4U76A

Hsmetap (f309m) holo form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u76A00
2Q94A 2GG8A 5D6FA 3TB5A 1A16A 1B6AA 1QXWA 2Q95A 4IKTA 2BWVA 1KQ9A 2GTXA 4FLKA 4A6WA 1O0XA 2GG0A 2EVMA 4U70A 3CB6A 5D6EA 4IF7A 4U76A 5FCFA 4FLJA 2BHBA 4U69A 1Y1NA 4OOKA 1QXYA 4FUKA 4RGZ1 1MATA 2GGBA 1M35A 2GU4A 2HOWA 2BWXA 4S00A 5JFRA 2BWWA 1XNZA 2Q8KA 3FMQA 3BITA 2IW2A 4HXXA 2DFIA 5JHUA 1PV9A 2NQ6A 2P99A 3L7GA 4KM3A 4B28A 3PKEA 1R5GA 1R5HA 3L24A 4U6WA 4U71A 1XGNA 4U6JA 1YW9A 3PKAA 5FCHA 3IU7A 3IU8A 4RZZA 2NQ7A 3D27A 5CIKA 1C21A 4FKCA 4U73A 1QZYA 4FO7A 1WY2A 3TAVA 4JUQA 4Z7MA 4IKUA 1KQ0A 1YW7A 5CDLA 2B3HA 3IU9A 4MATA 1QXZA 1YW8A 5JI6A 3MR1A 1CHMA 3RVAA 4FO8A 2GG7A 2GU6A 4U6ZA 4ZWOA 1C27A 3FM3A 2GA2A 3MATA 3CB5A 3CTZA 2BHAA 2V6CA 4S01A 1YJ3A 2ZSGA 4S2TP 3BIQA 3PKBA 2MATA 2GU5A 4IDYA 2GG3A 4U6EA 2Q92A 1JAWA 2EA2A 2V3ZA 2V3XA 1XGOA 1C24A 2Q93A 4EGEA 2P9AA 5CDVA 2B3KA 4ZNGA 2OAZA 4FLLA 4QR8A 4ZWPA 2BB7A 4U75A 2ADUA 3S6BA 1B59A 1W7VA 2GZ5A 4A6VA 2GU7A 1WL6A 3PKCA 3PKDA 3RORA 5CE6A 4PNCA 1WN1A 2BWYA 4R60A 2B3LA 4ZWUA 4PV4A 3FMRA 3Q6DA 2Q96A 2BWSA 1W2MA 2P98A 5CNXA 4IPAA 3IG4A 4IKSA 2OKNA 1YVMA 2BWTA 2GGCA 2EVOA 1WBQA 4FLIA 1WLRA 2GG5A 1XGMA 1WL9A 2GG2A 4U6CA 4IECA 2G6PA 1BN5A 2V3YA 1N51A 1KP0A 2BWUA 2EVCA 3BIPA 2BN7A 4IU6A 4U1BA 1WKMA 2BH3A 5CLSA 5E5BA 2BHDA 4RZYA 4S2RP 2GG9A 1C23A 3MX6A 1R58A 1C22A 2BHCA 4IKRA 1BOAA 2EA4A 5CDEA 1XGSA
chains in the Genus database with same CATH superfamily
2Q94A 2GG8A 5D6FA 3TB5A 1A16A 1B6AA 1QXWA 2Q95A 4IKTA 2BWVA 1KQ9A 2GTXA 4FLKA 4A6WA 1O0XA 2GG0A 2EVMA 4U70A 3CB6A 5D6EA 4IF7A 4U76A 5FCFA 4FLJA 2BHBA 4U69A 1Y1NA 4OOKA 1QXYA 4FUKA 4RGZ1 1MATA 2GGBA 1M35A 2GU4A 2HOWA 2BWXA 4S00A 5JFRA 2BWWA 1XNZA 2Q8KA 3FMQA 3BITA 2IW2A 4HXXA 2DFIA 5JHUA 1PV9A 2NQ6A 2P99A 3L7GA 4KM3A 4B28A 3PKEA 1R5GA 1R5HA 3L24A 4U6WA 4U71A 1XGNA 4U6JA 1YW9A 3PKAA 5FCHA 3IU7A 3IU8A 4RZZA 2NQ7A 3D27A 5CIKA 1C21A 4FKCA 4U73A 1QZYA 4FO7A 1WY2A 3TAVA 4JUQA 4Z7MA 4IKUA 1KQ0A 1YW7A 5CDLA 2B3HA 3IU9A 4MATA 1QXZA 1YW8A 5JI6A 3MR1A 1CHMA 3RVAA 