1XGNA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Aminopeptidase
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
total genus 93
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgnA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgnA01
1TLHB 2Y0MA 4HW0A 3KP4A 2ISYA 3L7WA 4R60A 3ZMDA 1U5TC 1TQPA 2CQKA 2W85A 4LK0F 3TAVA 2ZKZA 2PI0A 1HSTA 3WGHA 3NQOA 2GG5A 1ZRFA 2A6EF 4IKRA 5HS7A 2M5WA 4DNCA 1J5YA 4I02A 1ZREA 1V4RA 1BM9A 1K6OA 5L3FA 4WX9A 1QXYA 3BPVA 2V1UA 1FLIA 2EA2A 3DPTA 1TTYA 3ECOA 1RUOA 2ZFWA 5A2QK 5F1RA 4LFUA 1K78B 3WTVC 2L3DA 1WL6A 3Q9SA 2VE9A 1BI0A 5FD5A 1LDDA 4BNCA 3FXUA 4M73A 2GIVA 2QLZA 4I7HA 4L0ZB 2P99A 3BITA 1ZHFA 2LNBA 3G73A 2P7CB 4JQFA 2UXNA 3F6OA 2G6PA 5J6XA 5FB2A 4WF2A 2Q95A 4MQVA 2MLKA 5HLIA 3LQRA 2EFOA 4U76A 3TGNA 2IW5A 1OR7A 2EK5A 1WWXA 2W84A 1LEBA 4UVAA 1Z91A 4EGEA 4M9SA 3J7AO 2V1XA 4ON0A 4A0ZA 5J8FA 2FBHA 3WGIA 3GVAA 4M71A 4S2RP 2OU2A 2EV6A 3IU9A 1G3SA 1HKTA 3JSPA 2BN7A 1YW7A 4A6WA 5D4SA 1O7LA 1GXPA 1ULYA 2ZSGA 5DCMA 1MJ9A 4IVNA 4HX4A 1R36A 3L24A 1SAXA 2UXXA 3V8JA 1P92A 3Q6DA 1O3RA 2BWVA 4HDVA 3PKCA 3J80K 3QP5A 2ELHA 2D2WA 1R1VA 2ZO4A 5L3GA 5FFZA 2HZTA 3GFJA 4YIIA 1MJBA 3KZZA 5ICGA 2RC4A 2LSOA 2VBYA 2GG7A 4KIGA 2BWTA 2COMA 3O6BB 2JRTA 1ZN2A 4GYGA 2XGXA 1R22A 4P9FA 4HQMA 2GXBA 2P5KA 2GGCA 1WBQA 4U6CA 4WXDA 2EJRA 5IT3A 4KUMA 4HYEA 1FP1D 3P9KA 4H0EA 1USSA 1ZLKA 1LVAA 3ABTA 4RZZA 4ESJA 5E8IA 1PUEE 1LEAA 2QVOA 3KP6A 4LK1F 3HYIA 1LDKB 5LRRA 1N51A 4NHJA 4I09A 2MH9A 2OA4A 3L00A 4XLPF 4BXUA 2KRFA 2W57A 2STTA 4L9VA 1O3SA 4KN7X 2Z99A 4IHSA 2B3HA 3PKAA 2FNPA 3RKXA 2F5CA 4FX4A 5FCFA 3RIRA 2V3ZA 3M9AA 4L9JA 2VE8A 3WTXC 2D1VA 3F72A 3F8MA 1S8NA 5FFXA 4L0YB 2KIFA 4A2UA 2IPQX 5CIKA 3R60A 1XNZA 5CNXA 3BIPA 1IN7A 4O5VA 1QO0D 2K02A 2Q96A 4G9YA 2O8XA 4JBAA 1O7FA 4Y15A 1CGPA 2G7UA 3MZYA 4IRHA 2V3YA 3ZMVA 1FPQA 2D45A 4OOKA 1XMAA 1YFHA 4A5NA 4IKTA 2GU4A 2G9WA 2L02A 1DPUA 2CO5A 3GEZA 5HDGA 2HWVA 3R61A 3MEXA 1U3EM 2HYFA 5ICFA 3F22A 3BY6A 3HSFA 5E20A 2OZ6A 2QBYA 4IJAA 1SD4A 3ZQ7A 1KGSA 2A5YB 4Q48A 3WU1B 1ZGJA 4RS8A 3VEPA 3MZHA 4LLGF 1IXRC 3GW2A 3HHGA 4B8XA 5BOXA 2F5FA 3KEOA 2EFQA 4RGRA 2DBBA 5H6QA 1IN8A 1XCBA 4HLYA 2ZJ2A 1KQ9A 4HF1A 1XSDA 4ENKA 3MR1A 3LAPA 1FOKA 3ML6A 4HA8A 2PG4A 2O3FA 2IA2A 3V7CA 4ZYDA 2FE3A 2OKNA 4EGZA 3F6VA 2XKPA 3S2WA 3SZPA 3F3XA 1U5TB 1J0RA 3FHZA 4TV7A 3E97A 1HKQA 4BAYA 1D8KA 1KA8A 2QM3A 3LSTA 1R7JA 1HQCA 2J5PA 4EQQA 4ZWUA 1F4KA 2HGCA 4OIPF 2VXZA 5H6RA 3TKYA 1C27A 2GWRA 1EH8A 4MQ9F 1QZZA 1HW5A 2DU9A 2E1NA 3T0YA 5LLQA 4JK1X 2P9AA 1RNLA 2E7XA 2R3SA 2ZNZA 2FBKA 2ADUA 5DD4A 2XHKA 4YFNF 2Q92A 1KQ0A 2H6BA 1JAWA 1R1UA 3ZN1A 1FC3A 3I5UA 2FOKA 4P96A 1U6GA 2BWWA 5HDKA 4EJOA 1S3JA 4RAYA 3JAMZ 2EVCA 3WTTC 2BEOA 2M45A 5LEKA 4LB6B 3VFZA 3RPUA 2GU7A 3H3UA 4I0AA 3W6JB 2GXGA 1IAWA 3JTHA 4RGSA 4ENJA 1C21A 5K1YA 1IW7F 3CB5A 2RV8A 2V79A 3MCZA 3I64A 