4U76A

Hsmetap (f309m) holo form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u76A00
3PKEA 4U75A 2MATA 4IKTA 2B3LA 2GG9A 1BOAA 1O0XA 4U6JA 1R5GA 5CDVA 2GU4A 4IECA 1WL9A 3CB6A 4FLIA 4FUKA 1Y1NA 4U73A 5CDEA 1KQ9A 4FO8A 5D6EA 2Q96A 4ZWUA 1YJ3A 1QXYA 3IU7A 3S6BA 4S2TP 2DFIA 4A6WA 4OOKA 2Q94A 4U6CA 5CE6A 2P9AA 3L7GA 4FLJA 3FM3A 3PKDA 2BH3A 1M35A 5JFRA 2Q95A 2EVOA 4U76A 4Z7MA 4RZZA 4FO7A 3CTZA 2BN7A 1W2MA 1WY2A 2GA2A 1WBQA 1BN5A 2V3YA 4IPAA 1C27A 1XGSA 2OAZA 1XNZA 2BWYA 2OKNA 1JAWA 5CDLA 2P98A 4MATA 2Q93A 4S00A 5CIKA 1R5HA 3IU9A 2G6PA 1XGNA 2GG8A 5JHUA 2BHBA 1MATA 2GTXA 4IU6A 2NQ6A 2BWUA 1KP0A 1WKMA 3MX6A 2GG2A 2HOWA 4U1BA 5D6FA 2BWWA 3FMQA 3BIPA 1YW7A 2BWTA 3BITA 5FCHA 1WLRA 2GU6A 2ADUA 2GZ5A 4ZWPA 2Q8KA 4RZYA 5FCFA 4B28A 2EVMA 2BHAA 1QXZA 2ZSGA 3MR1A 3Q6DA 4PNCA 4ZNGA 4IDYA 1YW9A 2P99A 3PKBA 3RVAA 3CB5A 1B6AA 1R58A 2IW2A 4JUQA 5JI6A 1CHMA 1WL6A 3PKCA 2BB7A 2GG5A 4KM3A 4IF7A 4S2RP 1QZYA 1C24A 2Q92A 2BHDA 4U69A 5CNXA 3IU8A 2BWXA 2GG3A 2BWVA 1C23A 2GU7A 2NQ7A 4U6EA 4U6ZA 1PV9A 3RORA 4A6VA 2V3ZA 1YVMA 2EA2A 4U70A 1C21A 5CLSA 4IKUA 2GGCA 3IG4A 2GG7A 1WN1A 2V6CA 1C22A 2EA4A 3BIQA 3D27A 4PV4A 2B3HA 4FKCA 2GGBA 4FLKA 1QXWA 1XGOA 2V3XA 2BHCA 3L24A 4R60A 4HXXA 2BWSA 3MATA 4RGZ1 1A16A 2B3KA 1KQ0A 1B59A 2EVCA 1YW8A 4S01A 1XGMA 2GU5A 1W7VA 4IKSA 3TB5A 4QR8A 4ZWOA 3FMRA 1N51A 4U6WA 3PKAA 4EGEA 2GG0A 3TAVA 4FLLA 4U71A 4IKRA 5E5BA
chains in the Genus database with same CATH superfamily
3PKEA 4U75A 2MATA 4IKTA 2B3LA 2GG9A 1BOAA 1O0XA 4U6JA 1R5GA 5CDVA 2GU4A 4IECA 1WL9A 3CB6A 4FLIA 4FUKA 1Y1NA 4U73A 5CDEA 1KQ9A 4FO8A 5D6EA 2Q96A 4ZWUA 1YJ3A 1QXYA 3IU7A 3S6BA 4S2TP 2DFIA 4A6WA 4OOKA 2Q94A 4U6CA 5CE6A 2P9AA 3L7GA 4FLJA 3FM3A 3PKDA 2BH3A 1M35A 5JFRA 2Q95A 2EVOA 4U76A 4Z7MA 4RZZA 4FO7A 3CTZA 2BN7A 1W2MA 1WY2A 2GA2A 1WBQA 1BN5A 2V3YA 4IPAA 1C27A 1XGSA 2OAZA 1XNZA 2BWYA 2OKNA 1JAWA 5CDLA 2P98A 4MATA 2Q93A 4S00A 5CIKA 1R5HA 3IU9A 2G6PA 1XGNA 2GG8A 5JHUA 2BHBA 1MATA 2GTXA 4IU6A 2NQ6A 2BWUA 1KP0A 1WKMA 3MX6A 2GG2A 2HOWA 4U1BA 5D6FA 2BWWA 3FMQA 