4U76A

Hsmetap (f309m) holo form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u76A00
1MATA 2BWVA 1BN5A 4RGZ1 4U70A 4KM3A 2Q93A 4U69A 2NQ7A 4S01A 1WL9A 1WKMA 1KQ0A 4U73A 1QXYA 1A16A 2GA2A 4U6WA 4IKTA 4S00A 4FLJA 4FLKA 2BB7A 2GZ5A 1BOAA 2IW2A 2V3XA 3IU9A 1M35A 4PNCA 5CLSA 5JFRA 2P9AA 5CDVA 2EVCA 3MX6A 2BH3A 4IKSA 1XGMA 3Q6DA 4IKUA 2BWYA 2B3KA 4IECA 2BHCA 1WBQA 2GG7A 4ZWOA 1WN1A 2NQ6A 5CDEA 4FLIA 1W7VA 3L24A 4OOKA 2EVOA 4IF7A 4B28A 4FKCA 2ZSGA 4U75A 2ADUA 5JI6A 2MATA 1C27A 4PV4A 2BHAA 4U6CA 1KQ9A 3CB6A 4ZWPA 3RORA 1B59A 4FLLA 1C23A 4FO8A 4IPAA 3BITA 2HOWA 3PKAA 2V3YA 4S2RP 1QZYA 1PV9A 4A6VA 1YJ3A 5CNXA 1YW7A 2GGCA 3FMQA 2V6CA 3RVAA 2BWWA 3CTZA 2GG8A 3PKCA 2B3LA 2GG0A 3IU7A 1WLRA 5FCHA 2GTXA 1XGOA 1B6AA 2GG2A 4U1BA 1XNZA 4U6JA 3MATA 4HXXA 4MATA 4U6EA 2BWUA 1QXZA 2Q8KA 3S6BA 3BIPA 2GU7A 2EVMA 3TB5A 5D6EA 3BIQA 2Q96A 2EA2A 3PKBA 2B3HA 3TAVA 2GU4A 3FM3A 5CE6A 2OAZA 1YW9A 1W2MA 1QXWA 3CB5A 4IDYA 1KP0A 2BHDA 2OKNA 3L7GA 1XGSA 4JUQA 1C22A 1C24A 3PKDA 4U71A 1YW8A 2GG5A 3MR1A 1N51A 1O0XA 5FCFA 2Q95A 1WY2A 2GU5A 1R5GA 2GG9A 4RZZA 4ZWUA 1R5HA 5CIKA 4R60A 2BN7A 1XGNA 3FMRA 1C21A 1CHMA 2P99A 4QR8A 2Q92A 4FO7A 2G6PA 5D6FA 1WL6A 4U6ZA 1Y1NA 1R58A 2GGBA 4RZYA 4U76A 4S2TP 4EGEA 1JAWA 2Q94A 2BWSA 2EA4A 2BWTA 5CDLA 2DFIA 2BWXA 4A6WA 3PKEA 2GG3A 3IG4A 3IU8A 5E5BA 5JHUA 4Z7MA 4FUKA 3D27A 2V3ZA 4IKRA 4IU6A 1YVMA 2BHBA 2P98A 2GU6A 4ZNGA
chains in the Genus database with same CATH superfamily
1MATA 2BWVA 1BN5A 4RGZ1 4U70A 4KM3A 2Q93A 4U69A 2NQ7A 4S01A 1WL9A 1WKMA 1KQ0A 4U73A 1QXYA 1A16A 2GA2A 4U6WA 4IKTA 4S00A 4FLJA 4FLKA 2BB7A 2GZ5A 1BOAA 2IW2A 2V3XA 3IU9A 1M35A 4PNCA 5CLSA 5JFRA 2P9AA 5CDVA 2EVCA 3MX6A 2BH3A 4IKSA 1XGMA 3Q6DA 4IKUA 2BWYA 2B3KA 4IECA 2BHCA 1WBQA 2GG7A 4ZWOA 1WN1A 2NQ6A 5CDEA 4FLIA 1W7VA 3L24A 4OOKA 2EVOA 4IF7A 4B28A 4FKCA 2ZSGA 4U75A 2ADUA 5JI6A 2MATA 1C27A 4PV4A 2BHAA 4U6CA 1KQ9A 3CB6A 4ZWPA 3RORA 1B59A 4FLLA 1C23A 4FO8A 4IPAA 3BITA 2HOWA 3PKAA 2V3YA 4S2RP 1QZYA 1PV9A 4A6VA 1YJ3A 5CNXA 1YW7A 2GGCA 3FMQA 2V6CA 3RVAA 2BWWA 