4U76A

Hsmetap (f309m) holo form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u76A00
4FO7A 2G6PA 1B6AA 4RZZA 1BOAA 1N51A 1MATA 2OAZA 4RGZ1 4U73A 1WN1A 2BHBA 4FLLA 4ZWUA 4FLJA 1QXZA 1XGNA 2GA2A 4FUKA 2BWYA 2EVMA 2GU6A 2EA2A 1QXWA 2BWVA 2Q95A 3L24A 1O0XA 3TB5A 3MATA 3FMQA 1XNZA 4MATA 4U70A 2BWTA 1C23A 3MX6A 2GU5A 3CB6A 3D27A 3L7GA 4FO8A 1PV9A 5JI6A 4S2RP 2GTXA 4IKUA 2V6CA 5JFRA 1R5GA 2GZ5A 4FKCA 4RZYA 1YW9A 1WY2A 2DFIA 4IU6A 2GGCA 3IU7A 4U6ZA 4U71A 3CB5A 1YJ3A 3PKCA 3BIQA 2EA4A 2Q96A 4U6CA 4QR8A 4U1BA 1B59A 1CHMA 4R60A 4U6EA 4KM3A 4U69A 1M35A 4U6JA 2BHAA 1A16A 2V3ZA 2GG2A 5CIKA 4IECA 3RVAA 1C21A 1WKMA 1WLRA 3RORA 1JAWA 2GU4A 1W7VA 4U75A 2NQ7A 2B3LA 2Q94A 4OOKA 4IPAA 4U6WA 2BN7A 2BWXA 1Y1NA 4IKTA 2EVCA 3PKAA 2BH3A 4A6WA 1R58A 5E5BA 2NQ6A 2EVOA 1QXYA 4IDYA 2IW2A 2Q92A 3CTZA 2B3HA 2GG3A 3PKEA 4PV4A 1WL9A 3BITA 1WL6A 4ZWPA 1KP0A 4FLIA 1C27A 2GG9A 2Q8KA 1QZYA 2GU7A 5FCHA 2V3XA 2ADUA 5CLSA 5D6FA 2BWUA 2GG0A 4B28A 5CDEA 2BWWA 4S2TP 5CNXA 2BWSA 2BHCA 2GG5A 3FMRA 3Q6DA 3PKBA 4ZNGA 1YW8A 1WBQA 4U76A 2OKNA 3FM3A 3MR1A 3BIPA 3IG4A 1XGMA 4JUQA 1BN5A 2ZSGA 5JHUA 2P98A 4HXXA 2V3YA 1YVMA 3PKDA 1YW7A 1XGSA 4IF7A 5D6EA 4A6VA 1KQ0A 5CDLA 3S6BA 4IKSA 1W2MA 4Z7MA 4FLKA 4S00A 5CDVA 3IU8A 2BHDA 3IU9A 4PNCA 2BB7A 4IKRA 1C24A 1XGOA 5FCFA 5CE6A 2GG8A 4ZWOA 2MATA 2P99A 4S01A 2GGBA 1KQ9A 2GG7A 1C22A 2HOWA 3TAVA 4EGEA 1R5HA 2B3KA 2P9AA 2Q93A
chains in the Genus database with same CATH superfamily
4FO7A 2G6PA 1B6AA 4RZZA 1BOAA 1N51A 1MATA 2OAZA 4RGZ1 4U73A 1WN1A 2BHBA 4FLLA 4ZWUA 4FLJA 1QXZA 1XGNA 2GA2A 4FUKA 2BWYA 2EVMA 2GU6A 2EA2A 1QXWA 2BWVA 2Q95A 3L24A 1O0XA 3TB5A 3MATA 3FMQA 1XNZA 4MATA 4U70A 2BWTA 1C23A 3MX6A 2GU5A 3CB6A 3D27A 3L7GA 4FO8A 1PV9A 5JI6A 4S2RP 2GTXA 4IKUA 2V6CA 5JFRA 1R5GA 2GZ5A 4FKCA 4RZYA 1YW9A 1WY2A 2DFIA 4IU6A 2GGCA 3IU7A 4U6ZA 4U71A 3CB5A 1YJ3A 3PKCA 3BIQA 2EA4A 2Q96A 4U6CA 4QR8A 4U1BA 1B59A 1CHMA 4R60A 4U6EA 4KM3A 4U69A 1M35A 4U6JA 2BHAA 1A16A 2V3ZA 2GG2A 5CIKA 4IECA 3RVAA 1C21A 1WKMA 1WLRA 3RORA 1JAWA 2GU4A 1W7VA 4U75A 