4U69A

Hsmetap complex with (1-amino-2-methylpentyl)phosphonic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
molecule tags Hydrolase
source organism Homo sapiens
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u69A00
1JAWA 3PKCA 1Y1NA 2BHCA 3MATA 4HXXA 1B59A 2IW2A 1YW9A 2Q93A 3D27A 2BWVA 2GU4A 1WKMA 1KQ0A 4FO7A 4ZWPA 5JFRA 5D6EA 1M35A 4ZWUA 1W7VA 2BN7A 3FMQA 2GU6A 2NQ6A 4IKSA 1XGMA 4MATA 5E5BA 4ZWOA 3TB5A 2P9AA 1YVMA 5CIKA 1MATA 2ZSGA 3IU7A 3PKBA 2HOWA 2BWTA 1XGSA 3L7GA 4B28A 2BHDA 3BITA 3IG4A 5CE6A 2GG7A 4Z7MA 2B3LA 1XGOA 1XGNA 1C23A 3L24A 4IKUA 1KQ9A 2B3HA 2GGBA 4FLKA 4S00A 1YW8A 2GG9A 2BHAA 2GZ5A 1C27A 3CB5A 4FLJA 2GTXA 2BWUA 2EVMA 2ADUA 2BHBA 5FCHA 4U6EA 1R58A 5CDLA 4U75A 1W2MA 4QR8A 5D6FA 1WL6A 3S6BA 3RORA 1R5HA 4JUQA 3TAVA 3MR1A 1WLRA 2EVOA 2Q96A 2MATA 2BWXA 1YJ3A 4U6WA 5CNXA 1QXYA 2V3YA 4PNCA 2B3KA 4U71A 1PV9A 2BH3A 4IPAA 5JI6A 2GG2A 3MX6A 2NQ7A 2P99A 4U69A 2GA2A 4EGEA 2BWWA 3FM3A 1YW7A 3FMRA 4S2RP 1WY2A 1XNZA 2P98A 3BIQA 2BWSA 5JHUA 3Q6DA 1C21A 2EA2A 2EVCA 4FUKA 3PKEA 4FKCA 2GGCA 2V6CA 1O0XA 2GG5A 4IKTA 4PV4A 2V3XA 4U6JA 4U70A 4ZNGA 4S01A 5FCFA 1CHMA 2Q92A 1WBQA 5CDEA 1QXZA 4U6ZA 2GU5A 1N51A 4S2TP 1WL9A 5CDVA 4U1BA 3CTZA 4U73A 1QXWA 1C24A 2GU7A 4OOKA 3BIPA 2EA4A 2DFIA 3PKDA 2Q94A 4KM3A 4IECA 2OKNA 2GG8A 3IU9A 1WN1A 4FO8A 4IKRA 4IU6A 2BB7A 4FLIA 2GG3A 2Q95A 4R60A 5CLSA 4IF7A 3PKAA 4RGZ1 4A6VA 1A16A 4U76A 3CB6A 1R5GA 2BWYA 2G6PA 2OAZA 4A6WA 1QZYA 3IU8A 1BOAA 4RZYA 1BN5A 1KP0A 2V3ZA 4U6CA 2Q8KA 1B6AA 4RZZA 3RVAA 4FLLA 4IDYA 2GG0A 1C22A
chains in the Genus database with same CATH superfamily
1JAWA 3PKCA 1Y1NA 2BHCA 3MATA 4HXXA 1B59A 2IW2A 1YW9A 2Q93A 3D27A 2BWVA 2GU4A 1WKMA 1KQ0A 4FO7A 4ZWPA 5JFRA 5D6EA 1M35A 4ZWUA 1W7VA 2BN7A 3FMQA 2GU6A 2NQ6A 4IKSA 1XGMA 4MATA 5E5BA 4ZWOA 3TB5A 2P9AA 1YVMA 5CIKA 1MATA 2ZSGA 3IU7A 3PKBA 2HOWA 2BWTA 1XGSA 3L7GA 4B28A 2BHDA 3BITA 3IG4A 5CE6A 2GG7A 4Z7MA 2B3LA 1XGOA 1XGNA 1C23A 3L24A 4IKUA 1KQ9A 2B3HA 2GGBA 4FLKA 4S00A 1YW8A 2GG9A 2BHAA 2GZ5A 1C27A 3CB5A 4FLJA 2GTXA 2BWUA 2EVMA 2ADUA 2BHBA 5FCHA 4U6EA 