4U76A

Hsmetap (f309m) holo form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u76A00
2DFIA 3CB6A 3TB5A 1YW9A 1BOAA 2BHCA 3MX6A 4IDYA 5D6FA 1O0XA 2G6PA 2B3KA 4RGZ1 5JHUA 2ADUA 2GU6A 4U69A 1WKMA 2BWTA 5CLSA 1C22A 4S01A 3RORA 3IU9A 4U6ZA 4U6WA 2BWSA 4U73A 1XGMA 2BH3A 5D6EA 4IKRA 2GG5A 4RZZA 2NQ6A 3BITA 4ZWUA 3IG4A 4S2TP 1WY2A 1QXWA 2NQ7A 4RZYA 1WBQA 4B28A 2EVOA 3PKCA 4U71A 3RVAA 2BWUA 2Q93A 3L24A 4ZWOA 1C27A 3BIQA 2BWYA 4R60A 1C24A 2GTXA 1XGSA 2GG0A 2BWVA 5CIKA 1MATA 4S00A 4FO7A 4IF7A 1YW7A 3TAVA 2BN7A 3PKDA 4FLJA 4EGEA 2GU4A 1JAWA 1XGNA 3PKBA 3Q6DA 4U6CA 5CNXA 4A6WA 4FKCA 5CE6A 1N51A 4OOKA 4ZNGA 3D27A 1KQ9A 4JUQA 4FLIA 4FLKA 4U75A 2ZSGA 4PNCA 2GG9A 1R58A 1A16A 5E5BA 1WL9A 5JI6A 1R5HA 1KQ0A 2GU5A 2EVMA 1B6AA 1C23A 3CB5A 1YW8A 1C21A 4HXXA 2GG2A 3CTZA 2GG7A 5CDEA 2Q96A 4PV4A 4S2RP 4FO8A 1M35A 1KP0A 4FUKA 4A6VA 1R5GA 1W2MA 2P98A 2BHBA 4KM3A 2BWWA 4QR8A 2P9AA 2Q94A 1WL6A 4ZWPA 1QZYA 2V3ZA 2GG3A 2BHDA 2GA2A 2EVCA 2GU7A 1WLRA 1CHMA 4IECA 4U70A 2GGBA 4MATA 5FCFA 4IKUA 4Z7MA 2GG8A 2MATA 2OAZA 4U1BA 1QXYA 2HOWA 2BB7A 3IU7A 4U6JA 1PV9A 1XGOA 2B3HA 2EA2A 4IKSA 1XNZA 2P99A 2GGCA 1YJ3A 3MATA 4U76A 2V6CA 4IPAA 1YVMA 2BHAA 3MR1A 2B3LA 3PKAA 2Q8KA 5JFRA 3BIPA 2OKNA 2GZ5A 4FLLA 2EA4A 4U6EA 5CDVA 1QXZA 1W7VA 4IKTA 5CDLA 1WN1A 2Q92A 3FMRA 2IW2A 2Q95A 3FM3A 3L7GA 2V3YA 1B59A 3FMQA 1Y1NA 2BWXA 4IU6A 3PKEA 2V3XA 1BN5A 3IU8A 3S6BA 5FCHA
chains in the Genus database with same CATH superfamily
2DFIA 3CB6A 3TB5A 1YW9A 1BOAA 2BHCA 3MX6A 4IDYA 5D6FA 1O0XA 2G6PA 2B3KA 4RGZ1 5JHUA 2ADUA 2GU6A 4U69A 1WKMA 2BWTA 5CLSA 1C22A 4S01A 3RORA 3IU9A 4U6ZA 4U6WA 2BWSA 4U73A 1XGMA 2BH3A 5D6EA 4IKRA 2GG5A 4RZZA 2NQ6A 3BITA 4ZWUA 3IG4A 4S2TP 1WY2A 1QXWA 2NQ7A 4RZYA 1WBQA 4B28A 2EVOA 3PKCA 4U71A 3RVAA 2BWUA 2Q93A 3L24A 4ZWOA 1C27A 3BIQA 2BWYA 4R60A 1C24A 2GTXA 1XGSA 2GG0A 2BWVA 5CIKA 1MATA 4S00A 4FO7A 4IF7A 1YW7A 3TAVA 2BN7A 3PKDA 4FLJA 4EGEA 2GU4A 1JAWA 1XGNA 3PKBA 3Q6DA 4U6CA 5CNXA 4A6WA 4FKCA 5CE6A 1N51A 4OOKA 4ZNGA 3D27A 1KQ9A 4JUQA 4FLIA 4FLKA 4U75A 2ZSGA 