2NQ7A 2B3LA 2Q94A 4OOKA 4IPAA 4U6WA 2BN7A 2BWXA 1Y1NA 4IKTA 2EVCA 3PKAA 2BH3A 4A6WA 1R58A 5E5BA 2NQ6A 2EVOA 1QXYA 4IDYA 2IW2A 2Q92A 3CTZA 2B3HA 2GG3A 3PKEA 4PV4A 1WL9A 3BITA 1WL6A 4ZWPA 1KP0A 4FLIA 1C27A 2GG9A 2Q8KA 1QZYA 2GU7A 5FCHA 2V3XA 2ADUA 5CLSA 5D6FA 2BWUA 2GG0A 4B28A 5CDEA 2BWWA 4S2TP 5CNXA 2BWSA 2BHCA 2GG5A 3FMRA 3Q6DA 3PKBA 4ZNGA 1YW8A 1WBQA 4U76A 2OKNA 3FM3A 3MR1A 3BIPA 3IG4A 1XGMA 4JUQA 1BN5A 2ZSGA 5JHUA 2P98A 4HXXA 2V3YA 1YVMA 3PKDA 1YW7A 1XGSA 4IF7A 5D6EA 4A6VA 1KQ0A 5CDLA 3S6BA 4IKSA 1W2MA 4Z7MA 4FLKA 4S00A 5CDVA 3IU8A 2BHDA 3IU9A 4PNCA 2BB7A 4IKRA 1C24A 1XGOA 5FCFA 5CE6A 2GG8A 4ZWOA 2MATA 2P99A 4S01A 2GGBA 1KQ9A 2GG7A 1C22A 2HOWA 3TAVA 4EGEA 1R5HA 2B3KA 2P9AA 2Q93A
chains in the Genus database with same CATH topology
4FO7A 2G6PA 1B6AA 4RZZA 1BOAA 1N51A 1MATA 2OAZA 4RGZ1 4U73A 1WN1A 2BHBA 4FLLA 4ZWUA 4FLJA 1QXZA 1XGNA 2GA2A 4FUKA 2BWYA 2EVMA 2GU6A 2EA2A 1QXWA 2BWVA 2Q95A 3L24A 1O0XA 3TB5A 3MATA 3FMQA 1XNZA 4MATA 4U70A 2BWTA 1C23A 3MX6A 2GU5A 3CB6A 3D27A 3L7GA 4FO8A 1PV9A 5JI6A 4S2RP 2GTXA 4IKUA 2V6CA 5JFRA 1R5GA 2GZ5A 4FKCA 4RZYA 1YW9A 1WY2A 2DFIA 4IU6A 2GGCA 3IU7A 4U6ZA 4U71A 3CB5A 1YJ3A 3PKCA 3BIQA 2EA4A 2Q96A 4U6CA 4QR8A 4U1BA 1B59A 1CHMA 4R60A 4U6EA 4KM3A 4U69A 1M35A 4U6JA 2BHAA 1A16A 2V3ZA 2GG2A 5CIKA 4IECA 3RVAA 1C21A 1WKMA 1WLRA 3RORA 1JAWA 2GU4A 1W7VA 4U75A 2NQ7A 2B3LA 2Q94A 4OOKA 4IPAA 4U6WA 2BN7A 2BWXA 1Y1NA 4IKTA 2EVCA 3PKAA 2BH3A 4A6WA 1R58A 5E5BA 2NQ6A 2EVOA 1QXYA 4IDYA 2IW2A 2Q92A 3CTZA 2B3HA 2GG3A 3PKEA 4PV4A 1WL9A 3BITA 1WL6A 4ZWPA 1KP0A 4FLIA 1C27A 2GG9A 2Q8KA 1QZYA 2GU7A 5FCHA 2V3XA 2ADUA 5CLSA 5D6FA 2BWUA 2GG0A 4B28A 5CDEA 2BWWA 4S2TP 5CNXA 2BWSA 2BHCA 2GG5A 3FMRA 3Q6DA 3PKBA 4ZNGA 1YW8A 1WBQA 4U76A 2OKNA 3FM3A 3MR1A 3BIPA 3IG4A 1XGMA 4JUQA 1BN5A 2ZSGA 5JHUA 2P98A 4HXXA 2V3YA 1YVMA 3PKDA 1YW7A 1XGSA 4IF7A 5D6EA 4A6VA 1KQ0A 5CDLA 3S6BA 4IKSA 1W2MA 4Z7MA 4FLKA 4S00A 5CDVA 3IU8A 2BHDA 3IU9A 4PNCA 2BB7A 4IKRA 1C24A 1XGOA 5FCFA 5CE6A 2GG8A 4ZWOA 2MATA 2P99A 4S01A 2GGBA 1KQ9A 2GG7A 1C22A 2HOWA 