1R58A 5CDLA 4U75A 1W2MA 4QR8A 5D6FA 1WL6A 3S6BA 3RORA 1R5HA 4JUQA 3TAVA 3MR1A 1WLRA 2EVOA 2Q96A 2MATA 2BWXA 1YJ3A 4U6WA 5CNXA 1QXYA 2V3YA 4PNCA 2B3KA 4U71A 1PV9A 2BH3A 4IPAA 5JI6A 2GG2A 3MX6A 2NQ7A 2P99A 4U69A 2GA2A 4EGEA 2BWWA 3FM3A 1YW7A 3FMRA 4S2RP 1WY2A 1XNZA 2P98A 3BIQA 2BWSA 5JHUA 3Q6DA 1C21A 2EA2A 2EVCA 4FUKA 3PKEA 4FKCA 2GGCA 2V6CA 1O0XA 2GG5A 4IKTA 4PV4A 2V3XA 4U6JA 4U70A 4ZNGA 4S01A 5FCFA 1CHMA 2Q92A 1WBQA 5CDEA 1QXZA 4U6ZA 2GU5A 1N51A 4S2TP 1WL9A 5CDVA 4U1BA 3CTZA 4U73A 1QXWA 1C24A 2GU7A 4OOKA 3BIPA 2EA4A 2DFIA 3PKDA 2Q94A 4KM3A 4IECA 2OKNA 2GG8A 3IU9A 1WN1A 4FO8A 4IKRA 4IU6A 2BB7A 4FLIA 2GG3A 2Q95A 4R60A 5CLSA 4IF7A 3PKAA 4RGZ1 4A6VA 1A16A 4U76A 3CB6A 1R5GA 2BWYA 2G6PA 2OAZA 4A6WA 1QZYA 3IU8A 1BOAA 4RZYA 1BN5A 1KP0A 2V3ZA 4U6CA 2Q8KA 1B6AA 4RZZA 3RVAA 4FLLA 4IDYA 2GG0A 1C22A
chains in the Genus database with same CATH topology
1JAWA 3PKCA 1Y1NA 2BHCA 3MATA 4HXXA 1B59A 2IW2A 1YW9A 2Q93A 3D27A 2BWVA 2GU4A 1WKMA 1KQ0A 4FO7A 4ZWPA 5JFRA 5D6EA 1M35A 4ZWUA 1W7VA 2BN7A 3FMQA 2GU6A 2NQ6A 4IKSA 1XGMA 4MATA 5E5BA 4ZWOA 3TB5A 2P9AA 1YVMA 5CIKA 1MATA 2ZSGA 3IU7A 3PKBA 2HOWA 2BWTA 1XGSA 3L7GA 4B28A 2BHDA 3BITA 3IG4A 5CE6A 2GG7A 4Z7MA 2B3LA 1XGOA 1XGNA 1C23A 3L24A 4IKUA 1KQ9A 2B3HA 2GGBA 4FLKA 4S00A 1YW8A 2GG9A 2BHAA 2GZ5A 1C27A 3CB5A 4FLJA 2GTXA 2BWUA 2EVMA 2ADUA 2BHBA 5FCHA 4U6EA 1R58A 5CDLA 4U75A 1W2MA 4QR8A 5D6FA 1WL6A 3S6BA 3RORA 1R5HA 4JUQA 3TAVA 3MR1A 1WLRA 2EVOA 2Q96A 2MATA 2BWXA 1YJ3A 4U6WA 5CNXA 1QXYA 2V3YA 4PNCA 2B3KA 4U71A 1PV9A 2BH3A 4IPAA 5JI6A 2GG2A 3MX6A 2NQ7A 2P99A 4U69A 2GA2A 4EGEA 2BWWA 3FM3A 1YW7A 3FMRA 4S2RP 1WY2A 1XNZA 2P98A 3BIQA 2BWSA 5JHUA 3Q6DA 1C21A 2EA2A 2EVCA 4FUKA 3PKEA 4FKCA 2GGCA 2V6CA 1O0XA 2GG5A 4IKTA 4PV4A 2V3XA 4U6JA 4U70A 4ZNGA 4S01A 5FCFA 1CHMA 2Q92A 1WBQA 5CDEA 1QXZA 4U6ZA 2GU5A 1N51A 4S2TP 1WL9A 5CDVA 4U1BA 3CTZA 4U73A 1QXWA 1C24A 2GU7A 4OOKA 3BIPA 2EA4A 2DFIA 3PKDA 2Q94A 4KM3A 4IECA 2OKNA 2GG8A 3IU9A 1WN1A 4FO8A 4IKRA 4IU6A 2BB7A 4FLIA 2GG3A 2Q95A 4R60A 5CLSA 4IF7A 3PKAA 4RGZ1 4A6VA 1A16A 4U76A 3CB6A 1R5GA 