4FO8A 2GG7A 2GU6A 4U6ZA 4ZWOA 1C27A 3FM3A 2GA2A 3MATA 3CB5A 3CTZA 2BHAA 2V6CA 4S01A 1YJ3A 2ZSGA 4S2TP 3BIQA 3PKBA 2MATA 2GU5A 4IDYA 2GG3A 4U6EA 2Q92A 1JAWA 2EA2A 2V3ZA 2V3XA 1XGOA 1C24A 2Q93A 4EGEA 2P9AA 5CDVA 2B3KA 4ZNGA 2OAZA 4FLLA 4QR8A 4ZWPA 2BB7A 4U75A 2ADUA 3S6BA 1B59A 1W7VA 2GZ5A 4A6VA 2GU7A 1WL6A 3PKCA 3PKDA 3RORA 5CE6A 4PNCA 1WN1A 2BWYA 4R60A 2B3LA 4ZWUA 4PV4A 3FMRA 3Q6DA 2Q96A 2BWSA 1W2MA 2P98A 5CNXA 4IPAA 3IG4A 4IKSA 2OKNA 1YVMA 2BWTA 2GGCA 2EVOA 1WBQA 4FLIA 1WLRA 2GG5A 1XGMA 1WL9A 2GG2A 4U6CA 4IECA 2G6PA 1BN5A 2V3YA 1N51A 1KP0A 2BWUA 2EVCA 3BIPA 2BN7A 4IU6A 4U1BA 1WKMA 2BH3A 5CLSA 5E5BA 2BHDA 4RZYA 4S2RP 2GG9A 1C23A 3MX6A 1R58A 1C22A 2BHCA 4IKRA 1BOAA 2EA4A 5CDEA 1XGSA
chains in the Genus database with same CATH topology
2Q94A 2GG8A 5D6FA 3TB5A 1A16A 1B6AA 1QXWA 2Q95A 4IKTA 2BWVA 1KQ9A 2GTXA 4FLKA 4A6WA 1O0XA 2GG0A 2EVMA 4U70A 3CB6A 5D6EA 4IF7A 4U76A 5FCFA 4FLJA 2BHBA 4U69A 1Y1NA 4OOKA 1QXYA 4FUKA 4RGZ1 1MATA 2GGBA 1M35A 2GU4A 2HOWA 2BWXA 4S00A 5JFRA 2BWWA 1XNZA 2Q8KA 3FMQA 3BITA 2IW2A 4HXXA 2DFIA 5JHUA 1PV9A 2NQ6A 2P99A 3L7GA 4KM3A 4B28A 3PKEA 1R5GA 1R5HA 3L24A 4U6WA 4U71A 1XGNA 4U6JA 1YW9A 3PKAA 5FCHA 3IU7A 3IU8A 4RZZA 2NQ7A 3D27A 5CIKA 1C21A 4FKCA 4U73A 1QZYA 4FO7A 1WY2A 3TAVA 4JUQA 4Z7MA 4IKUA 1KQ0A 1YW7A 5CDLA 2B3HA 3IU9A 4MATA 1QXZA 1YW8A 5JI6A 3MR1A 1CHMA 3RVAA 4FO8A 2GG7A 2GU6A 4U6ZA 4ZWOA 1C27A 3FM3A 2GA2A 3MATA 3CB5A 3CTZA 2BHAA 2V6CA 4S01A 1YJ3A 2ZSGA 4S2TP 3BIQA 3PKBA 2MATA 2GU5A 4IDYA 2GG3A 4U6EA 2Q92A 1JAWA 2EA2A 2V3ZA 2V3XA 1XGOA 1C24A 2Q93A 4EGEA 2P9AA 5CDVA 2B3KA 4ZNGA 2OAZA 4FLLA 4QR8A 4ZWPA 2BB7A 4U75A 2ADUA 3S6BA 1B59A 1W7VA 2GZ5A 4A6VA 2GU7A 1WL6A 3PKCA 3PKDA 3RORA 5CE6A 4PNCA 1WN1A 2BWYA 4R60A 2B3LA 4ZWUA 4PV4A 3FMRA 3Q6DA 2Q96A 2BWSA 1W2MA 2P98A 5CNXA 4IPAA 3IG4A 4IKSA 2OKNA 1YVMA 2BWTA 2GGCA 2EVOA 1WBQA 4FLIA 1WLRA 2GG5A 1XGMA 1WL9A 2GG2A 4U6CA 4IECA 2G6PA 1BN5A 2V3YA 1N51A 1KP0A 2BWUA 2EVCA 3BIPA 2BN7A 4IU6A 4U1BA 1WKMA 2BH3A 5CLSA 5E5BA 2BHDA 4RZYA 4S2RP 2GG9A 1C23A 3MX6A 1R58A 1C22A 