3TAVA 4EGEA 1R5HA 2B3KA 2P9AA 2Q93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO7 A;  2G6P A;  1B6A A;  4RZZ A;  1BOA A;  1N51 A;  1MAT A;  2OAZ A;  4RGZ 1;  4U73 A;  1WN1 A;  2BHB A;  4FLL A;  4ZWU A;  4FLJ A;  1QXZ A;  1XGN A;  2GA2 A;  4FUK A;  2BWY A;  2EVM A;  2GU6 A;  2EA2 A;  1QXW A;  2BWV A;  2Q95 A;  3L24 A;  1O0X A;  3TB5 A;  3MAT A;  3FMQ A;  1XNZ A;  4MAT A;  4U70 A;  2BWT A;  1C23 A;  3MX6 A;  2GU5 A;  3CB6 A;  3D27 A;  3L7G A;  4FO8 A;  1PV9 A;  5JI6 A;  4S2R P;  2GTX A;  4IKU A;  2V6C A;  5JFR A;  1R5G A;  2GZ5 A;  4FKC A;  4RZY A;  1YW9 A;  1WY2 A;  2DFI A;  4IU6 A;  2GGC A;  3IU7 A;  4U6Z A;  4U71 A;  3CB5 A;  1YJ3 A;  3PKC A;  3BIQ A;  2EA4 A;  2Q96 A;  4U6C A;  4QR8 A;  4U1B A;  1B59 A;  1CHM A;  4R60 A;  4U6E A;  4KM3 A;  4U69 A;  1M35 A;  4U6J A;  2BHA A;  1A16 A;  2V3Z A;  2GG2 A;  5CIK A;  4IEC A;  3RVA A;  1C21 A;  1WKM A;  1WLR A;  3ROR A;  1JAW A;  2GU4 A;  1W7V A;  4U75 A;  2NQ7 A;  2B3L A;  2Q94 A;  4OOK A;  4IPA A;  4U6W A;  2BN7 A;  2BWX A;  1Y1N A;  4IKT A;  2EVC A;  3PKA A;  2BH3 A;  4A6W A;  1R58 A;  5E5B A;  2NQ6 A;  2EVO A;  1QXY A;  4IDY A;  2IW2 A;  2Q92 A;  3CTZ A;  2B3H A;  2GG3 A;  3PKE A;  4PV4 A;  1WL9 A;  3BIT A;  1WL6 A;  4ZWP A;  1KP0 A;  4FLI A;  1C27 A;  2GG9 A;  2Q8K A;  1QZY A;  2GU7 A;  5FCH A;  2V3X A;  2ADU A;  5CLS A;  5D6F A;  2BWU A;  2GG0 A;  4B28 A;  5CDE A;  2BWW A;  4S2T P;  5CNX A;  2BWS A;  2BHC A;  2GG5 A;  3FMR A;  3Q6D A;  3PKB A;  4ZNG A;  1YW8 A;  1WBQ A;  4U76 A;  2OKN A;  3FM3 A;  3MR1 A;  3BIP A;  3IG4 A;  1XGM A;  4JUQ A;  1BN5 A;  2ZSG A;  5JHU A;  2P98 A;  4HXX A;  2V3Y A;  1YVM A;  3PKD A;  1YW7 A;  1XGS A;  4IF7 A;  5D6E A;  4A6V A;  1KQ0 A;  5CDL A;  3S6B A;  4IKS A;  1W2M A;  4Z7M A;  4FLK A;  4S00 A;  5CDV A;  3IU8 A;  2BHD A;  3IU9 A;  4PNC A;  2BB7 A;  4IKR A;  1C24 A;  1XGO A;  5FCF A;  5CE6 A;  2GG8 A;  4ZWO A;  2MAT A;  2P99 A;  4S01 A;  2GGB A;  1KQ9 A;  2GG7 A;  1C22 A;  2HOW A;  3TAV A;  4EGE A;  1R5H A;  2B3K A;  2P9A A;  2Q93 A; 