1MDMA 2P98A 2F5DA 3MWMA 1W4MA 3HRMA 3ISPA 4F7ZA 3BIQA 2FBIA 3O2PE 3IKVA 4GO1A 1C24A 5ERIA 1QXWA 2M1BA 4ENNA 1RUNA 3IWFA 4XLNF 5F6FA 5E18F 2D1HA 2WWYA 1CF7B 3MFKA 1BN5A 3FM3A 2IVMA 2EV0A 2M8EA 2BHCA 2A6HF 4MTDA 4HV5A 1ZLJA 3EDPA 2L4MA 1T0FA 3DP7A 2PN6A 2Z9OA 5E8GA 4KMFA 5KVRA 2CFXA 4EJVA 1K79A 3I59A 2GU5A 3FM5A 2BHDA 3IL2A 4LG0B 1ZRCA 2Q8KA 5EEHA 2DAOA 3C3WA 2CG4A 1JXSA 2GG9A 1HW2A 1OPCA 1IXSB 2H94A 1BBYA 5TRDA 2BWUA 4I2OA 1AOYA 4KT5C 3ELKA 1XCVA 3BWGA 1FT9A 4GCVA 3JTGA 5D5WB 4QLCU 3R6SA 1QNTA 2WTEA 2CYYA 4GYIA 3KE2A 5A2QZ 4I01A 1FYKA 4U7DA 2BWSA 2UWMA 3HSRA 1BI1A 4YFKF 4MHGA 4S2TP 4U0WA 1IUYA 4G7ZF 4L18B 3G3ZA 4CGZA 2JSCA 3SXYA 5CDLA 4IXAA 3RKWA 4PGHA 1WLRA 3ABUA 4IECA 2KIUA 2ACJA 1YLFA 3IHUA 1SFUA 1Z6TA 4LJZF 1K78A 2BWXA 2FXAA 2R7DA 1QZYA 4AD9A 1HKSA 2F5EA 3RKYA 4A6VA 1FBUA 3P7NA 3R0AA 1KP0A 3DF8A 4P5OA 1FNNA 3QPHA 2EVOA 1RIOH 4UV9A 2Q2EA 1UB9A 5CVVA 1FYMA 1GVJA 1ZG5A 1LJ9A 5FGMA 1YS7A 2L01A 5ICCA 4Z7MA 3LA3A 1HSJA 4HLXA 3T1BA 4OIRF 3E6DA 2BWYA 2IA1A 3ZMTA 3EYYA 3BJ6A 1YQAA 4HX7A 5H20A 5FO5A 3L09A 1XMKA 1E17A 2FNAA 1IRFA 2G7HA 1M35A 2BHAA 2EWNA 2OQRA 2C6YA 2FU4A 4L5IA 3BROA 2RKHA 2YX7A 4IKUA 3TDUC 4IU6A 5HLGA 1XGNA 4KICA 1T39A 2QUFA 3GUDA 4U0VA 3GZ6A 4FO8A 1W7VA 4AIHA 2H27A 3K69A 2EA4A 2H09A 1YVMA 2QENA 1ODDA 4S05A 1ON2A 3F8CA 1I1SA 1J75A 1KU9A 4CO8A 2VONA 4EM1A 2NQ6A 5FLXK 3SHFA 4L9NA 2PBIA 2GAUA 4HV6A 3L2CA 1ZG1A 2HKXA 2MC3A 2XROA 3V8KA 1Z05A 2PEXA 3CUOA 1QBJA 1W7PD 3KP3A 3H92A 2DW4A 3WU0A 1REPC 3VODA 1EH6A 1L0OC 2P5LC 3CUQC 2FRHA 2ESHA 2AS5F 3BOQA 4P9UA 2DTRA 3H3ZA 3M8EA 5ILVA 3SZTA 4B09A 5L3CA 1JHHA 3WE2A 3JSOA 4U0YA 2ESNA 3B73A 4G7OF 4OINF 2YSRA 3F8NA 2O03A 4WWCA 3BZ6A 3SQNA 1I1GA 4U75A 5JR3A 5CDVA 4HXXA 1Z7UA 2GA1A 2P5VA 4YIFA 1FP2A 1ON1A 3MQ0A 4CHUA 2DQLA 3M8FA 1B59A 1TBXA 2K4BA 2NS0A 4XRFA 3GFIA 1IXCA 3M7GA 1PP8F 2RNJA 4WCGA 3GLXA 3DFGA 4E70A 1DPRA 4XBFA 5HOOA 2ZMEB 4RAZA 1KU3A 4BHPA 4OMZA 2Z3YA 3IRRA 5LBQA 5DD8A 1A16A 4L5JA 2FF4A 2VBWA 3TDZC 2LF7A 4EJTA 5CVRA 2J5OA 5DYMA 3E5QA 3KZYA 1CHMA 2GTXA 3REOA 3COAC 1FSHA 1WKMA 3KFWX 2EVMA 3FWEA 1S6LA 5L3DA 3K1PA 2IA0A 2JZYA 5LHHA 4IRIA 3PQKA 1MKMA 4U88A 5K5QA 2QWWA 2GU6A 4BHBA 4UV8A 2TDXA 3R4KA 1QPMA 5D6FA 3KLOA 1O3TA 3IKTA 3GO5A 3F23A 5BS6A 1PDNC 3HHHA 3I54A 5DDGA 2VT3A 1XGOA 3EUHA 2EV5A 4FUKA 4ESBA 2IRFG 3C1DA 4HOBA 4U71A 2GA2A 1V3FA 3FMSA 4A0YA 1U5TA 2HQRA 3F8FA 3ZMZA 2VOOA 4PZJA 1MJAA 5AONA 3D27A 3TB5A 1TNSA 4RGUA 4HBLA 3VB2A 5D8LB 4MTEA 4Q5SF 3HTSB 3QU6A 3KP2A 1FYLA 1YTYA 5JI6A 1D3YA 2MBFA 1B9NA 1ZARA 4IHTA 2O61A 3KP7A 1YS6A 1EH7A 1LDJA 1S7AA 2XRNA 3I0TA 3CJNA 1DDNA 3KP5A 1B1BA 4ZYHA 3D0SA 2DFIA 3GZ5A 1Z1DA 2B0LA 5DV5A 2NNYA 3J81Z 4A5MA 3KEQA 3MAJA 3IU7A 4FLJA 4GGGA 2KJCA 4EJUA 3ROUA 3B02A 4UNOA 4UVBA 5LGTA 4XSXF 4KNYA 1WL9A 2GG0A 2DI3A 1QGPA 2KJBA 3OV8A 4M74A 1BI3A 5CVJA 1P6RA 5FCHA 1BOAA 4KFCA 3FX3A 3CO7C 1J9IA 