4PNCA 2GG9A 1R58A 1A16A 5E5BA 1WL9A 5JI6A 1R5HA 1KQ0A 2GU5A 2EVMA 1B6AA 1C23A 3CB5A 1YW8A 1C21A 4HXXA 2GG2A 3CTZA 2GG7A 5CDEA 2Q96A 4PV4A 4S2RP 4FO8A 1M35A 1KP0A 4FUKA 4A6VA 1R5GA 1W2MA 2P98A 2BHBA 4KM3A 2BWWA 4QR8A 2P9AA 2Q94A 1WL6A 4ZWPA 1QZYA 2V3ZA 2GG3A 2BHDA 2GA2A 2EVCA 2GU7A 1WLRA 1CHMA 4IECA 4U70A 2GGBA 4MATA 5FCFA 4IKUA 4Z7MA 2GG8A 2MATA 2OAZA 4U1BA 1QXYA 2HOWA 2BB7A 3IU7A 4U6JA 1PV9A 1XGOA 2B3HA 2EA2A 4IKSA 1XNZA 2P99A 2GGCA 1YJ3A 3MATA 4U76A 2V6CA 4IPAA 1YVMA 2BHAA 3MR1A 2B3LA 3PKAA 2Q8KA 5JFRA 3BIPA 2OKNA 2GZ5A 4FLLA 2EA4A 4U6EA 5CDVA 1QXZA 1W7VA 4IKTA 5CDLA 1WN1A 2Q92A 3FMRA 2IW2A 2Q95A 3FM3A 3L7GA 2V3YA 1B59A 3FMQA 1Y1NA 2BWXA 4IU6A 3PKEA 2V3XA 1BN5A 3IU8A 3S6BA 5FCHA
chains in the Genus database with same CATH topology
2DFIA 3CB6A 3TB5A 1YW9A 1BOAA 2BHCA 3MX6A 4IDYA 5D6FA 1O0XA 2G6PA 2B3KA 4RGZ1 5JHUA 2ADUA 2GU6A 4U69A 1WKMA 2BWTA 5CLSA 1C22A 4S01A 3RORA 3IU9A 4U6ZA 4U6WA 2BWSA 4U73A 1XGMA 2BH3A 5D6EA 4IKRA 2GG5A 4RZZA 2NQ6A 3BITA 4ZWUA 3IG4A 4S2TP 1WY2A 1QXWA 2NQ7A 4RZYA 1WBQA 4B28A 2EVOA 3PKCA 4U71A 3RVAA 2BWUA 2Q93A 3L24A 4ZWOA 1C27A 3BIQA 2BWYA 4R60A 1C24A 2GTXA 1XGSA 2GG0A 2BWVA 5CIKA 1MATA 4S00A 4FO7A 4IF7A 1YW7A 3TAVA 2BN7A 3PKDA 4FLJA 4EGEA 2GU4A 1JAWA 1XGNA 3PKBA 3Q6DA 4U6CA 5CNXA 4A6WA 4FKCA 5CE6A 1N51A 4OOKA 4ZNGA 3D27A 1KQ9A 4JUQA 4FLIA 4FLKA 4U75A 2ZSGA 4PNCA 2GG9A 1R58A 1A16A 5E5BA 1WL9A 5JI6A 1R5HA 1KQ0A 2GU5A 2EVMA 1B6AA 1C23A 3CB5A 1YW8A 1C21A 4HXXA 2GG2A 3CTZA 2GG7A 5CDEA 2Q96A 4PV4A 4S2RP 4FO8A 1M35A 1KP0A 4FUKA 4A6VA 1R5GA 1W2MA 2P98A 2BHBA 4KM3A 2BWWA 4QR8A 2P9AA 2Q94A 1WL6A 4ZWPA 1QZYA 2V3ZA 2GG3A 2BHDA 2GA2A 2EVCA 2GU7A 1WLRA 1CHMA 4IECA 4U70A 2GGBA 4MATA 5FCFA 4IKUA 4Z7MA 2GG8A 2MATA 2OAZA 4U1BA 1QXYA 2HOWA 2BB7A 3IU7A 4U6JA 1PV9A 1XGOA 2B3HA 2EA2A 4IKSA 1XNZA 2P99A 2GGCA 1YJ3A 3MATA 4U76A 2V6CA 4IPAA 1YVMA 2BHAA 3MR1A 2B3LA 3PKAA 2Q8KA 5JFRA 3BIPA 2OKNA 2GZ5A 4FLLA 2EA4A 4U6EA 5CDVA 1QXZA 1W7VA 4IKTA 5CDLA 1WN1A 2Q92A 3FMRA 2IW2A 2Q95A 3FM3A 3L7GA 2V3YA 1B59A 3FMQA 1Y1NA 2BWXA 4IU6A 