3CTZA 2GG8A 3PKCA 2B3LA 2GG0A 3IU7A 1WLRA 5FCHA 2GTXA 1XGOA 1B6AA 2GG2A 4U1BA 1XNZA 4U6JA 3MATA 4HXXA 4MATA 4U6EA 2BWUA 1QXZA 2Q8KA 3S6BA 3BIPA 2GU7A 2EVMA 3TB5A 5D6EA 3BIQA 2Q96A 2EA2A 3PKBA 2B3HA 3TAVA 2GU4A 3FM3A 5CE6A 2OAZA 1YW9A 1W2MA 1QXWA 3CB5A 4IDYA 1KP0A 2BHDA 2OKNA 3L7GA 1XGSA 4JUQA 1C22A 1C24A 3PKDA 4U71A 1YW8A 2GG5A 3MR1A 1N51A 1O0XA 5FCFA 2Q95A 1WY2A 2GU5A 1R5GA 2GG9A 4RZZA 4ZWUA 1R5HA 5CIKA 4R60A 2BN7A 1XGNA 3FMRA 1C21A 1CHMA 2P99A 4QR8A 2Q92A 4FO7A 2G6PA 5D6FA 1WL6A 4U6ZA 1Y1NA 1R58A 2GGBA 4RZYA 4U76A 4S2TP 4EGEA 1JAWA 2Q94A 2BWSA 2EA4A 2BWTA 5CDLA 2DFIA 2BWXA 4A6WA 3PKEA 2GG3A 3IG4A 3IU8A 5E5BA 5JHUA 4Z7MA 4FUKA 3D27A 2V3ZA 4IKRA 4IU6A 1YVMA 2BHBA 2P98A 2GU6A 4ZNGA
chains in the Genus database with same CATH topology
1MATA 2BWVA 1BN5A 4RGZ1 4U70A 4KM3A 2Q93A 4U69A 2NQ7A 4S01A 1WL9A 1WKMA 1KQ0A 4U73A 1QXYA 1A16A 2GA2A 4U6WA 4IKTA 4S00A 4FLJA 4FLKA 2BB7A 2GZ5A 1BOAA 2IW2A 2V3XA 3IU9A 1M35A 4PNCA 5CLSA 5JFRA 2P9AA 5CDVA 2EVCA 3MX6A 2BH3A 4IKSA 1XGMA 3Q6DA 4IKUA 2BWYA 2B3KA 4IECA 2BHCA 1WBQA 2GG7A 4ZWOA 1WN1A 2NQ6A 5CDEA 4FLIA 1W7VA 3L24A 4OOKA 2EVOA 4IF7A 4B28A 4FKCA 2ZSGA 4U75A 2ADUA 5JI6A 2MATA 1C27A 4PV4A 2BHAA 4U6CA 1KQ9A 3CB6A 4ZWPA 3RORA 1B59A 4FLLA 1C23A 4FO8A 4IPAA 3BITA 2HOWA 3PKAA 2V3YA 4S2RP 1QZYA 1PV9A 4A6VA 1YJ3A 5CNXA 1YW7A 2GGCA 3FMQA 2V6CA 3RVAA 2BWWA 3CTZA 2GG8A 3PKCA 2B3LA 2GG0A 3IU7A 1WLRA 5FCHA 2GTXA 1XGOA 1B6AA 2GG2A 4U1BA 1XNZA 4U6JA 3MATA 4HXXA 4MATA 4U6EA 2BWUA 1QXZA 2Q8KA 3S6BA 3BIPA 2GU7A 2EVMA 3TB5A 5D6EA 3BIQA 2Q96A 2EA2A 3PKBA 2B3HA 3TAVA 2GU4A 3FM3A 5CE6A 2OAZA 1YW9A 1W2MA 1QXWA 3CB5A 4IDYA 1KP0A 2BHDA 2OKNA 3L7GA 1XGSA 4JUQA 1C22A 1C24A 3PKDA 4U71A 1YW8A 2GG5A 3MR1A 1N51A 1O0XA 5FCFA 2Q95A 1WY2A 2GU5A 1R5GA 2GG9A 4RZZA 4ZWUA 1R5HA 5CIKA 4R60A 2BN7A 1XGNA 3FMRA 1C21A 1CHMA 2P99A 4QR8A 2Q92A 4FO7A 2G6PA 5D6FA 1WL6A 4U6ZA 1Y1NA 1R58A 2GGBA 4RZYA 4U76A 4S2TP 4EGEA 1JAWA 2Q94A 2BWSA 2EA4A 2BWTA 5CDLA 2DFIA 2BWXA 4A6WA 3PKEA 2GG3A 3IG4A 3IU8A 5E5BA 5JHUA 4Z7MA 4FUKA 3D27A 2V3ZA 4IKRA 