4CICA 1XSXA 2XUBA 1AWCA 3WTSC 3RJPA 2MA3A 5L3BA 1FX7A 2LDUA 4I0BA 4HF0A 3L9FA 4G6DA 1OYIA 3HSEA 1U2WA 2KKOA 1UCRA 1STZA 5ILUA 1Y0UA 1SD7A 3WE3A 3FXQA 2BH3A 1SFEA 1KU2A 5DEQA 4KM3A 2DK5A 1FY7A 4RB3C 2QQ9A 2YPRA 4LG0A 4RB0A 1L3LA 1XD7A 5D8KB 4R8HA 3K2ZA 1TW2A 1DUXC 1LB2A 1WY2A 3FF5A 1HXDA 4PCQA 2UZKA 3ERED 4HDUA 2B3LA 2PJPA 2IP2A 2OQGA 4U7BA 2VODA 1J59A 4IPAA 4N9IA 3T8TA 1T38A 1YJ3A 1U78A 4LMYA 5AIPA 4Y17A 1XN7A 2WC2A 4P55A 3CUQB 2BHBA 4LB5A 1R23A 2IT0A 2XAGA 5LRSA 4ENMA 5LHGA 4BHCA 3K1MA 2RVCA 4NB5A 3WTUC 4GXOA 2K27A 2Q0OA 2YU3A 1FWZA 3DKWA 5DUIA 1PV9A 1SMTA 4JUQA 1MATA 1BIAA 1JGSA 1BC7C 1C22A 5BPIA 4AIJA 3WGGA 4ETSA 2XAFA 2HKOA 4MEYF 4U69A 2LF8A 2GZWA 4A0XA 3HUGA 1TNTA 2CSOA 4N9HA 3SFZA 3TOBA 1FZPB 2CW0F 2HOWA 4LGWA 1ZGAA 5JHUA 5IT9K 2JPBA 2IJLA 3PKEA 4PNCA 4ZWOA 5LGUA 2BGCA 3RYRA 1R5GA 3WTZA 4MNUA 1O0XA 5E5BA 3JAMK 4WK8F 5CYVA 3F21A 4U6ZA 3QP6A 2OZUA 1IN5A 2MD5A 5CVIA 4L9TA 3E6CC 4M6YA 1J7KA 4BYYA 4S04A 1W5TA 2XIGA 2VC1A 3CLOA 5JVTA 3CDHA 4WXHA 5KK1A 1MD0A 2XAQA 1F9NA 5FLXZ 4Q47A 2XKOA 4ASNA 3AAFA 2P6TA 2NQ7A 2BV6A 1C23A 4EJWA 3N4MA 1G3TA 4ZNGA 2DPDA 1G3YA 2JT1A 2X4HA 3U1DA 4BQAA 2ZCWA 5CLSA 4UHTA 4O3MA 4U1BA 1ZH5A 4N0BA 5LEJA 2W25A 4M6XA 3LAJA 3HTUA 4YG2F 3U9GA 2Q94A 5D5VB 3JW4A 4QR8A 2RQPA 2HTSA 3J80Z 3EETA 2VBXA 3QU3A 3ULQB 2NAZA 3EQLF 2XASA 3M1EA 2GZ5A 4PDKA 3RORA 2ZNYA 4MGRA 3BDDA 2V3XA 1W7PB 3KETA 4DQ2A 3TOAA 4O6JA 2XAJA 4G94A 3RI4A 1KYZA 1BI2A 4RZYA 1UFMA 1MZBA 2A07F 1YG2A 1T6SA 4UVCA 1Q1HA 2V9VA 2RGVA 1YIOA 3KLNA 2W24A 3C18A 2PLYA 5EEGA 4FLLA 2GG2A 4IDYA 4EMSA 4ZYEA 3I58A 2O0YA 1P2FA 3BP8A 2ISZA 2EFNA 2YX4A 3IWZA 2XAHA 3TQNA 3ECHA 1XGMA 1FSEA 1C0WA 3NRVA 2QYOA 2Q93A 3V4GA 2LKPA 3FMQA 3O3KA 2O6GE 3DEUA 2VBZA 1ZYRF 4FT8A 4LLLA 3CO6C 2GGBA 1S29A 3Q5FA 2ZMEA 5F64A 3T5XA 4KA4A 4EGYA 3CB6A 2EFPA 2VT2A 4CYDA 2JTVA 4S01A 4EM2A 3BJAA 3K0LA 1YW9A 3FXRA 4M9XA 1B9MA 2PMUA 4ZZDA 1RI7A 2DQRA 3PKDA 4OIQF 2DO7A 2XV4S 1WI9A 3K1NA 3I53A 2F2EA 4R1HA 2HQNA 2XVCA 4IKSA 5CDEA 4FKCA 4HZFA 4AVPA 5HS9A 4UXNA 3VOEA 3TO6A 2STWA 2GQQA 2E7WA 5HVQC 4HF2A 1OMIA 3KCCA 1LNWA 1R00A 3ZN0A 1IN6A 4EV0A 5DUKA 2PQ8A 4IF4A 3DV8A 2L54A 4CZZA 1BIBA 1JHFA 4KN4X 4FHTA 4CXFA 2FSWA 1FBSA 2PMHA 3DQVC 1F1ZA 1W5SA 3PKBA 1BJAA 3BJOA 2GG8A 4MATA 4IF7A 5L3EA 1BC8C 5J8CA 1ZRDA 3CTAA 1KYWA 3S6BA 1O3QA 2HFHA 1TQMA 1KU7A 2QQAA 3HOSA 1KQ8A 5DCMB 3TO9A 2A69F 1H0MA 2HDCA 4KYWA 1E2XA 1ONVA 2K4JA 3IG4A 1IN4A 2R7FA 3V7SA 4KIFA 4G8XA 4ZZLA 4LLNA 2BE5F 2FEZA 4A12A 1SD6A 3BPXA 1D5VA 1WRJA 3LA7A 5BMZA 3ZMSA 4ZH4F 3HIFA 2NRAC 3GWZA 4LD5A 4ESFA 4QWQA 1I27A 4FLKA 1G6NA 2P4WA 3E6MA 3HOTA 5AIQA 1RZ4A 4I98B 2FA5A 4KIBA 4B28A 1F5TA 2RN7A 1ZG3A 4OIOF 3E3VA 3LFKA 5E17F 3GFMA 1I5ZA 3WTWC 3EYIA 1J2XA 1VTNC 5TJJA 1S7OA 4U6JA 1B6AA 2HTJA 5FD6A 3V8LA 4EM0B 2QQBA 2A68F 2DPUA 1G4DA 3HRUA 5ICEA 2M30A 4HQEA 2K86A 3LA2A 3P9IA 3WG9A 2E1CA 