3BIPA 1YW7A 2BWTA 3BITA 5FCHA 1WLRA 2GU6A 2ADUA 2GZ5A 4ZWPA 2Q8KA 4RZYA 5FCFA 4B28A 2EVMA 2BHAA 1QXZA 2ZSGA 3MR1A 3Q6DA 4PNCA 4ZNGA 4IDYA 1YW9A 2P99A 3PKBA 3RVAA 3CB5A 1B6AA 1R58A 2IW2A 4JUQA 5JI6A 1CHMA 1WL6A 3PKCA 2BB7A 2GG5A 4KM3A 4IF7A 4S2RP 1QZYA 1C24A 2Q92A 2BHDA 4U69A 5CNXA 3IU8A 2BWXA 2GG3A 2BWVA 1C23A 2GU7A 2NQ7A 4U6EA 4U6ZA 1PV9A 3RORA 4A6VA 2V3ZA 1YVMA 2EA2A 4U70A 1C21A 5CLSA 4IKUA 2GGCA 3IG4A 2GG7A 1WN1A 2V6CA 1C22A 2EA4A 3BIQA 3D27A 4PV4A 2B3HA 4FKCA 2GGBA 4FLKA 1QXWA 1XGOA 2V3XA 2BHCA 3L24A 4R60A 4HXXA 2BWSA 3MATA 4RGZ1 1A16A 2B3KA 1KQ0A 1B59A 2EVCA 1YW8A 4S01A 1XGMA 2GU5A 1W7VA 4IKSA 3TB5A 4QR8A 4ZWOA 3FMRA 1N51A 4U6WA 3PKAA 4EGEA 2GG0A 3TAVA 4FLLA 4U71A 4IKRA 5E5BA
chains in the Genus database with same CATH topology
3PKEA 4U75A 2MATA 4IKTA 2B3LA 2GG9A 1BOAA 1O0XA 4U6JA 1R5GA 5CDVA 2GU4A 4IECA 1WL9A 3CB6A 4FLIA 4FUKA 1Y1NA 4U73A 5CDEA 1KQ9A 4FO8A 5D6EA 2Q96A 4ZWUA 1YJ3A 1QXYA 3IU7A 3S6BA 4S2TP 2DFIA 4A6WA 4OOKA 2Q94A 4U6CA 5CE6A 2P9AA 3L7GA 4FLJA 3FM3A 3PKDA 2BH3A 1M35A 5JFRA 2Q95A 2EVOA 4U76A 4Z7MA 4RZZA 4FO7A 3CTZA 2BN7A 1W2MA 1WY2A 2GA2A 1WBQA 1BN5A 2V3YA 4IPAA 1C27A 1XGSA 2OAZA 1XNZA 2BWYA 2OKNA 1JAWA 5CDLA 2P98A 4MATA 2Q93A 4S00A 5CIKA 1R5HA 3IU9A 2G6PA 1XGNA 2GG8A 5JHUA 2BHBA 1MATA 2GTXA 4IU6A 2NQ6A 2BWUA 1KP0A 1WKMA 3MX6A 2GG2A 2HOWA 4U1BA 5D6FA 2BWWA 3FMQA 3BIPA 1YW7A 2BWTA 3BITA 5FCHA 1WLRA 2GU6A 2ADUA 2GZ5A 4ZWPA 2Q8KA 4RZYA 5FCFA 4B28A 2EVMA 2BHAA 1QXZA 2ZSGA 3MR1A 3Q6DA 4PNCA 4ZNGA 4IDYA 1YW9A 2P99A 3PKBA 3RVAA 3CB5A 1B6AA 1R58A 2IW2A 4JUQA 5JI6A 1CHMA 1WL6A 3PKCA 2BB7A 2GG5A 4KM3A 4IF7A 4S2RP 1QZYA 1C24A 2Q92A 2BHDA 4U69A 5CNXA 3IU8A 2BWXA 2GG3A 2BWVA 1C23A 2GU7A 2NQ7A 4U6EA 4U6ZA 1PV9A 3RORA 4A6VA 2V3ZA 1YVMA 2EA2A 4U70A 1C21A 5CLSA 4IKUA 2GGCA 3IG4A 2GG7A 1WN1A 2V6CA 1C22A 2EA4A 3BIQA 3D27A 4PV4A 2B3HA 4FKCA 2GGBA 4FLKA 1QXWA 1XGOA 2V3XA 2BHCA 3L24A 4R60A 4HXXA 2BWSA 3MATA 4RGZ1 1A16A 2B3KA 1KQ0A 1B59A 2EVCA 1YW8A 4S01A 1XGMA 2GU5A 1W7VA 4IKSA 3TB5A 4QR8A 4ZWOA 3FMRA 1N51A 4U6WA 3PKAA 4EGEA 