  4FUK A;  5CLS A;  2GG5 A;  2NQ7 A;  2V3X A;  4FLI A;  4ZWO A;  1WLR A;  2BN7 A;  2B3K A;  5JFR A;  2EVM A;  4FLJ A;  1M35 A;  2GU7 A;  1WBQ A;  1A16 A;  4IKS A;  1XGS A;  2ZSG A;  4S2T P;  2MAT A;  4PV4 A;  2GU5 A;  4IF7 A;  2V6C A;  1YW7 A;  2Q92 A;  5CDV A;  4U70 A;  2EA2 A;  4U1B A;  2G6P A;  4U75 A;  4IU6 A;  4ZNG A;  1XGN A;  4JUQ A;  2GG3 A;  1WKM A;  4U69 A;  2Q8K A;  3MR1 A;  3MAT A;  2DFI A;  1YW8 A;  1QXZ A;  2OAZ A;  2BHD A;  4B28 A;  4A6W A;  5FCF A;  3MX6 A;  3FM3 A;  2BHC A;  2OKN A; 
#chains in the Genus database with same CATH homology
 1BN5 A;  2EA4 A;  2EVO A;  3BIP A;  4A6V A;  3IG4 A;  3IU8 A;  1O0X A;  4RGZ 1;  2GG9 A;  4PNC A;  2GG0 A;  1XNZ A;  2GG2 A;  3PKD A;  1WL6 A;  1YW9 A;  2B3H A;  1PV9 A;  5CDE A;  5CIK A;  2GU6 A;  1B59 A;  2GGB A;  1QZY A;  3ROR A;  2P9A A;  1R58 A;  2EVC A;  1B6A A;  2HOW A;  2BWT A;  4FO7 A;  3TAV A;  2BH3 A;  3TB5 A;  4FLK A;  1YJ3 A;  2BWS A;  4R60 A;  4RZY A;  1Y1N A;  4RZZ A;  1C24 A;  1YVM A;  4U6E A;  5JHU A;  4U6Z A;  1WN1 A;  4FO8 A;  2Q95 A;  3BIQ A;  3CB6 A;  4HXX A;  3PKB A;  2GZ5 A;  2BWV A;  4IDY A;  2V3Y A;  2BWW A;  2BB7 A;  2GA2 A;  3D27 A;  2Q94 A;  1C27 A;  1N51 A;  1WL9 A;  5D6E A;  1KQ0 A;  1W2M A;  1C23 A;  3Q6D A;  3PKC A;  1CHM A;  4U6W A;  2GTX A;  2P98 A;  2GG7 A;  2GGC A;  3FMR A;  4IEC A;  3PKA A;  4MAT A;  3CTZ A;  5D6F A;  1R5H A;  2BHA A;  2GG8 A;  3IU7 A;  4S01 A;  5E5B A;  4U71 A;  2BWX A;  2P99 A;  2NQ6 A;  4ZWU A;  1XGO A;  1C22 A;  4Z7M A;  5JI6 A;  4IKU A;  3RVA A;  1W7V A;  1KP0 A;  1WY2 A;  4IKR A;  4U73 A;  2B3L A;  2ADU A;  2BWY A;  4EGE A;  1R5G A;  2V3Z A;  4U6C A;  4KM3 A;  1KQ9 A;  4S2R P;  5FCH A;  5CE6 A;  4IPA A;  2BWU A;  4U76 A;  4IKT A;  3FMQ A;  2BHB A;  4U6J A;  4FLL A;  5CNX A;  3CB5 A;  1XGM A;  2IW2 A;  3S6B A;  1JAW A;  3PKE A;  4ZWP A;  4QR8 A;  5CDL A;  3L24 A;  1C21 A;  1QXW A;  2Q93 A;  3IU9 A;  4OOK A;  4FKC A;  4S00 A;  2Q96 A;  2GU4 A;  1QXY A;  3BIT A;  1MAT A;  3L7G A;  1BOA A;  4FUK A;  5CLS A;  2GG5 A;  2NQ7 A;  2V3X A;  4FLI A;  4ZWO A;  1WLR A;  2BN7 A;  2B3K A;  5JFR A;  2EVM A;  4FLJ A;  1M35 A;  2GU7 A;  1WBQ A;  1A16 A;  4IKS A;  1XGS A;  2ZSG A;  4S2T P;  2MAT A;  4PV4 A;  2GU5 A;  4IF7 A;  2V6C A;  1YW7 A;  2Q92 A;  5CDV A;  4U70 A;  2EA2 A;  4U1B A;  2G6P A;  4U75 A;  4IU6 A;  4ZNG A;  1XGN A;  4JUQ A;  2GG3 A;  1WKM A;  4U69 A;  2Q8K A;  3MR1 A;  3MAT A;  2DFI A;  1YW8 A;  1QXZ A;  2OAZ A;  2BHD A;  4B28 A;  4A6W A;  5FCF A;  3MX6 A;  3FM3 A;  2BHC A;  2OKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...