3IU8A 1LQ1A 2HYGD 2IW2A 4M9ZA 1USTA 2OD5A 1TQIA 1P4AA 1XDSA 1HW1A 4Y13A 4BH9A 2HR3A 1SMYF 4FLIA 2NNNA 1T98A 4RGZ1 1U8RA 4IRGA 1TW3A 2CGPA 3LQQA 3RDIA 1O57A 2FQ3A 4U6EA 1P4XA 2DLLA 4ZYGA 2X0LA 3V7RA 1ZAOA 3N97A 3WTYC 1IRGA 2DK8A 4CDGA 1SD5A 4K2EA 5DCFA 5D4RA 6PAXA 2YR2A 2V6CA 2Z5UA 1W2MA 2K7LA 3QRFF 2QZ8A 2VN2A 3E5XA 2Z33A 2Y48A 4KMUX 4D0PA 1B4AA 1DP7P 3ZMUA 2OBPA 2A61A 2HEOA 1OYYA 3R0JA 4G6QA 1I6XA 1YO5C 5K5RA 2NYXA 3CUQA 1CF7A 4AIKA 4ZWPA 1SFXA 1IZ1A 1UHWA 2QBYB 4OOIA 4EVIA 1A04A 1MGTA 2BB7A 1H9GA 4RB2C 3GF2A 5D5UB 2VC0A 5E1WA 5IT9Z 2EFWA 2VOPA 4M72A 3MX6A 1WQ2A 2EB7A 3DXJF 5LGNA 5D5XB 3HRTA 3QOPA 5HLHA 3GFLA 1T2KA 1GHCA 1R58A 1WN1A 3D5LA 4PGGA 3RVAA 4Z2YA 1XB4A 3FMRA 3K9TA 1OYWA 1YYVA 4U73A 3GX4X 3J81K 3I4PA 3T8RA 3IC7A 1GXQA 4S00A 5ILSA 2JPCA 3TO7A 4A6DA 2B3KA 2BYVE 2AXLA 5K5OA 3QPTA 5CJ9A 2WV0A 3QAHA 1K7AA 2H6CA 3WODF 3FZVA 2Y75A 5CVUA 4PV4A 1Y1NA 4RGXA 4AWXB 1H9TA 1EV7A 2P8TA 4UUVA 4RB1A 2P7VB 1R1TA 2GG3A 4OU0A 1HBXG 2BBYA 3E5UA 4Q4ZF 1OKRA 1YW8A 1QXZA 3I71A 3DPLC 4OMYA 2M87A 4KDPA 2OAZA 3HRSA 1R5HA 1IF1A 4G7HF 3RTRA 4YFXF 1XGSA 5E1ZB 3U2RA 2V1DA 4XSZF 3L7GA 4WXCA 5E1XA 1Z6RA 4R79A 3Q9VA 5JFRA 5CE6A 1FBQA 1NHAA 3IRQA 1MDMB 2MLGA 1PP7U 3F8BA 2P6SA 2CWEA 2ZBKA 3GXOA 4MEXF 1D8JA 3E6BA 5HDNA 3OOPA 1P4WA 1XDUA 2HS5A 3PQJA 1XSVA 2RDPA 3P9CA 1Z9CA 2PFBA 2MATA 5D6EA 1G3WA 1UHMA 3NEUA 4U70A 1W7PA 3RPQA 1WSUA 3ZPLA 4HAMA 3ZP5A 5BPDA 4U6WA 5HS8A 2FMYA 5BQTA 5ED4A 2MH2A 3LWFA 3PFIA 2A3SA 3C7JA 2HOEA 3I59B 2KIMA 2DT5A 3RYPA 2FMLA 4HX8A 3MATA 3W6KB 4A6EA 3GYHX 1QQIA 1JE8A 4FO7A 2ZXJA 4NQWA 3CTZA 2ETHA 4FX0A 5LHIA 1X3UA 2L4AA
chains in the Genus database with same CATH superfamily
5EG0B 1TLHB 2Y0MA 3CMYA 4HW0A 3EUHC 2K5CA 2X48A 2ISYA 2LBFA 3KP4A 2E60A 3L7WA 2GIZA 3DBLB 1WJCA 1AKHA 4R60A 3ZMDA 1U5TC 2R5ZA 1TQPA 1TZLA 1ZK8A 2CQKA 2W85A 4P1WA 5TGTA 4LK0F 3TAVA 1WJEA 2ZSIB 1ETXA 2ZKZA 2V26A 3K4JA 1APLC 2PI0A 1HSTA 3WGHA 3NQOA 2O5RA 2GG5A 1ZRFA 1Z3YA 2A6EF 4IKRA 1VF9A 1T33A 2IGKA 5HS7A 3BG6A 3FHNA 3A01A 3OWTA 2M5WA 2IGMA 3F0CA 4DNCA 4EEFG 1J5YA 4I02A 3I4MJ 2M3AA 4B3XA 3AG4H 1ZREA 1V4RA 1BM9A 1K6OA 3D5RC 5L3FA 2L9SA 3HOVJ 4WX9A 1QXYA 2HNHA 3BPVA 2V1UA 2JMWA 1FLIA 2EA2A 1ETVA 3DPTA 1TTYA 3ECOA 1RUOA 2ZFWA 2B7EA 5A2QK 5K7ZA 5F1RA 4JYKA 4LFUA 1K78B 3WTVC 3CMAI 3A0BC 3S2HJ 2L3DA 1WL6A 3Q9SA 2VE9A 1BI0A 5FD5A 1LDDA 5FKLA 3FXUA 4FETA 4M73A 3CCUI 2D5VA 4BNCA 1QVUA 3VYSB 2GIVA 2QLZA 4I7HA 4L0ZB 2LY9A 1PJRA 2CUZA 2P99A 3BITA 2DTZA 1ZHFA 2ZJPF 2LNBA 3G73A 1Y39A 2P7CB 3OIPA 4JQFA 2UXNA 3LMMA 3F6OA 2G6PA 1SVLA 4NC6A 5J6XA 5FB2A 4WF2A 2Q95A 1X1PA 4MQVA 2MLKA 2Q2EB 5HLIA 2LKSA 4ITVA 3LSRA 3LQRA 2EFOA 4U76A 3TGNA 2IW5A 4HNUA 1OR7A 4BGDA 2EK5A 2JVGA 4BJ6C 1WWXA 1MBFA 2W84A 1LEBA 4KJZA 4UVAA 1Z91A 2KHMA 2HPIA 1FMWA 3ASNH 4EGEA 4XLAA 2XPUA 4M9SA 3J7AO 1TWGJ 2V1XA 3G1LA 4ON0A 4GDFA 4A0ZA 5J8FA 1GVDA 