2BHCA 4IKRA 1BOAA 2EA4A 5CDEA 1XGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q94 A;  2GG8 A;  5D6F A;  3TB5 A;  1A16 A;  1B6A A;  1QXW A;  2Q95 A;  4IKT A;  2BWV A;  1KQ9 A;  2GTX A;  4FLK A;  4A6W A;  1O0X A;  2GG0 A;  2EVM A;  4U70 A;  3CB6 A;  5D6E A;  4IF7 A;  4U76 A;  5FCF A;  4FLJ A;  2BHB A;  4U69 A;  1Y1N A;  4OOK A;  1QXY A;  4FUK A;  4RGZ 1;  1MAT A;  2GGB A;  1M35 A;  2GU4 A;  2HOW A;  2BWX A;  4S00 A;  5JFR A;  2BWW A;  1XNZ A;  2Q8K A;  3FMQ A;  3BIT A;  2IW2 A;  4HXX A;  2DFI A;  5JHU A;  1PV9 A;  2NQ6 A;  2P99 A;  3L7G A;  4KM3 A;  4B28 A;  3PKE A;  1R5G A;  1R5H A;  3L24 A;  4U6W A;  4U71 A;  1XGN A;  4U6J A;  1YW9 A;  3PKA A;  5FCH A;  3IU7 A;  3IU8 A;  4RZZ A;  2NQ7 A;  3D27 A;  5CIK A;  1C21 A;  4FKC A;  4U73 A;  1QZY A;  4FO7 A;  1WY2 A;  3TAV A;  4JUQ A;  4Z7M A;  4IKU A;  1KQ0 A;  1YW7 A;  5CDL A;  2B3H A;  3IU9 A;  4MAT A;  1QXZ A;  1YW8 A;  5JI6 A;  3MR1 A;  1CHM A;  3RVA A;  4FO8 A;  2GG7 A;  2GU6 A;  4U6Z A;  4ZWO A;  1C27 A;  3FM3 A;  2GA2 A;  3MAT A;  3CB5 A;  3CTZ A;  2BHA A;  2V6C A;  4S01 A;  1YJ3 A;  2ZSG A;  4S2T P;  3BIQ A;  3PKB A;  2MAT A;  2GU5 A;  4IDY A;  2GG3 A;  4U6E A;  2Q92 A;  1JAW A;  2EA2 A;  2V3Z A;  2V3X A;  1XGO A;  1C24 A;  2Q93 A;  4EGE A;  2P9A A;  5CDV A;  2B3K A;  4ZNG A;  2OAZ A;  4FLL A;  4QR8 A;  4ZWP A;  2BB7 A;  4U75 A;  2ADU A;  3S6B A;  1B59 A;  1W7V A;  2GZ5 A;  4A6V A;  2GU7 A;  1WL6 A;  3PKC A;  3PKD A;  3ROR A;  5CE6 A;  4PNC A;  1WN1 A;  2BWY A;  4R60 A;  2B3L A;  4ZWU A;  4PV4 A;  3FMR A;  3Q6D A;  2Q96 A;  2BWS A;  1W2M A;  2P98 A;  5CNX A;  4IPA A;  3IG4 A;  4IKS A;  2OKN A;  1YVM A;  2BWT A;  2GGC A;  2EVO A;  1WBQ A;  4FLI A;  1WLR A;  2GG5 A;  1XGM A;  1WL9 A;  2GG2 A;  4U6C A;  4IEC A;  2G6P A;  1BN5 A;  2V3Y A;  1N51 A;  1KP0 A;  2BWU A;  2EVC A;  3BIP A;  2BN7 A;  4IU6 A;  4U1B A;  1WKM A;  2BH3 A;  5CLS A;  5E5B A;  2BHD A;  4RZY A;  4S2R P;  2GG9 A;  1C23 A;  3MX6 A;  1R58 A;  1C22 A;  2BHC A;  4IKR A;  1BOA A;  2EA4 A;  5CDE A;  1XGS A; 