2GG0A 3TAVA 4FLLA 4U71A 4IKRA 5E5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PKE A;  4U75 A;  2MAT A;  4IKT A;  2B3L A;  2GG9 A;  1BOA A;  1O0X A;  4U6J A;  1R5G A;  5CDV A;  2GU4 A;  4IEC A;  1WL9 A;  3CB6 A;  4FLI A;  4FUK A;  1Y1N A;  4U73 A;  5CDE A;  1KQ9 A;  4FO8 A;  5D6E A;  2Q96 A;  4ZWU A;  1YJ3 A;  1QXY A;  3IU7 A;  3S6B A;  4S2T P;  2DFI A;  4A6W A;  4OOK A;  2Q94 A;  4U6C A;  5CE6 A;  2P9A A;  3L7G A;  4FLJ A;  3FM3 A;  3PKD A;  2BH3 A;  1M35 A;  5JFR A;  2Q95 A;  2EVO A;  4U76 A;  4Z7M A;  4RZZ A;  4FO7 A;  3CTZ A;  2BN7 A;  1W2M A;  1WY2 A;  2GA2 A;  1WBQ A;  1BN5 A;  2V3Y A;  4IPA A;  1C27 A;  1XGS A;  2OAZ A;  1XNZ A;  2BWY A;  2OKN A;  1JAW A;  5CDL A;  2P98 A;  4MAT A;  2Q93 A;  4S00 A;  5CIK A;  1R5H A;  3IU9 A;  2G6P A;  1XGN A;  2GG8 A;  5JHU A;  2BHB A;  1MAT A;  2GTX A;  4IU6 A;  2NQ6 A;  2BWU A;  1KP0 A;  1WKM A;  3MX6 A;  2GG2 A;  2HOW A;  4U1B A;  5D6F A;  2BWW A;  3FMQ A;  3BIP A;  1YW7 A;  2BWT A;  3BIT A;  5FCH A;  1WLR A;  2GU6 A;  2ADU A;  2GZ5 A;  4ZWP A;  2Q8K A;  4RZY A;  5FCF A;  4B28 A;  2EVM A;  2BHA A;  1QXZ A;  2ZSG A;  3MR1 A;  3Q6D A;  4PNC A;  4ZNG A;  4IDY A;  1YW9 A;  2P99 A;  3PKB A;  3RVA A;  3CB5 A;  1B6A A;  1R58 A;  2IW2 A;  4JUQ A;  5JI6 A;  1CHM A;  1WL6 A;  3PKC A;  2BB7 A;  2GG5 A;  4KM3 A;  4IF7 A;  4S2R P;  1QZY A;  1C24 A;  2Q92 A;  2BHD A;  4U69 A;  5CNX A;  3IU8 A;  2BWX A;  2GG3 A;  2BWV A;  1C23 A;  2GU7 A;  2NQ7 A;  4U6E A;  4U6Z A;  1PV9 A;  3ROR A;  4A6V A;  2V3Z A;  1YVM A;  2EA2 A;  4U70 A;  1C21 A;  5CLS A;  4IKU A;  2GGC A;  3IG4 A;  2GG7 A;  1WN1 A;  2V6C A;  1C22 A;  2EA4 A;  3BIQ A;  3D27 A;  4PV4 A;  2B3H A;  4FKC A;  2GGB A;  4FLK A;  1QXW A;  1XGO A;  2V3X A;  2BHC A;  3L24 A;  4R60 A;  4HXX A;  2BWS A;  3MAT A;  4RGZ 1;  1A16 A;  2B3K A;  1KQ0 A;  1B59 A;  2EVC A;  1YW8 A;  4S01 A;  1XGM A;  2GU5 A;  1W7V A;  4IKS A;  3TB5 A;  4QR8 A;  4ZWO A;  3FMR A;  1N51 A;  4U6W A;  3PKA A;  4EGE A;  2GG0 A;  3TAV A;  4FLL A;  4U71 A;  4IKR A;  5E5B A; 