2FBHA 2L9NA 3VSLA 3WGIA 3BCAA 3GVAA 4B1RA 4M71A 2O9LA 2ID6A 3CMEI 4S2RP 2DJIA 2OU2A 2MW8A 2EV6A 3IU9A 1G3SA 1HKTA 4MIMA 4F93B 3JSPA 3K10A 2BN7A 1YW7A 4A6WA 5D4SA 4BE2A 1O7LA 1GXPA 2JUGA 1ULYA 3WG7H 2ZSGA 4CCOA 4UUSB 2LOOA 2BZTA 5DCMA 4A3GJ 1MJ9A 2LRDA 2JK3A 4IVNA 4HX4A 1R36A 3CMMA 3L24A 3X2QH 1SAXA 2UXXA 3CESA 1X2MA 3V8JA 1P92A 1RETA 3Q6DA 2DN0A 1O3RA 2BWVA 3UKGA 2DA2A 1DU0A 4HDVA 4IQJA 3CJQB 3IH2A 3PKCA 1HC8A 3J80K 1XS9A 2R7QA 3QP5A 5LFAA 2ELHA 2D2WA 4DZJA 2BVLA 3S93A 1TL8A 1R1VA 1YJWI 3SEQA 1FIPA 4AYBN 2ZO4A 4I76A 5L3GA 4XORA 5FFZA 1E3OC 2HZTA 3GFJA 4YIIA 2VUMJ 1MJBA 3KZZA 2DJNA 5ICGA 2RC4A 2LSOA 4RAFA 3BR0A 2VBYA 3AL0C 2GG7A 3ABMH 1FTTA 4KIGA 1O4XA 2BWTA 3CCRI 2COMA 3A1YA 3O6BB 5EYRA 2JRTA 3MKWB 2KRCA 4C3HJ 2EH3A 2XPVA 1ZN2A 4M3DA 4GYGA 1V55H 1SVOA 2XGXA 3FXKA 3HOXJ 2EZIA 3SFIA 1R22A 4P9FA 3BG7A 3FKJA 4HQMA 2GXBA 2P5KA 3BTJA 1WBQA 2GGCA 4U6CA 3DWLE 4WXDA 2Z2SB 2EJRA 4RAGA 1ETQA 5IT3A 2AQEA 3TL4X 4KUMA 2H8WA 4ZDPA 2ELKA 4HYEA 1FP1D 3P9KA 4CA0A 1JJ6C 3PO3J 4H0EA 4Y33A 3ZXSA 1USSA 4OAZA 1ZLKA 3PL8A 4MLOA 1LVAA 3BTIA 4HG2A 2WAQN 3ABTA 4BEHA 4RZZA 4ESJA 5E8IA 2VPRA 1PUEE 1Z67A 1LEAA 2QVOA 2HU9A 3KP6A 4LK1F 1E3PA 5IYBJ 3HYIA 3ONQA 4IHXA 4NBQA 1LDKB 2M7AA 5LRRA 2CV0A 2IGOA 1R5ID 1R4MB 4PJLA 1N51A 3K70C 4NHJA 1POGA 4I09A 2MH9A 1OISA 5IOZA 1P7JA 2OA4A 3L00A 3OR1C 4XLPF 3JRIA 3ZQHA 4BXUA 1QVTA 5J1YA 2MC4A 4ANJA 2KRFA 2W57A 1UMQA 2STTA 1T08B 1LKXA 4L9VA 1O3SA 2DOFA 4KN7X 3G4SI 3PSIA 5DTDA 2Z99A 4IHSA 2B3HA 3PKAA 5M3MJ 2FNPA 3RKXA 2F5CA 2IBDA 4DIQA 5JHFA 4KITB 4FX4A 5FCFA 3RIRA 2V3ZA 1UJ8A 2K85A 2RREA 3A02A 3KPHA 3J7AY 2LLKA 3Q0UA 1JKPC 3M9AA 3SYTA 2CFOA 4L9JA 4C3JJ 2VE8A 3JRAA 3WTXC 3IV5A 3PIOF 2D1VA 3F72A 3F8MA 3CCQI 1S8NA 5FFXA 1X1DA 4NC8A 4L0YB 2KIFA 4A2UA 2IPQX 5CIKA 3R60A 1XNZA 5CNXA 1K61A 3BIPA 1IN7A 2DOEA 1X3ZB 2JA8J 3S1QJ 3MKYB 4O5VA 4KT6A 1QO0D 1VZ0A 2K02A 3KYDB 3CCSI 1ACIA 2Q96A 1FMVA 4G9YA 2O8XA 4JBAA 3CF2A 2UUZA 1O7FA 5DS9A 5B5EC 1GV5A 2CQXA 4Y15A 1CGPA 5GPCA 2G7UA 1U0JA 3MZYA 1X3WB 3TP0A 4IRHA 2V3YA 3ZMVA 1FPQA 1EJ9A 2D45A 4LIUA 4BE0A 1XMAA 4OOKA 2A6TA 1OQYA 5B66C 1YFHA 4A5NA 4IKTA 2GU4A 2G9WA 4E7SA 2L02A 2L7KA 1DPUA 4HNVA 2CO5A 2BOLA 2I8DA 3GEZA 2LFBA 5HDGA 1A35A 2HWVA 3R61A 3MEXA 1OCTC 1U3EM 4E6KG 2HYFA 3BR1A 5ICFA 4UUTA 3OYNA 3GTKJ 2RQQA 3F22A 3BG5A 3BY6A 1UG2A 1UHSA 3HSFA 5E20A 2LY2A 2OZ6A 2FQ4A 5C44J 4IJAA 2QBYA 1SD4A 4XIDA 3ZQ7A 2M7BA 1KGSA 2A5YB 4Q48A 4NC7A 3S14J 3S15J 3WU1B 3TEDA 2ZJQF 1ZGJA 2HQ5A 4RS8A 3VEPA 2VQLA 4W1UA 4LLGF 1IXRC 1GLNA 3GW2A 3MZHA 1ZGWA 3HHGA 4B8XA 3FXLA 5BOXA 2F5FA 3KEOA 2EFQA 3HL2A 3CCJI 1H88C 2ID3A 4RGRA 2DBBA 5J40A 1JTYA 2DMQA 2M0MA 3CJRB 5H6QA 5EEAA 3CDLA 1IN8A 2BW3A 1XCBA 1V5EA 2OJED 3QYBA 2ZJ2A 1KQ9A 4HLYA 1R71A 4HF1A 4XN3A 3KYLA 3RZOJ 1XSDA 3ZOBA 1ZTRA 2KT0A 4ENKA 3MR1A 3LAPA 2E1MB 1FOKA 3ML6A 4HA8A 2PG4A 2O3FA 3FK7A 2IA2A 