#chains in the Genus database with same CATH topology
 2Q94 A;  2GG8 A;  5D6F A;  3TB5 A;  1A16 A;  1B6A A;  1QXW A;  2Q95 A;  4IKT A;  2BWV A;  1KQ9 A;  2GTX A;  4FLK A;  4A6W A;  1O0X A;  2GG0 A;  2EVM A;  4U70 A;  3CB6 A;  5D6E A;  4IF7 A;  4U76 A;  5FCF A;  4FLJ A;  2BHB A;  4U69 A;  1Y1N A;  4OOK A;  1QXY A;  4FUK A;  4RGZ 1;  1MAT A;  2GGB A;  1M35 A;  2GU4 A;  2HOW A;  2BWX A;  4S00 A;  5JFR A;  2BWW A;  1XNZ A;  2Q8K A;  3FMQ A;  3BIT A;  2IW2 A;  4HXX A;  2DFI A;  5JHU A;  1PV9 A;  2NQ6 A;  2P99 A;  3L7G A;  4KM3 A;  4B28 A;  3PKE A;  1R5G A;  1R5H A;  3L24 A;  4U6W A;  4U71 A;  1XGN A;  4U6J A;  1YW9 A;  3PKA A;  5FCH A;  3IU7 A;  3IU8 A;  4RZZ A;  2NQ7 A;  3D27 A;  5CIK A;  1C21 A;  4FKC A;  4U73 A;  1QZY A;  4FO7 A;  1WY2 A;  3TAV A;  4JUQ A;  4Z7M A;  4IKU A;  1KQ0 A;  1YW7 A;  5CDL A;  2B3H A;  3IU9 A;  4MAT A;  1QXZ A;  1YW8 A;  5JI6 A;  3MR1 A;  1CHM A;  3RVA A;  4FO8 A;  2GG7 A;  2GU6 A;  4U6Z A;  4ZWO A;  1C27 A;  3FM3 A;  2GA2 A;  3MAT A;  3CB5 A;  3CTZ A;  2BHA A;  2V6C A;  4S01 A;  1YJ3 A;  2ZSG A;  4S2T P;  3BIQ A;  3PKB A;  2MAT A;  2GU5 A;  4IDY A;  2GG3 A;  4U6E A;  2Q92 A;  1JAW A;  2EA2 A;  2V3Z A;  2V3X A;  1XGO A;  1C24 A;  2Q93 A;  4EGE A;  2P9A A;  5CDV A;  2B3K A;  4ZNG A;  2OAZ A;  4FLL A;  4QR8 A;  4ZWP A;  2BB7 A;  4U75 A;  2ADU A;  3S6B A;  1B59 A;  1W7V A;  2GZ5 A;  4A6V A;  2GU7 A;  1WL6 A;  3PKC A;  3PKD A;  3ROR A;  5CE6 A;  4PNC A;  1WN1 A;  2BWY A;  4R60 A;  2B3L A;  4ZWU A;  4PV4 A;  3FMR A;  3Q6D A;  2Q96 A;  2BWS A;  1W2M A;  2P98 A;  5CNX A;  4IPA A;  3IG4 A;  4IKS A;  2OKN A;  1YVM A;  2BWT A;  2GGC A;  2EVO A;  1WBQ A;  4FLI A;  1WLR A;  2GG5 A;  1XGM A;  1WL9 A;  2GG2 A;  4U6C A;  4IEC A;  2G6P A;  1BN5 A;  2V3Y A;  1N51 A;  1KP0 A;  2BWU A;  2EVC A;  3BIP A;  2BN7 A;  4IU6 A;  4U1B A;  1WKM A;  2BH3 A;  5CLS A;  5E5B A;  2BHD A;  4RZY A;  4S2R P;  2GG9 A;  1C23 A;  3MX6 A;  1R58 A;  1C22 A;  2BHC A;  4IKR A;  1BOA A;  2EA4 A;  5CDE A;  1XGS A; 