#chains in the Genus database with same CATH topology
 4FO7 A;  2G6P A;  1B6A A;  4RZZ A;  1BOA A;  1N51 A;  1MAT A;  2OAZ A;  4RGZ 1;  4U73 A;  1WN1 A;  2BHB A;  4FLL A;  4ZWU A;  4FLJ A;  1QXZ A;  1XGN A;  2GA2 A;  4FUK A;  2BWY A;  2EVM A;  2GU6 A;  2EA2 A;  1QXW A;  2BWV A;  2Q95 A;  3L24 A;  1O0X A;  3TB5 A;  3MAT A;  3FMQ A;  1XNZ A;  4MAT A;  4U70 A;  2BWT A;  1C23 A;  3MX6 A;  2GU5 A;  3CB6 A;  3D27 A;  3L7G A;  4FO8 A;  1PV9 A;  5JI6 A;  4S2R P;  2GTX A;  4IKU A;  2V6C A;  5JFR A;  1R5G A;  2GZ5 A;  4FKC A;  4RZY A;  1YW9 A;  1WY2 A;  2DFI A;  4IU6 A;  2GGC A;  3IU7 A;  4U6Z A;  4U71 A;  3CB5 A;  1YJ3 A;  3PKC A;  3BIQ A;  2EA4 A;  2Q96 A;  4U6C A;  4QR8 A;  4U1B A;  1B59 A;  1CHM A;  4R60 A;  4U6E A;  4KM3 A;  4U69 A;  1M35 A;  4U6J A;  2BHA A;  1A16 A;  2V3Z A;  2GG2 A;  5CIK A;  4IEC A;  3RVA A;  1C21 A;  1WKM A;  1WLR A;  3ROR A;  1JAW A;  2GU4 A;  1W7V A;  4U75 A;  2NQ7 A;  2B3L A;  2Q94 A;  4OOK A;  4IPA A;  4U6W A;  2BN7 A;  2BWX A;  1Y1N A;  4IKT A;  2EVC A;  3PKA A;  2BH3 A;  4A6W A;  1R58 A;  5E5B A;  2NQ6 A;  2EVO A;  1QXY A;  4IDY A;  2IW2 A;  2Q92 A;  3CTZ A;  2B3H A;  2GG3 A;  3PKE A;  4PV4 A;  1WL9 A;  3BIT A;  1WL6 A;  4ZWP A;  1KP0 A;  4FLI A;  1C27 A;  2GG9 A;  2Q8K A;  1QZY A;  2GU7 A;  5FCH A;  2V3X A;  2ADU A;  5CLS A;  5D6F A;  2BWU A;  2GG0 A;  4B28 A;  5CDE A;  2BWW A;  4S2T P;  5CNX A;  2BWS A;  2BHC A;  2GG5 A;  3FMR A;  3Q6D A;  3PKB A;  4ZNG A;  1YW8 A;  1WBQ A;  4U76 A;  2OKN A;  3FM3 A;  3MR1 A;  3BIP A;  3IG4 A;  1XGM A;  4JUQ A;  1BN5 A;  2ZSG A;  5JHU A;  2P98 A;  4HXX A;  2V3Y A;  1YVM A;  3PKD A;  1YW7 A;  1XGS A;  4IF7 A;  5D6E A;  4A6V A;  1KQ0 A;  5CDL A;  3S6B A;  4IKS A;  1W2M A;  4Z7M A;  4FLK A;  4S00 A;  5CDV A;  3IU8 A;  2BHD A;  3IU9 A;  4PNC A;  2BB7 A;  4IKR A;  1C24 A;  1XGO A;  5FCF A;  5CE6 A;  2GG8 A;  4ZWO A;  2MAT A;  2P99 A;  4S01 A;  2GGB A;  1KQ9 A;  2GG7 A;  1C22 A;  2HOW A;  3TAV A;  4EGE A;  1R5H A;  2B3K A;  2P9A A;  2Q93 A; 