4GRIA 3V7CA 4IKFA 4ZYDA 2VIXA 2FE3A 2OKNA 4EGZA 3F6VA 1DP3A 2XKPA 2FOWA 4V19K 3S2WA 3SZPA 3F3XA 1U5TB 1J0RA 3PNTA 2F6CA 3FHZA 3H9JA 4TV7A 3CCVI 3E97A 1IRZA 2LMDA 1HKQA 3IP4B 4BAYA 1D8KA 3ZQLA 2XPWA 1XMXA 1KA8A 2QM3A 3LFUA 2DCEA 3LSTA 4QPQA 4YIRX 1R7JA 1GDTA 1HQCA 2J5PA 4DGWB 4EQQA 2X1EA 4ZWUA 3S3MA 2L7MP 1F4KA 4IQ4A 2HGCA 4OIPF 2EPFA 3B6AA 2VXZA 5H6RA 3TKYA 1C27A 2GWRA 5IP6A 3I9V2 1BA5A 1EH8A 4MQ9F 5F0HA 1QZZA 1HW5A 2DU9A 2E1NA 4XM3A 2XB5A 3T0YA 2M8GX 1YOVB 5LLQA 4JK1X 2K3FA 2P9AA 3U21A 1LE8A 2HVSA 3JCUC 1NK3P 5FLVA 1RNLA 2E7XA 1RR8C 3IAM2 2KZGA 2KIQA 2R3SA 1S9HA 2ZNZA 1M1EB 2FBKA 2VKHA 2ADUA 2ZJRF 5DD4A 3D1NI 2XHKA 4YFNF 1ETKA 5E79C 1KQ0A 2Q92A 2AQFA 2H6BA 2LYCA 1JAWA 1R1UA 3ZN1A 1FC3A 2JJ7A 3I5UA 2FOKA 3VDXA 1ETOA 4P96A 1U6GA 2BWWA 4E7LA 5HDKA 4EJOA 1S3JA 4RAYA 4XRSA 3UNGC 4BKXA 3JAMZ 4Y3OA 1JI8A 2EVCA 3OS0A 2JWTA 3G2BA 1V54H 3WTTC 2BEOA 5M3FJ 2M45A 3I4NJ 5LEKA 4LB6B 3VFZA 3RPUA 1TWHJ 1H8AC 2GU7A 3H3UA 4I0AA 3W6JB 2GXGA 1IAWA 3JTHA 2FX0A 1RC9A 2BXZA 4RGSA 2DA7A 2DODA 4ENJA 1JKOC 1C21A 2ZMEC 2M34A 5FRNA 5K1YA 1IW7F 3OYEA 2CV1A 3CB5A 2W4SA 2RV8A 1WZ2A 2V79A 3MCZA 3I64A 5EGOB 1BL0A 1MDMA 1JKQC 2P98A 2F5DA 1LVKA 1MSFC 3MWMA 1HA8A 3H5NA 2MSYA 1W4MA 3HRMA 1IO2A 2XB0X 3ISPA 4F7ZA 3BIQA 2FBIA 4RBOA 3O2PE 3IKVA 4GO1A 4IEJA 2W48A 1C24A 3A4CA 5ERIA 1QXWA 4XLEA 2M1BA 1ZR2A 4ENNA 3S16J 2HDDA 2EZKA 3BR6A 2KISA 3IWFA 1RUNA 4XLNF 3I56I 2DDBA 1MMNA 1K4TA 3BR2A 5F6FA 5E18F 2BVMA 2D1HA 5JLWA 2WWYA 1CF7B 4ZYAA 5FJ8J 3MFKA 2HXOA 2V1NA 1BN5A 3FM3A 2IVMA 4CCMA 1U9OA 2EV0A 2WAFA 2M8EA 2R5YB 2BHCA 2A6HF 4MTDA 4HV5A 5FLMJ 1ZLJA 2ECBA 2IXSA 2AXTC 3EDPA 1W1WE 2L4MA 4BXXJ 1Y56A 3ERMA 1T0FA 3DP7A 2VQHA 2PN6A 4DZPA 2G0EA 2Z9OA 5E8GA 4KMFA 5KVRA 1MNDA 2CFXA 2P81A 4EJVA 3I59A 1K79A 2GU5A 2QSFX 2X6OA 3FM5A 2BHDA 1K4SA 2K9NA 2FUG2 3IL2A 5LD2C 4LG0B 2NXNB 1ZRCA 3EUKL 2Q8KA 1G59A 3U1KA 1FJLA 5EEHA 2DAOA 5EG0A 3C3WA 2CG4A 1JXSA 3AL0B 2GG9A 1SVMA 1HW2A 4XLCA 3QQAA 2K9QA 1OPCA 1IXSB 2H94A 2NS7A 3K2AA 2JA2A 1BBYA 3PNYA 5TRDA 2BWUA 4I2OA 1IDZA 1AOYA 4KT5C 3ELKA 1XCVA 3BWGA 1FT9A 3HZJA 1ZELA 4GCVA 2HDWA 3PUBA 4ZDLA 3JTGA 4E7JA 4X6AJ 5D5WB 4QLCU 4QSHA 2ZC2A 3R6SA 1QNTA 2WTEA 2CYYA 4GYIA 3KE2A 1LUJB 1Z77A 3Q0VA 4D9JA 4I01A 5A2QZ 3JRFA 2Y9ZA 1FYKA 1AHDP 4U7DA 4A69C 2BWSA 2UWMA 3HSRA 1BI1A 4YFKF 2HYJA 4MHGA 4S2TP 4U0WA 1IUYA 3MKLA 4G7ZF 4L18B 3G3ZA 4CGZA 3K4BA 2JSCA 4C3IJ 3SXYA 5CPRB 2EIMH 2LC2A 3HC7A 4V2FA 1QA6A 5CDLA 1IGNA 4IXAA 3RKWA 4XKCA 3PO2J 3OL3A 4PGHA 1WLRA 3ABUA 3HBLA 1GT0C 4IECA 2KIUA 2DMTA 2ACJA 1YLFA 2PMZA 3IHUA 2PX9A 2NVUB 1SFUA 4E7HA 2A5WA 1Z6TA 4LJZF 1K78A 2BWXA 4J00A 2OV7A 4AU7A 2FXAA 2R7DA 4XLHA 5CQEA 1QZYA 3RPUD 1HKSA 4AD9A 2F5EA 3OYGA 3RKYA 4BQNA 4A6VA 1FBUA 3P7NA 1HF0A 5CKTA 3R0AA 1KP0A 3IAS2 2E1MC 1OCCH 3DF8A 1VQ4I 3CD6I 2P0WA 3PM1A 3VPRA 1VQ8I 4P5OA 1FNNA 3QPHA 2EVOA 3HUGB 1RIOH 1YI2I 