2BWYA 2G6PA 2OAZA 4A6WA 1QZYA 3IU8A 1BOAA 4RZYA 1BN5A 1KP0A 2V3ZA 4U6CA 2Q8KA 1B6AA 4RZZA 3RVAA 4FLLA 4IDYA 2GG0A 1C22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAW A;  3PKC A;  1Y1N A;  2BHC A;  3MAT A;  4HXX A;  1B59 A;  2IW2 A;  1YW9 A;  2Q93 A;  3D27 A;  2BWV A;  2GU4 A;  1WKM A;  1KQ0 A;  4FO7 A;  4ZWP A;  5JFR A;  5D6E A;  1M35 A;  4ZWU A;  1W7V A;  2BN7 A;  3FMQ A;  2GU6 A;  2NQ6 A;  4IKS A;  1XGM A;  4MAT A;  5E5B A;  4ZWO A;  3TB5 A;  2P9A A;  1YVM A;  5CIK A;  1MAT A;  2ZSG A;  3IU7 A;  3PKB A;  2HOW A;  2BWT A;  1XGS A;  3L7G A;  4B28 A;  2BHD A;  3BIT A;  3IG4 A;  5CE6 A;  2GG7 A;  4Z7M A;  2B3L A;  1XGO A;  1XGN A;  1C23 A;  3L24 A;  4IKU A;  1KQ9 A;  2B3H A;  2GGB A;  4FLK A;  4S00 A;  1YW8 A;  2GG9 A;  2BHA A;  2GZ5 A;  1C27 A;  3CB5 A;  4FLJ A;  2GTX A;  2BWU A;  2EVM A;  2ADU A;  2BHB A;  5FCH A;  4U6E A;  1R58 A;  5CDL A;  4U75 A;  1W2M A;  4QR8 A;  5D6F A;  1WL6 A;  3S6B A;  3ROR A;  1R5H A;  4JUQ A;  3TAV A;  3MR1 A;  1WLR A;  2EVO A;  2Q96 A;  2MAT A;  2BWX A;  1YJ3 A;  4U6W A;  5CNX A;  1QXY A;  2V3Y A;  4PNC A;  2B3K A;  4U71 A;  1PV9 A;  2BH3 A;  4IPA A;  5JI6 A;  2GG2 A;  3MX6 A;  2NQ7 A;  2P99 A;  4U69 A;  2GA2 A;  4EGE A;  2BWW A;  3FM3 A;  1YW7 A;  3FMR A;  4S2R P;  1WY2 A;  1XNZ A;  2P98 A;  3BIQ A;  2BWS A;  5JHU A;  3Q6D A;  1C21 A;  2EA2 A;  2EVC A;  4FUK A;  3PKE A;  4FKC A;  2GGC A;  2V6C A;  1O0X A;  2GG5 A;  4IKT A;  4PV4 A;  2V3X A;  4U6J A;  4U70 A;  4ZNG A;  4S01 A;  5FCF A;  1CHM A;  2Q92 A;  1WBQ A;  5CDE A;  1QXZ A;  4U6Z A;  2GU5 A;  1N51 A;  4S2T P;  1WL9 A;  5CDV A;  4U1B A;  3CTZ A;  4U73 A;  1QXW A;  1C24 A;  2GU7 A;  4OOK A;  3BIP A;  2EA4 A;  2DFI A;  3PKD A;  2Q94 A;  4KM3 A;  4IEC A;  2OKN A;  2GG8 A;  3IU9 A;  1WN1 A;  4FO8 A;  4IKR A;  4IU6 A;  2BB7 A;  4FLI A;  2GG3 A;  2Q95 A;  4R60 A;  5CLS A;  4IF7 A;  3PKA A;  4RGZ 1;  4A6V A;  1A16 A;  4U76 A;  3CB6 A;  1R5G A;  2BWY A;  2G6P A;  2OAZ A;  4A6W A;  1QZY A;  3IU8 A;  1BOA A;  4RZY A;  1BN5 A;  1KP0 A;  2V3Z A;  4U6C A;  2Q8K A;  1B6A A;  4RZZ A;  3RVA A;  4FLL A;  4IDY A;  2GG0 A;  1C22 A; 