#chains in the Genus database with same CATH topology
 3PKE A;  4U75 A;  2MAT A;  4IKT A;  2B3L A;  2GG9 A;  1BOA A;  1O0X A;  4U6J A;  1R5G A;  5CDV A;  2GU4 A;  4IEC A;  1WL9 A;  3CB6 A;  4FLI A;  4FUK A;  1Y1N A;  4U73 A;  5CDE A;  1KQ9 A;  4FO8 A;  5D6E A;  2Q96 A;  4ZWU A;  1YJ3 A;  1QXY A;  3IU7 A;  3S6B A;  4S2T P;  2DFI A;  4A6W A;  4OOK A;  2Q94 A;  4U6C A;  5CE6 A;  2P9A A;  3L7G A;  4FLJ A;  3FM3 A;  3PKD A;  2BH3 A;  1M35 A;  5JFR A;  2Q95 A;  2EVO A;  4U76 A;  4Z7M A;  4RZZ A;  4FO7 A;  3CTZ A;  2BN7 A;  1W2M A;  1WY2 A;  2GA2 A;  1WBQ A;  1BN5 A;  2V3Y A;  4IPA A;  1C27 A;  1XGS A;  2OAZ A;  1XNZ A;  2BWY A;  2OKN A;  1JAW A;  5CDL A;  2P98 A;  4MAT A;  2Q93 A;  4S00 A;  5CIK A;  1R5H A;  3IU9 A;  2G6P A;  1XGN A;  2GG8 A;  5JHU A;  2BHB A;  1MAT A;  2GTX A;  4IU6 A;  2NQ6 A;  2BWU A;  1KP0 A;  1WKM A;  3MX6 A;  2GG2 A;  2HOW A;  4U1B A;  5D6F A;  2BWW A;  3FMQ A;  3BIP A;  1YW7 A;  2BWT A;  3BIT A;  5FCH A;  1WLR A;  2GU6 A;  2ADU A;  2GZ5 A;  4ZWP A;  2Q8K A;  4RZY A;  5FCF A;  4B28 A;  2EVM A;  2BHA A;  1QXZ A;  2ZSG A;  3MR1 A;  3Q6D A;  4PNC A;  4ZNG A;  4IDY A;  1YW9 A;  2P99 A;  3PKB A;  3RVA A;  3CB5 A;  1B6A A;  1R58 A;  2IW2 A;  4JUQ A;  5JI6 A;  1CHM A;  1WL6 A;  3PKC A;  2BB7 A;  2GG5 A;  4KM3 A;  4IF7 A;  4S2R P;  1QZY A;  1C24 A;  2Q92 A;  2BHD A;  4U69 A;  5CNX A;  3IU8 A;  2BWX A;  2GG3 A;  2BWV A;  1C23 A;  2GU7 A;  2NQ7 A;  4U6E A;  4U6Z A;  1PV9 A;  3ROR A;  4A6V A;  2V3Z A;  1YVM A;  2EA2 A;  4U70 A;  1C21 A;  5CLS A;  4IKU A;  2GGC A;  3IG4 A;  2GG7 A;  1WN1 A;  2V6C A;  1C22 A;  2EA4 A;  3BIQ A;  3D27 A;  4PV4 A;  2B3H A;  4FKC A;  2GGB A;  4FLK A;  1QXW A;  1XGO A;  2V3X A;  2BHC A;  3L24 A;  4R60 A;  4HXX A;  2BWS A;  3MAT A;  4RGZ 1;  1A16 A;  2B3K A;  1KQ0 A;  1B59 A;  2EVC A;  1YW8 A;  4S01 A;  1XGM A;  2GU5 A;  1W7V A;  4IKS A;  3TB5 A;  4QR8 A;  4ZWO A;  3FMR A;  1N51 A;  4U6W A;  3PKA A;  4EGE A;  2GG0 A;  3TAV A;  4FLL A;  4U71 A;  4IKR A;  5E5B A; 