4IU6A 1YVMA 2BHBA 2P98A 2GU6A 4ZNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAT A;  2BWV A;  1BN5 A;  4RGZ 1;  4U70 A;  4KM3 A;  2Q93 A;  4U69 A;  2NQ7 A;  4S01 A;  1WL9 A;  1WKM A;  1KQ0 A;  4U73 A;  1QXY A;  1A16 A;  2GA2 A;  4U6W A;  4IKT A;  4S00 A;  4FLJ A;  4FLK A;  2BB7 A;  2GZ5 A;  1BOA A;  2IW2 A;  2V3X A;  3IU9 A;  1M35 A;  4PNC A;  5CLS A;  5JFR A;  2P9A A;  5CDV A;  2EVC A;  3MX6 A;  2BH3 A;  4IKS A;  1XGM A;  3Q6D A;  4IKU A;  2BWY A;  2B3K A;  4IEC A;  2BHC A;  1WBQ A;  2GG7 A;  4ZWO A;  1WN1 A;  2NQ6 A;  5CDE A;  4FLI A;  1W7V A;  3L24 A;  4OOK A;  2EVO A;  4IF7 A;  4B28 A;  4FKC A;  2ZSG A;  4U75 A;  2ADU A;  5JI6 A;  2MAT A;  1C27 A;  4PV4 A;  2BHA A;  4U6C A;  1KQ9 A;  3CB6 A;  4ZWP A;  3ROR A;  1B59 A;  4FLL A;  1C23 A;  4FO8 A;  4IPA A;  3BIT A;  2HOW A;  3PKA A;  2V3Y A;  4S2R P;  1QZY A;  1PV9 A;  4A6V A;  1YJ3 A;  5CNX A;  1YW7 A;  2GGC A;  3FMQ A;  2V6C A;  3RVA A;  2BWW A;  3CTZ A;  2GG8 A;  3PKC A;  2B3L A;  2GG0 A;  3IU7 A;  1WLR A;  5FCH A;  2GTX A;  1XGO A;  1B6A A;  2GG2 A;  4U1B A;  1XNZ A;  4U6J A;  3MAT A;  4HXX A;  4MAT A;  4U6E A;  2BWU A;  1QXZ A;  2Q8K A;  3S6B A;  3BIP A;  2GU7 A;  2EVM A;  3TB5 A;  5D6E A;  3BIQ A;  2Q96 A;  2EA2 A;  3PKB A;  2B3H A;  3TAV A;  2GU4 A;  3FM3 A;  5CE6 A;  2OAZ A;  1YW9 A;  1W2M A;  1QXW A;  3CB5 A;  4IDY A;  1KP0 A;  2BHD A;  2OKN A;  3L7G A;  1XGS A;  4JUQ A;  1C22 A;  1C24 A;  3PKD A;  4U71 A;  1YW8 A;  2GG5 A;  3MR1 A;  1N51 A;  1O0X A;  5FCF A;  2Q95 A;  1WY2 A;  2GU5 A;  1R5G A;  2GG9 A;  4RZZ A;  4ZWU A;  1R5H A;  5CIK A;  4R60 A;  2BN7 A;  1XGN A;  3FMR A;  1C21 A;  1CHM A;  2P99 A;  4QR8 A;  2Q92 A;  4FO7 A;  2G6P A;  5D6F A;  1WL6 A;  4U6Z A;  1Y1N A;  1R58 A;  2GGB A;  4RZY A;  4U76 A;  4S2T P;  4EGE A;  1JAW A;  2Q94 A;  2BWS A;  2EA4 A;  2BWT A;  5CDL A;  2DFI A;  2BWX A;  4A6W A;  3PKE A;  2GG3 A;  3IG4 A;  3IU8 A;  5E5B A;  5JHU A;  4Z7M A;  4FUK A;  3D27 A;  2V3Z A;  4IKR A;  4IU6 A;  1YVM A;  2BHB A;  2P98 A;  2GU6 A;  4ZNG A; 