3PKEA 2V3XA 1BN5A 3IU8A 3S6BA 5FCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFI A;  3CB6 A;  3TB5 A;  1YW9 A;  1BOA A;  2BHC A;  3MX6 A;  4IDY A;  5D6F A;  1O0X A;  2G6P A;  2B3K A;  4RGZ 1;  5JHU A;  2ADU A;  2GU6 A;  4U69 A;  1WKM A;  2BWT A;  5CLS A;  1C22 A;  4S01 A;  3ROR A;  3IU9 A;  4U6Z A;  4U6W A;  2BWS A;  4U73 A;  1XGM A;  2BH3 A;  5D6E A;  4IKR A;  2GG5 A;  4RZZ A;  2NQ6 A;  3BIT A;  4ZWU A;  3IG4 A;  4S2T P;  1WY2 A;  1QXW A;  2NQ7 A;  4RZY A;  1WBQ A;  4B28 A;  2EVO A;  3PKC A;  4U71 A;  3RVA A;  2BWU A;  2Q93 A;  3L24 A;  4ZWO A;  1C27 A;  3BIQ A;  2BWY A;  4R60 A;  1C24 A;  2GTX A;  1XGS A;  2GG0 A;  2BWV A;  5CIK A;  1MAT A;  4S00 A;  4FO7 A;  4IF7 A;  1YW7 A;  3TAV A;  2BN7 A;  3PKD A;  4FLJ A;  4EGE A;  2GU4 A;  1JAW A;  1XGN A;  3PKB A;  3Q6D A;  4U6C A;  5CNX A;  4A6W A;  4FKC A;  5CE6 A;  1N51 A;  4OOK A;  4ZNG A;  3D27 A;  1KQ9 A;  4JUQ A;  4FLI A;  4FLK A;  4U75 A;  2ZSG A;  4PNC A;  2GG9 A;  1R58 A;  1A16 A;  5E5B A;  1WL9 A;  5JI6 A;  1R5H A;  1KQ0 A;  2GU5 A;  2EVM A;  1B6A A;  1C23 A;  3CB5 A;  1YW8 A;  1C21 A;  4HXX A;  2GG2 A;  3CTZ A;  2GG7 A;  5CDE A;  2Q96 A;  4PV4 A;  4S2R P;  4FO8 A;  1M35 A;  1KP0 A;  4FUK A;  4A6V A;  1R5G A;  1W2M A;  2P98 A;  2BHB A;  4KM3 A;  2BWW A;  4QR8 A;  2P9A A;  2Q94 A;  1WL6 A;  4ZWP A;  1QZY A;  2V3Z A;  2GG3 A;  2BHD A;  2GA2 A;  2EVC A;  2GU7 A;  1WLR A;  1CHM A;  4IEC A;  4U70 A;  2GGB A;  4MAT A;  5FCF A;  4IKU A;  4Z7M A;  2GG8 A;  2MAT A;  2OAZ A;  4U1B A;  1QXY A;  2HOW A;  2BB7 A;  3IU7 A;  4U6J A;  1PV9 A;  1XGO A;  2B3H A;  2EA2 A;  4IKS A;  1XNZ A;  2P99 A;  2GGC A;  1YJ3 A;  3MAT A;  4U76 A;  2V6C A;  4IPA A;  1YVM A;  2BHA A;  3MR1 A;  2B3L A;  3PKA A;  2Q8K A;  5JFR A;  3BIP A;  2OKN A;  2GZ5 A;  4FLL A;  2EA4 A;  4U6E A;  5CDV A;  1QXZ A;  1W7V A;  4IKT A;  5CDL A;  1WN1 A;  2Q92 A;  3FMR A;  2IW2 A;  2Q95 A;  3FM3 A;  3L7G A;  2V3Y A;  1B59 A;  3FMQ A;  1Y1N A;  2BWX A;  4IU6 A;  3PKE A;  2V3X A;  1BN5 A;  3IU8 A;  3S6B A;  5FCH A; 