#chains in the Genus database with same CATH homology
 3PKE A;  4U75 A;  2MAT A;  4IKT A;  2B3L A;  2GG9 A;  1BOA A;  1O0X A;  4U6J A;  1R5G A;  5CDV A;  2GU4 A;  4IEC A;  1WL9 A;  3CB6 A;  4FLI A;  4FUK A;  1Y1N A;  4U73 A;  5CDE A;  1KQ9 A;  4FO8 A;  5D6E A;  2Q96 A;  4ZWU A;  1YJ3 A;  1QXY A;  3IU7 A;  3S6B A;  4S2T P;  2DFI A;  4A6W A;  4OOK A;  2Q94 A;  4U6C A;  5CE6 A;  2P9A A;  3L7G A;  4FLJ A;  3FM3 A;  3PKD A;  2BH3 A;  1M35 A;  5JFR A;  2Q95 A;  2EVO A;  4U76 A;  4Z7M A;  4RZZ A;  4FO7 A;  3CTZ A;  2BN7 A;  1W2M A;  1WY2 A;  2GA2 A;  1WBQ A;  1BN5 A;  2V3Y A;  4IPA A;  1C27 A;  1XGS A;  2OAZ A;  1XNZ A;  2BWY A;  2OKN A;  1JAW A;  5CDL A;  2P98 A;  4MAT A;  2Q93 A;  4S00 A;  5CIK A;  1R5H A;  3IU9 A;  2G6P A;  1XGN A;  2GG8 A;  5JHU A;  2BHB A;  1MAT A;  2GTX A;  4IU6 A;  2NQ6 A;  2BWU A;  1KP0 A;  1WKM A;  3MX6 A;  2GG2 A;  2HOW A;  4U1B A;  5D6F A;  2BWW A;  3FMQ A;  3BIP A;  1YW7 A;  2BWT A;  3BIT A;  5FCH A;  1WLR A;  2GU6 A;  2ADU A;  2GZ5 A;  4ZWP A;  2Q8K A;  4RZY A;  5FCF A;  4B28 A;  2EVM A;  2BHA A;  1QXZ A;  2ZSG A;  3MR1 A;  3Q6D A;  4PNC A;  4ZNG A;  4IDY A;  1YW9 A;  2P99 A;  3PKB A;  3RVA A;  3CB5 A;  1B6A A;  1R58 A;  2IW2 A;  4JUQ A;  5JI6 A;  1CHM A;  1WL6 A;  3PKC A;  2BB7 A;  2GG5 A;  4KM3 A;  4IF7 A;  4S2R P;  1QZY A;  1C24 A;  2Q92 A;  2BHD A;  4U69 A;  5CNX A;  3IU8 A;  2BWX A;  2GG3 A;  2BWV A;  1C23 A;  2GU7 A;  2NQ7 A;  4U6E A;  4U6Z A;  1PV9 A;  3ROR A;  4A6V A;  2V3Z A;  1YVM A;  2EA2 A;  4U70 A;  1C21 A;  5CLS A;  4IKU A;  2GGC A;  3IG4 A;  2GG7 A;  1WN1 A;  2V6C A;  1C22 A;  2EA4 A;  3BIQ A;  3D27 A;  4PV4 A;  2B3H A;  4FKC A;  2GGB A;  4FLK A;  1QXW A;  1XGO A;  2V3X A;  2BHC A;  3L24 A;  4R60 A;  4HXX A;  2BWS A;  3MAT A;  4RGZ 1;  1A16 A;  2B3K A;  1KQ0 A;  1B59 A;  2EVC A;  1YW8 A;  4S01 A;  1XGM A;  2GU5 A;  1W7V A;  4IKS A;  3TB5 A;  4QR8 A;  4ZWO A;  3FMR A;  1N51 A;  4U6W A;  3PKA A;  4EGE A;  2GG0 A;  3TAV A;  4FLL A;  4U71 A;  4IKR A;  5E5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...