#chains in the Genus database with same CATH topology
 1JAW A;  3PKC A;  1Y1N A;  2BHC A;  3MAT A;  4HXX A;  1B59 A;  2IW2 A;  1YW9 A;  2Q93 A;  3D27 A;  2BWV A;  2GU4 A;  1WKM A;  1KQ0 A;  4FO7 A;  4ZWP A;  5JFR A;  5D6E A;  1M35 A;  4ZWU A;  1W7V A;  2BN7 A;  3FMQ A;  2GU6 A;  2NQ6 A;  4IKS A;  1XGM A;  4MAT A;  5E5B A;  4ZWO A;  3TB5 A;  2P9A A;  1YVM A;  5CIK A;  1MAT A;  2ZSG A;  3IU7 A;  3PKB A;  2HOW A;  2BWT A;  1XGS A;  3L7G A;  4B28 A;  2BHD A;  3BIT A;  3IG4 A;  5CE6 A;  2GG7 A;  4Z7M A;  2B3L A;  1XGO A;  1XGN A;  1C23 A;  3L24 A;  4IKU A;  1KQ9 A;  2B3H A;  2GGB A;  4FLK A;  4S00 A;  1YW8 A;  2GG9 A;  2BHA A;  2GZ5 A;  1C27 A;  3CB5 A;  4FLJ A;  2GTX A;  2BWU A;  2EVM A;  2ADU A;  2BHB A;  5FCH A;  4U6E A;  1R58 A;  5CDL A;  4U75 A;  1W2M A;  4QR8 A;  5D6F A;  1WL6 A;  3S6B A;  3ROR A;  1R5H A;  4JUQ A;  3TAV A;  3MR1 A;  1WLR A;  2EVO A;  2Q96 A;  2MAT A;  2BWX A;  1YJ3 A;  4U6W A;  5CNX A;  1QXY A;  2V3Y A;  4PNC A;  2B3K A;  4U71 A;  1PV9 A;  2BH3 A;  4IPA A;  5JI6 A;  2GG2 A;  3MX6 A;  2NQ7 A;  2P99 A;  4U69 A;  2GA2 A;  4EGE A;  2BWW A;  3FM3 A;  1YW7 A;  3FMR A;  4S2R P;  1WY2 A;  1XNZ A;  2P98 A;  3BIQ A;  2BWS A;  5JHU A;  3Q6D A;  1C21 A;  2EA2 A;  2EVC A;  4FUK A;  3PKE A;  4FKC A;  2GGC A;  2V6C A;  1O0X A;  2GG5 A;  4IKT A;  4PV4 A;  2V3X A;  4U6J A;  4U70 A;  4ZNG A;  4S01 A;  5FCF A;  1CHM A;  2Q92 A;  1WBQ A;  5CDE A;  1QXZ A;  4U6Z A;  2GU5 A;  1N51 A;  4S2T P;  1WL9 A;  5CDV A;  4U1B A;  3CTZ A;  4U73 A;  1QXW A;  1C24 A;  2GU7 A;  4OOK A;  3BIP A;  2EA4 A;  2DFI A;  3PKD A;  2Q94 A;  4KM3 A;  4IEC A;  2OKN A;  2GG8 A;  3IU9 A;  1WN1 A;  4FO8 A;  4IKR A;  4IU6 A;  2BB7 A;  4FLI A;  2GG3 A;  2Q95 A;  4R60 A;  5CLS A;  4IF7 A;  3PKA A;  4RGZ 1;  4A6V A;  1A16 A;  4U76 A;  3CB6 A;  1R5G A;  2BWY A;  2G6P A;  2OAZ A;  4A6W A;  1QZY A;  3IU8 A;  1BOA A;  4RZY A;  1BN5 A;  1KP0 A;  2V3Z A;  4U6C A;  2Q8K A;  1B6A A;  4RZZ A;  3RVA A;  4FLL A;  4IDY A;  2GG0 A;  1C22 A; 