#chains in the Genus database with same CATH topology
 1MAT A;  2BWV A;  1BN5 A;  4RGZ 1;  4U70 A;  4KM3 A;  2Q93 A;  4U69 A;  2NQ7 A;  4S01 A;  1WL9 A;  1WKM A;  1KQ0 A;  4U73 A;  1QXY A;  1A16 A;  2GA2 A;  4U6W A;  4IKT A;  4S00 A;  4FLJ A;  4FLK A;  2BB7 A;  2GZ5 A;  1BOA A;  2IW2 A;  2V3X A;  3IU9 A;  1M35 A;  4PNC A;  5CLS A;  5JFR A;  2P9A A;  5CDV A;  2EVC A;  3MX6 A;  2BH3 A;  4IKS A;  1XGM A;  3Q6D A;  4IKU A;  2BWY A;  2B3K A;  4IEC A;  2BHC A;  1WBQ A;  2GG7 A;  4ZWO A;  1WN1 A;  2NQ6 A;  5CDE A;  4FLI A;  1W7V A;  3L24 A;  4OOK A;  2EVO A;  4IF7 A;  4B28 A;  4FKC A;  2ZSG A;  4U75 A;  2ADU A;  5JI6 A;  2MAT A;  1C27 A;  4PV4 A;  2BHA A;  4U6C A;  1KQ9 A;  3CB6 A;  4ZWP A;  3ROR A;  1B59 A;  4FLL A;  1C23 A;  4FO8 A;  4IPA A;  3BIT A;  2HOW A;  3PKA A;  2V3Y A;  4S2R P;  1QZY A;  1PV9 A;  4A6V A;  1YJ3 A;  5CNX A;  1YW7 A;  2GGC A;  3FMQ A;  2V6C A;  3RVA A;  2BWW A;  3CTZ A;  2GG8 A;  3PKC A;  2B3L A;  2GG0 A;  3IU7 A;  1WLR A;  5FCH A;  2GTX A;  1XGO A;  1B6A A;  2GG2 A;  4U1B A;  1XNZ A;  4U6J A;  3MAT A;  4HXX A;  4MAT A;  4U6E A;  2BWU A;  1QXZ A;  2Q8K A;  3S6B A;  3BIP A;  2GU7 A;  2EVM A;  3TB5 A;  5D6E A;  3BIQ A;  2Q96 A;  2EA2 A;  3PKB A;  2B3H A;  3TAV A;  2GU4 A;  3FM3 A;  5CE6 A;  2OAZ A;  1YW9 A;  1W2M A;  1QXW A;  3CB5 A;  4IDY A;  1KP0 A;  2BHD A;  2OKN A;  3L7G A;  1XGS A;  4JUQ A;  1C22 A;  1C24 A;  3PKD A;  4U71 A;  1YW8 A;  2GG5 A;  3MR1 A;  1N51 A;  1O0X A;  5FCF A;  2Q95 A;  1WY2 A;  2GU5 A;  1R5G A;  2GG9 A;  4RZZ A;  4ZWU A;  1R5H A;  5CIK A;  4R60 A;  2BN7 A;  1XGN A;  3FMR A;  1C21 A;  1CHM A;  2P99 A;  4QR8 A;  2Q92 A;  4FO7 A;  2G6P A;  5D6F A;  1WL6 A;  4U6Z A;  1Y1N A;  1R58 A;  2GGB A;  4RZY A;  4U76 A;  4S2T P;  4EGE A;  1JAW A;  2Q94 A;  2BWS A;  2EA4 A;  2BWT A;  5CDL A;  2DFI A;  2BWX A;  4A6W A;  3PKE A;  2GG3 A;  3IG4 A;  3IU8 A;  5E5B A;  5JHU A;  4Z7M A;  4FUK A;  3D27 A;  2V3Z A;  4IKR A;  4IU6 A;  1YVM A;  2BHB A;  2P98 A;  2GU6 A;  4ZNG A; 