1V5GA 4MFDA 4UV9A 4F92B 2Q2EA 1UB9A 4JX5A 1Z0XA 3HDDA 5CVVA 2GM4A 2R92J 4RLQA 3OR2C 2F4MB 1FYMA 1GVJA 1ZG5A 2BY2A 1LJ9A 1OCOH 5FGMA 1YS7A 3J7ZI 2L01A 3AFHA 5ICCA 2E71A 4Z7MA 1NTCA 2EIKH 3LA3A 1HSJA 4HLXA 3T1BA 4OIRF 3E6DA 2BWYA 2EZLA 2IA1A 3ZMTA 3EYYA 3BJ6A 3OYHA 1YQAA 3LSKA 1V5FA 4HX7A 5H20A 5FO5A 3L09A 1VQ6I 2XGCA 1XMKA 1E17A 4UUSA 1IUFA 1IRFA 2E1OA 2KFDA 3BC8A 2G7HA 2FNAA 2GBYA 1M35A 1SFOJ 2BHAA 2EWNA 2OQRA 2C6YA 2FU4A 2Y69H 4L5IA 3J7YJ 3BROA 2RKHA 4D5CA 2YX7A 2X1CA 1T56A 1YHQI 3W6VA 4IKUA 2JA7J 2OCEA 3TDUC 4IU6A 3QPLA 3DTEA 5F08A 5HLGA 1XGNA 2ECCA 4KICA 1T39A 2XSDC 1YJ9I 1QHHD 4F55A 2JUCA 1ZQ3P 2QUFA 3GUDA 4U0VA 3K4CA 1MMAA 1D0XA 1ZR4A 1B8IB 5J47A 2V7FA 3GZ6A 3FISA 4FO8A 1W7VA 3G71I 2QCOA 4AIHA 2H27A 3K69A 4C9YA 2EA4A 2VKEA 2LH9A 3DCFA 1N78A 1UELB 3TMOA 2H09A 1YVMA 2QENA 1ODDA 3S32A 4S05A 1ON2A 2I10A 3GLLA 4A3DJ 3F8CA 1I1SA 1J75A 1KU9A 4CO8A 3VSKA 2VONA 4EM1A 3NARA 2VASA 1XX5A 2NQ6A 1AKHB 3G1MA 5FLXK 3SHFA 2V9PA 4L9NA 2DA5A 2PBIA 2GAUA 4HV6A 3L2CA 1ZG1A 2HKXA 2LP0A 2MC3A 3QYFA 2XROA 3V8KA 2QEXI 1Z05A 2PEXA 2VQGA 3CUOA 4UB6C 4DOZA 2W7NA 1QBJA 2Y0SN 1WFXA 1W7PD 4RM3A 2QSGX 3KP3A 2CQ7A 2X6YA 3H92A 4XN0A 1RKWA 2DW4A 3WU0A 1REPC 3VODA 3VWBA 1EH6A 4G6TB 1KONA 3LSPA 1VQLI 1L0OC 4HPQA 2P5LC 3CUQC 2FRHA 1DGRM 1R6RA 2ESHA 3DPUA 3HKZA 3K7AJ 3ZQQA 2AS5F 3BOQA 3BZCA 4P9UA 1YJNI 2DTRA 3H3ZA 3M8EA 5ILVA 3SZTA 4B09A 2F4IA 2Z1DA 3ZQCA 1MBKA 3AG2H 4LG3A 5L3CA 1JHHA 3WE2A 1U9NA 3JREA 3JSOA 1IDYA 3ABLH 4U0YA 2ESNA 3B73A 3W2AA 1KZHA 2ELJA 4OINF 4G7OF 2R93J 1P9QC 2CH0A 3QWLA 4GFBA 2OPTA 2YSRA 1FTZA 3I3LA 5JLXA 3F8NA 2O03A 1D0ZA 4WWCA 2XAUA 3BZ6A 4RMNA 3OYMA 3SQNA 1I1GA 4U75A 2BY0A 5JR3A 5CDVA 4HXXA 4BXFA 1Z7UA 2GA1A 2P5VA 4YIFA 3LSIA 1FP2A 4D5FA 1ON1A 4PK4A 3MQ0A 4CHUA 2DQLA 3M8FA 1B59A 1TBXA 2K4BA 2NS0A 4XRFA 1FEXA 3CCYA 3GFIA 5J1UA 1IXCA 4W97A 2H1KA 3M7GA 3CP2A 1PP8F 2RNJA 2E35A 1SAUA 2WB1A 4WCGA 1VQNI 3GLXA 3DFGA 2K9SA 4Z6YA 4E70A 1DPRA 5BNGA 4XBFA 4QIWN 5HOOA 2DDAA 2CUEA 2ZMEB 4RAZA 1KU3A 4BHPA 4OMZA 4DYQA 2Z3YA 3HGGA 3IRRA 2H1LA 3CC4I 1A6IA 5LBQA 5F0CA 5DD8A 3W2VA 3GZNB 1CQTA 1TT0A 2KMUA 1QZEA 5J3LA 2Q1ZB 3M3YJ 1A16A 2QKMB 4L5JA 5FRMA 2FF4A 2VBWA 1EF4A 1YRNB 3TDZC 2LF7A 4EJTA 5CVRA 2DFFA 2J5OA 3OYDA 3K6GA 2IAIA 5DYMA 2VI6A 4OAYA 3E5QA 3KZYA 4XICA 3GTPJ 1CHMA 3HOYJ 2DXIA 2GTXA 3REOA 1RR7A 3COAC 3GCMA 3SZGA 1FSHA 2LD5A 1WJAA 3DTKA 4BUPA 2R7UA 1WKMA 4XR6A 3KFWX 1I39A 3MVPA 2EVMA 4J19A 3FWEA 1S6LA 5L3DA 1NG6A 5IP9J 3K1PA 2EILH 1ERDA 2IA0A 2JZYA 5LHHA 4IRIA 2Y2ZA 4PJMA 1AA7A 3EUAA 3DU5A 3PQKA 4ZC3A 1MKMA 4U88A 5FKOA 1X4OA 4AVZA 1FIAA 5K5QA 2QWWA 2KZVA 1SFKA 2GU6A 4BHBA 4UV8A 2TDXA 2YU9J 3R4KA 2NOGA 1QPMA 5D6FA 3KLOA 5GP9A 5FROA 1O3TA 4PJ0C 4NNJA 3IKTA 3GO5A 3F23A 5KAIC 4IHVA 5BS6A 3CJTB 1W0TA 1PDNC 3PFYA 3M07A 1MIJA 1IG7A 4ZJZA 3HHHA 3I54A 3E7LA 5DDGA 4E7KA 2DYRH 2JN6A 2VT3A 1XGOA 