#chains in the Genus database with same CATH topology
 2DFI A;  3CB6 A;  3TB5 A;  1YW9 A;  1BOA A;  2BHC A;  3MX6 A;  4IDY A;  5D6F A;  1O0X A;  2G6P A;  2B3K A;  4RGZ 1;  5JHU A;  2ADU A;  2GU6 A;  4U69 A;  1WKM A;  2BWT A;  5CLS A;  1C22 A;  4S01 A;  3ROR A;  3IU9 A;  4U6Z A;  4U6W A;  2BWS A;  4U73 A;  1XGM A;  2BH3 A;  5D6E A;  4IKR A;  2GG5 A;  4RZZ A;  2NQ6 A;  3BIT A;  4ZWU A;  3IG4 A;  4S2T P;  1WY2 A;  1QXW A;  2NQ7 A;  4RZY A;  1WBQ A;  4B28 A;  2EVO A;  3PKC A;  4U71 A;  3RVA A;  2BWU A;  2Q93 A;  3L24 A;  4ZWO A;  1C27 A;  3BIQ A;  2BWY A;  4R60 A;  1C24 A;  2GTX A;  1XGS A;  2GG0 A;  2BWV A;  5CIK A;  1MAT A;  4S00 A;  4FO7 A;  4IF7 A;  1YW7 A;  3TAV A;  2BN7 A;  3PKD A;  4FLJ A;  4EGE A;  2GU4 A;  1JAW A;  1XGN A;  3PKB A;  3Q6D A;  4U6C A;  5CNX A;  4A6W A;  4FKC A;  5CE6 A;  1N51 A;  4OOK A;  4ZNG A;  3D27 A;  1KQ9 A;  4JUQ A;  4FLI A;  4FLK A;  4U75 A;  2ZSG A;  4PNC A;  2GG9 A;  1R58 A;  1A16 A;  5E5B A;  1WL9 A;  5JI6 A;  1R5H A;  1KQ0 A;  2GU5 A;  2EVM A;  1B6A A;  1C23 A;  3CB5 A;  1YW8 A;  1C21 A;  4HXX A;  2GG2 A;  3CTZ A;  2GG7 A;  5CDE A;  2Q96 A;  4PV4 A;  4S2R P;  4FO8 A;  1M35 A;  1KP0 A;  4FUK A;  4A6V A;  1R5G A;  1W2M A;  2P98 A;  2BHB A;  4KM3 A;  2BWW A;  4QR8 A;  2P9A A;  2Q94 A;  1WL6 A;  4ZWP A;  1QZY A;  2V3Z A;  2GG3 A;  2BHD A;  2GA2 A;  2EVC A;  2GU7 A;  1WLR A;  1CHM A;  4IEC A;  4U70 A;  2GGB A;  4MAT A;  5FCF A;  4IKU A;  4Z7M A;  2GG8 A;  2MAT A;  2OAZ A;  4U1B A;  1QXY A;  2HOW A;  2BB7 A;  3IU7 A;  4U6J A;  1PV9 A;  1XGO A;  2B3H A;  2EA2 A;  4IKS A;  1XNZ A;  2P99 A;  2GGC A;  1YJ3 A;  3MAT A;  4U76 A;  2V6C A;  4IPA A;  1YVM A;  2BHA A;  3MR1 A;  2B3L A;  3PKA A;  2Q8K A;  5JFR A;  3BIP A;  2OKN A;  2GZ5 A;  4FLL A;  2EA4 A;  4U6E A;  5CDV A;  1QXZ A;  1W7V A;  4IKT A;  5CDL A;  1WN1 A;  2Q92 A;  3FMR A;  2IW2 A;  2Q95 A;  3FM3 A;  3L7G A;  2V3Y A;  1B59 A;  3FMQ A;  1Y1N A;  2BWX A;  4IU6 A;  3PKE A;  2V3X A;  1BN5 A;  3IU8 A;  3S6B A;  5FCH A; 