#chains in the Genus database with same CATH homology
 2Q94 A;  2GG8 A;  5D6F A;  3TB5 A;  1A16 A;  1B6A A;  1QXW A;  2Q95 A;  4IKT A;  2BWV A;  1KQ9 A;  2GTX A;  4FLK A;  4A6W A;  1O0X A;  2GG0 A;  2EVM A;  4U70 A;  3CB6 A;  5D6E A;  4IF7 A;  4U76 A;  5FCF A;  4FLJ A;  2BHB A;  4U69 A;  1Y1N A;  4OOK A;  1QXY A;  4FUK A;  4RGZ 1;  1MAT A;  2GGB A;  1M35 A;  2GU4 A;  2HOW A;  2BWX A;  4S00 A;  5JFR A;  2BWW A;  1XNZ A;  2Q8K A;  3FMQ A;  3BIT A;  2IW2 A;  4HXX A;  2DFI A;  5JHU A;  1PV9 A;  2NQ6 A;  2P99 A;  3L7G A;  4KM3 A;  4B28 A;  3PKE A;  1R5G A;  1R5H A;  3L24 A;  4U6W A;  4U71 A;  1XGN A;  4U6J A;  1YW9 A;  3PKA A;  5FCH A;  3IU7 A;  3IU8 A;  4RZZ A;  2NQ7 A;  3D27 A;  5CIK A;  1C21 A;  4FKC A;  4U73 A;  1QZY A;  4FO7 A;  1WY2 A;  3TAV A;  4JUQ A;  4Z7M A;  4IKU A;  1KQ0 A;  1YW7 A;  5CDL A;  2B3H A;  3IU9 A;  4MAT A;  1QXZ A;  1YW8 A;  5JI6 A;  3MR1 A;  1CHM A;  3RVA A;  4FO8 A;  2GG7 A;  2GU6 A;  4U6Z A;  4ZWO A;  1C27 A;  3FM3 A;  2GA2 A;  3MAT A;  3CB5 A;  3CTZ A;  2BHA A;  2V6C A;  4S01 A;  1YJ3 A;  2ZSG A;  4S2T P;  3BIQ A;  3PKB A;  2MAT A;  2GU5 A;  4IDY A;  2GG3 A;  4U6E A;  2Q92 A;  1JAW A;  2EA2 A;  2V3Z A;  2V3X A;  1XGO A;  1C24 A;  2Q93 A;  4EGE A;  2P9A A;  5CDV A;  2B3K A;  4ZNG A;  2OAZ A;  4FLL A;  4QR8 A;  4ZWP A;  2BB7 A;  4U75 A;  2ADU A;  3S6B A;  1B59 A;  1W7V A;  2GZ5 A;  4A6V A;  2GU7 A;  1WL6 A;  3PKC A;  3PKD A;  3ROR A;  5CE6 A;  4PNC A;  1WN1 A;  2BWY A;  4R60 A;  2B3L A;  4ZWU A;  4PV4 A;  3FMR A;  3Q6D A;  2Q96 A;  2BWS A;  1W2M A;  2P98 A;  5CNX A;  4IPA A;  3IG4 A;  4IKS A;  2OKN A;  1YVM A;  2BWT A;  2GGC A;  2EVO A;  1WBQ A;  4FLI A;  1WLR A;  2GG5 A;  1XGM A;  1WL9 A;  2GG2 A;  4U6C A;  4IEC A;  2G6P A;  1BN5 A;  2V3Y A;  1N51 A;  1KP0 A;  2BWU A;  2EVC A;  3BIP A;  2BN7 A;  4IU6 A;  4U1B A;  1WKM A;  2BH3 A;  5CLS A;  5E5B A;  2BHD A;  4RZY A;  4S2R P;  2GG9 A;  1C23 A;  3MX6 A;  1R58 A;  1C22 A;  2BHC A;  4IKR A;  1BOA A;  2EA4 A;  5CDE A;  1XGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...