#chains in the Genus database with same CATH homology
 1MAT A;  2BWV A;  1BN5 A;  4RGZ 1;  4U70 A;  4KM3 A;  2Q93 A;  4U69 A;  2NQ7 A;  4S01 A;  1WL9 A;  1WKM A;  1KQ0 A;  4U73 A;  1QXY A;  1A16 A;  2GA2 A;  4U6W A;  4IKT A;  4S00 A;  4FLJ A;  4FLK A;  2BB7 A;  2GZ5 A;  1BOA A;  2IW2 A;  2V3X A;  3IU9 A;  1M35 A;  4PNC A;  5CLS A;  5JFR A;  2P9A A;  5CDV A;  2EVC A;  3MX6 A;  2BH3 A;  4IKS A;  1XGM A;  3Q6D A;  4IKU A;  2BWY A;  2B3K A;  4IEC A;  2BHC A;  1WBQ A;  2GG7 A;  4ZWO A;  1WN1 A;  2NQ6 A;  5CDE A;  4FLI A;  1W7V A;  3L24 A;  4OOK A;  2EVO A;  4IF7 A;  4B28 A;  4FKC A;  2ZSG A;  4U75 A;  2ADU A;  5JI6 A;  2MAT A;  1C27 A;  4PV4 A;  2BHA A;  4U6C A;  1KQ9 A;  3CB6 A;  4ZWP A;  3ROR A;  1B59 A;  4FLL A;  1C23 A;  4FO8 A;  4IPA A;  3BIT A;  2HOW A;  3PKA A;  2V3Y A;  4S2R P;  1QZY A;  1PV9 A;  4A6V A;  1YJ3 A;  5CNX A;  1YW7 A;  2GGC A;  3FMQ A;  2V6C A;  3RVA A;  2BWW A;  3CTZ A;  2GG8 A;  3PKC A;  2B3L A;  2GG0 A;  3IU7 A;  1WLR A;  5FCH A;  2GTX A;  1XGO A;  1B6A A;  2GG2 A;  4U1B A;  1XNZ A;  4U6J A;  3MAT A;  4HXX A;  4MAT A;  4U6E A;  2BWU A;  1QXZ A;  2Q8K A;  3S6B A;  3BIP A;  2GU7 A;  2EVM A;  3TB5 A;  5D6E A;  3BIQ A;  2Q96 A;  2EA2 A;  3PKB A;  2B3H A;  3TAV A;  2GU4 A;  3FM3 A;  5CE6 A;  2OAZ A;  1YW9 A;  1W2M A;  1QXW A;  3CB5 A;  4IDY A;  1KP0 A;  2BHD A;  2OKN A;  3L7G A;  1XGS A;  4JUQ A;  1C22 A;  1C24 A;  3PKD A;  4U71 A;  1YW8 A;  2GG5 A;  3MR1 A;  1N51 A;  1O0X A;  5FCF A;  2Q95 A;  1WY2 A;  2GU5 A;  1R5G A;  2GG9 A;  4RZZ A;  4ZWU A;  1R5H A;  5CIK A;  4R60 A;  2BN7 A;  1XGN A;  3FMR A;  1C21 A;  1CHM A;  2P99 A;  4QR8 A;  2Q92 A;  4FO7 A;  2G6P A;  5D6F A;  1WL6 A;  4U6Z A;  1Y1N A;  1R58 A;  2GGB A;  4RZY A;  4U76 A;  4S2T P;  4EGE A;  1JAW A;  2Q94 A;  2BWS A;  2EA4 A;  2BWT A;  5CDL A;  2DFI A;  2BWX A;  4A6W A;  3PKE A;  2GG3 A;  3IG4 A;  3IU8 A;  5E5B A;  5JHU A;  4Z7M A;  4FUK A;  3D27 A;  2V3Z A;  4IKR A;  4IU6 A;  1YVM A;  2BHB A;  2P98 A;  2GU6 A;  4ZNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...