#chains in the Genus database with same CATH homology
 4FO7 A;  2G6P A;  1B6A A;  4RZZ A;  1BOA A;  1N51 A;  1MAT A;  2OAZ A;  4RGZ 1;  4U73 A;  1WN1 A;  2BHB A;  4FLL A;  4ZWU A;  4FLJ A;  1QXZ A;  1XGN A;  2GA2 A;  4FUK A;  2BWY A;  2EVM A;  2GU6 A;  2EA2 A;  1QXW A;  2BWV A;  2Q95 A;  3L24 A;  1O0X A;  3TB5 A;  3MAT A;  3FMQ A;  1XNZ A;  4MAT A;  4U70 A;  2BWT A;  1C23 A;  3MX6 A;  2GU5 A;  3CB6 A;  3D27 A;  3L7G A;  4FO8 A;  1PV9 A;  5JI6 A;  4S2R P;  2GTX A;  4IKU A;  2V6C A;  5JFR A;  1R5G A;  2GZ5 A;  4FKC A;  4RZY A;  1YW9 A;  1WY2 A;  2DFI A;  4IU6 A;  2GGC A;  3IU7 A;  4U6Z A;  4U71 A;  3CB5 A;  1YJ3 A;  3PKC A;  3BIQ A;  2EA4 A;  2Q96 A;  4U6C A;  4QR8 A;  4U1B A;  1B59 A;  1CHM A;  4R60 A;  4U6E A;  4KM3 A;  4U69 A;  1M35 A;  4U6J A;  2BHA A;  1A16 A;  2V3Z A;  2GG2 A;  5CIK A;  4IEC A;  3RVA A;  1C21 A;  1WKM A;  1WLR A;  3ROR A;  1JAW A;  2GU4 A;  1W7V A;  4U75 A;  2NQ7 A;  2B3L A;  2Q94 A;  4OOK A;  4IPA A;  4U6W A;  2BN7 A;  2BWX A;  1Y1N A;  4IKT A;  2EVC A;  3PKA A;  2BH3 A;  4A6W A;  1R58 A;  5E5B A;  2NQ6 A;  2EVO A;  1QXY A;  4IDY A;  2IW2 A;  2Q92 A;  3CTZ A;  2B3H A;  2GG3 A;  3PKE A;  4PV4 A;  1WL9 A;  3BIT A;  1WL6 A;  4ZWP A;  1KP0 A;  4FLI A;  1C27 A;  2GG9 A;  2Q8K A;  1QZY A;  2GU7 A;  5FCH A;  2V3X A;  2ADU A;  5CLS A;  5D6F A;  2BWU A;  2GG0 A;  4B28 A;  5CDE A;  2BWW A;  4S2T P;  5CNX A;  2BWS A;  2BHC A;  2GG5 A;  3FMR A;  3Q6D A;  3PKB A;  4ZNG A;  1YW8 A;  1WBQ A;  4U76 A;  2OKN A;  3FM3 A;  3MR1 A;  3BIP A;  3IG4 A;  1XGM A;  4JUQ A;  1BN5 A;  2ZSG A;  5JHU A;  2P98 A;  4HXX A;  2V3Y A;  1YVM A;  3PKD A;  1YW7 A;  1XGS A;  4IF7 A;  5D6E A;  4A6V A;  1KQ0 A;  5CDL A;  3S6B A;  4IKS A;  1W2M A;  4Z7M A;  4FLK A;  4S00 A;  5CDV A;  3IU8 A;  2BHD A;  3IU9 A;  4PNC A;  2BB7 A;  4IKR A;  1C24 A;  1XGO A;  5FCF A;  5CE6 A;  2GG8 A;  4ZWO A;  2MAT A;  2P99 A;  4S01 A;  2GGB A;  1KQ9 A;  2GG7 A;  1C22 A;  2HOW A;  3TAV A;  4EGE A;  1R5H A;  2B3K A;  2P9A A;  2Q93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...