#chains in the Genus database with same CATH homology
 1JAW A;  3PKC A;  1Y1N A;  2BHC A;  3MAT A;  4HXX A;  1B59 A;  2IW2 A;  1YW9 A;  2Q93 A;  3D27 A;  2BWV A;  2GU4 A;  1WKM A;  1KQ0 A;  4FO7 A;  4ZWP A;  5JFR A;  5D6E A;  1M35 A;  4ZWU A;  1W7V A;  2BN7 A;  3FMQ A;  2GU6 A;  2NQ6 A;  4IKS A;  1XGM A;  4MAT A;  5E5B A;  4ZWO A;  3TB5 A;  2P9A A;  1YVM A;  5CIK A;  1MAT A;  2ZSG A;  3IU7 A;  3PKB A;  2HOW A;  2BWT A;  1XGS A;  3L7G A;  4B28 A;  2BHD A;  3BIT A;  3IG4 A;  5CE6 A;  2GG7 A;  4Z7M A;  2B3L A;  1XGO A;  1XGN A;  1C23 A;  3L24 A;  4IKU A;  1KQ9 A;  2B3H A;  2GGB A;  4FLK A;  4S00 A;  1YW8 A;  2GG9 A;  2BHA A;  2GZ5 A;  1C27 A;  3CB5 A;  4FLJ A;  2GTX A;  2BWU A;  2EVM A;  2ADU A;  2BHB A;  5FCH A;  4U6E A;  1R58 A;  5CDL A;  4U75 A;  1W2M A;  4QR8 A;  5D6F A;  1WL6 A;  3S6B A;  3ROR A;  1R5H A;  4JUQ A;  3TAV A;  3MR1 A;  1WLR A;  2EVO A;  2Q96 A;  2MAT A;  2BWX A;  1YJ3 A;  4U6W A;  5CNX A;  1QXY A;  2V3Y A;  4PNC A;  2B3K A;  4U71 A;  1PV9 A;  2BH3 A;  4IPA A;  5JI6 A;  2GG2 A;  3MX6 A;  2NQ7 A;  2P99 A;  4U69 A;  2GA2 A;  4EGE A;  2BWW A;  3FM3 A;  1YW7 A;  3FMR A;  4S2R P;  1WY2 A;  1XNZ A;  2P98 A;  3BIQ A;  2BWS A;  5JHU A;  3Q6D A;  1C21 A;  2EA2 A;  2EVC A;  4FUK A;  3PKE A;  4FKC A;  2GGC A;  2V6C A;  1O0X A;  2GG5 A;  4IKT A;  4PV4 A;  2V3X A;  4U6J A;  4U70 A;  4ZNG A;  4S01 A;  5FCF A;  1CHM A;  2Q92 A;  1WBQ A;  5CDE A;  1QXZ A;  4U6Z A;  2GU5 A;  1N51 A;  4S2T P;  1WL9 A;  5CDV A;  4U1B A;  3CTZ A;  4U73 A;  1QXW A;  1C24 A;  2GU7 A;  4OOK A;  3BIP A;  2EA4 A;  2DFI A;  3PKD A;  2Q94 A;  4KM3 A;  4IEC A;  2OKN A;  2GG8 A;  3IU9 A;  1WN1 A;  4FO8 A;  4IKR A;  4IU6 A;  2BB7 A;  4FLI A;  2GG3 A;  2Q95 A;  4R60 A;  5CLS A;  4IF7 A;  3PKA A;  4RGZ 1;  4A6V A;  1A16 A;  4U76 A;  3CB6 A;  1R5G A;  2BWY A;  2G6P A;  2OAZ A;  4A6W A;  1QZY A;  3IU8 A;  1BOA A;  4RZY A;  1BN5 A;  1KP0 A;  2V3Z A;  4U6C A;  2Q8K A;  1B6A A;  4RZZ A;  3RVA A;  4FLL A;  4IDY A;  2GG0 A;  1C22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...