#chains in the Genus database with same CATH homology
 2DFI A;  3CB6 A;  3TB5 A;  1YW9 A;  1BOA A;  2BHC A;  3MX6 A;  4IDY A;  5D6F A;  1O0X A;  2G6P A;  2B3K A;  4RGZ 1;  5JHU A;  2ADU A;  2GU6 A;  4U69 A;  1WKM A;  2BWT A;  5CLS A;  1C22 A;  4S01 A;  3ROR A;  3IU9 A;  4U6Z A;  4U6W A;  2BWS A;  4U73 A;  1XGM A;  2BH3 A;  5D6E A;  4IKR A;  2GG5 A;  4RZZ A;  2NQ6 A;  3BIT A;  4ZWU A;  3IG4 A;  4S2T P;  1WY2 A;  1QXW A;  2NQ7 A;  4RZY A;  1WBQ A;  4B28 A;  2EVO A;  3PKC A;  4U71 A;  3RVA A;  2BWU A;  2Q93 A;  3L24 A;  4ZWO A;  1C27 A;  3BIQ A;  2BWY A;  4R60 A;  1C24 A;  2GTX A;  1XGS A;  2GG0 A;  2BWV A;  5CIK A;  1MAT A;  4S00 A;  4FO7 A;  4IF7 A;  1YW7 A;  3TAV A;  2BN7 A;  3PKD A;  4FLJ A;  4EGE A;  2GU4 A;  1JAW A;  1XGN A;  3PKB A;  3Q6D A;  4U6C A;  5CNX A;  4A6W A;  4FKC A;  5CE6 A;  1N51 A;  4OOK A;  4ZNG A;  3D27 A;  1KQ9 A;  4JUQ A;  4FLI A;  4FLK A;  4U75 A;  2ZSG A;  4PNC A;  2GG9 A;  1R58 A;  1A16 A;  5E5B A;  1WL9 A;  5JI6 A;  1R5H A;  1KQ0 A;  2GU5 A;  2EVM A;  1B6A A;  1C23 A;  3CB5 A;  1YW8 A;  1C21 A;  4HXX A;  2GG2 A;  3CTZ A;  2GG7 A;  5CDE A;  2Q96 A;  4PV4 A;  4S2R P;  4FO8 A;  1M35 A;  1KP0 A;  4FUK A;  4A6V A;  1R5G A;  1W2M A;  2P98 A;  2BHB A;  4KM3 A;  2BWW A;  4QR8 A;  2P9A A;  2Q94 A;  1WL6 A;  4ZWP A;  1QZY A;  2V3Z A;  2GG3 A;  2BHD A;  2GA2 A;  2EVC A;  2GU7 A;  1WLR A;  1CHM A;  4IEC A;  4U70 A;  2GGB A;  4MAT A;  5FCF A;  4IKU A;  4Z7M A;  2GG8 A;  2MAT A;  2OAZ A;  4U1B A;  1QXY A;  2HOW A;  2BB7 A;  3IU7 A;  4U6J A;  1PV9 A;  1XGO A;  2B3H A;  2EA2 A;  4IKS A;  1XNZ A;  2P99 A;  2GGC A;  1YJ3 A;  3MAT A;  4U76 A;  2V6C A;  4IPA A;  1YVM A;  2BHA A;  3MR1 A;  2B3L A;  3PKA A;  2Q8K A;  5JFR A;  3BIP A;  2OKN A;  2GZ5 A;  4FLL A;  2EA4 A;  4U6E A;  5CDV A;  1QXZ A;  1W7V A;  4IKT A;  5CDL A;  1WN1 A;  2Q92 A;  3FMR A;  2IW2 A;  2Q95 A;  3FM3 A;  3L7G A;  2V3Y A;  1B59 A;  3FMQ A;  1Y1N A;  2BWX A;  4IU6 A;  3PKE A;  2V3X A;  1BN5 A;  3IU8 A;  3S6B A;  5FCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...