1MMDA 3EUHA 4FE4A 3MZ8A 1LFPA 3CP8A 2EV5A 4FUKA 4I6ZA 4ESBA 2IRFG 3C1DA 4HOBA 4JX4A 5FKMA 3TBIA 4U71A 2GA2A 3UR3C 1V3FA 3FMSA 2ZFUA 4A0YA 2KDZA 3OYCA 1U5TA 2HQRA 3BZKA 3F8FA 3M1CA 1D0YA 3ZMZA 2VOOA 4PZJA 5KAFC 1MJAA 1FOWA 2OF7A 3S1NJ 5AONA 3D27A 3TB5A 1TNSA 4RGUA 2E5NA 1X58A 3C2GA 4HBLA 3VB2A 2V4JC 5D8LB 1ETYA 1NK2P 1XTAA 3HB9A 2HPMA 4MTEA 4Q5SF 1K6YA 4Y52J 3HTSB 3QU6A 4XRSG 3KP2A 1D1BA 1FYLA 1YTYA 3DEEA 5JI6A 5KCMA 1D3YA 4A93J 2MBFA 3P5JA 3Q3SA 1B9NA 1ZARA 2Y9YA 4D7MA 1XC5A 4IHTA 1Q1VA 2O61A 3KP7A 1WGXA 1YS6A 1EH7A 3OIOA 1LDJA 1S7AA 2XRNA 3AKZA 1MBHA 3F9KA 4DYCA 3I0TA 4LOCA 3ZQFA 3CJNA 1DDNA 2JQ7A 3KP5A 1B1BA 2L2OA 4RA2A 4ZYHA 5C4JJ 2B9SA 2ME6A 3D0SA 2DFIA 3GZ5A 1Z1DA 2B0LA 3OMYA 1ITYA 2DT7B 3AG3H 4B48A 2KRHA 3HPGA 5DV5A 2NNYA 3J81Z 3CF5F 1X1BA 1HLVA 2HXIA 3K4LA 1B72B 1JTXA 5H2FC 2NVYJ 4A5MA 3KEQA 3MAJA 3IU7A 4FLJA 4GGGA 2B63J 2LREA 3LSMA 2KJCA 4FTHA 4EJUA 3ROUA 1TWAJ 3B02A 4XOTA 4UNOA 3OSFA 4UVBA 5LGTA 3K4NA 3BQYA 1FOYA 5GAEJ 4XSXF 4KNYA 1WL9A 2GG0A 2NVQJ 2DI3A 1QGPA 2KJBA 4ZTJA 3OV8A 1WJ5A 2PJRB 4M74A 1BI3A 5CVJA 1P6RA 5FCHA 1SC7A 4CYCB 1BOAA 5IPAA 3NWSA 4KFCA 3FX3A 3CO7C 3H3VK 5EGOA 3CCMI 5K7HA 3OYIA 1W36D 3O8GA 2E2JJ 1J9IA 4CICA 1XSXA 2XUBA 1AWCA 1G2HA 3WTSC 3RJPA 1XG1A 1VQ7I 3DKYA 2KQRA 2MA3A 5L3BA 2R7XA 3PJRA 1PUFB 4PSXA 2JRMA 3ZGKA 3FKIJ 2TRTA 1FX7A 2LDUA 2VQCA 4I0BA 1D1AA 4HF0A 3H35A 2DYSH 3L9FA 4G6DA 4MFEA 5DM6F 3ZRGA 1OYIA 1OJLA 4NUBA 4BJ5C 5EDNA 2E2IJ 5C4XJ 3HSEA 2X1DA 1U2WA 2KKOA 3LSHA 1UCRA 4A3CJ 1S72I 3OYBA 1STZA 3FBNB 3H9QA 5ILUA 5IOYA 2XC7A 1Y0UA 5FKNA 1SD7A 3WE3A 3FXQA 2WAQA 5GPAA 2X9DA 3DBRB 3HJEA 4A3EJ 2BH3A 1SFEA 1KU2A 4B3AA 5DEQA 4M3FA 1GV2A 4C2MJ 4KM3A 2VJ4A 4PJJA 2DK5A 1FY7A 2FJ1A 2QGUA 1EKEA 4XMYA 2F4OB 5M5WJ 3S3NA 2L5QA 4RB3C 2QQ9A 2L7ZA 2YPRA 4LG0A 4RB0A 1L3LA 1XD7A 5D8KB 1OR7C 1X2NA 2DA6A 4R8HA 3K2ZA 5B1AH 1QPIA 3CC2I 1TW2A 3PUFA 1DUXC 1LB2A 2K3PA 4XOPA 2EIJH 1A36A 1WY2A 1T8IA 3FF5A 2CQNA 1HXDA 2HOAA 3OYKA 1TT5B 2MFZA 1RESA 3ABKH 1W0UA 3BT9A 4BDYA 4Y7NJ 3Q0WA 3M8JA 4PCQA 3ERED 2UZKA 1D5YA 4HDUA 2B3LA 2PJPA 3GTJJ 2IP2A 3AG1H 2OQGA 4U7BA 2E19A 3DLAA 1JKRC 2VODA 1J59A 2XDVA 4IPAA 4N9IA 1MBJA 3T8TA 3S1RJ 4BY1J 1T38A 3OS1A 1VQ9I 4XRMA 1U78A 5GAHJ 1YJ3A 4LMYA 5AIPA 1IV6A 4Y17A 1WJBA 4BY7J 2KDOA 2R4GA 1XN7A 2WC2A 4P55A 3CUQB 2BHBA 5IYDJ 4LB5A 3A03A 1R23A 1HDDC 2IT0A 2IS2A 1NH3A 2XAGA 5LRSA 4ENMA 5LHGA 4II2A 4BHCA 1F43A 1N75A 3K1MA 2RVCA 5B3SH 4NB5A 3WTUC 4IHYA 2X6WA 4GXOA 1JGGA 2DT6A 2K27A 5J4VA 2Q0OA 2XF5A 2WA0A 1FWZA 2YU3A 1MH3A 3DKWA 2X6XA 3HXLA 1QU3A 1WI3A 1ENHA 2K9LA 5DUIA 2L9RA 3FBIB 3GTLJ 1PV9A 1WH7A 1SMTA 2OTJI 2L7FP 4JUQA 1PYVA 4F52A 1MATA 1WJDA 3C2HA 2GLOA 3TW6A 2AO9A 1BIAA 4N4NB 1JGSA 1BC7C 1C22A 5BPIA 2QSHX 4AIJA 3WGGA 2IEKA 4ETSA 2HVQA 4C2UA 3SDBA 2XAFA 2HKOA 4MEYF 2RAEA 2M4KA 4U69A 3DEWA 3H5AA 1VQOI 2IS6A 2LF8A 2GZWA 2GXAA 4A0XA 2CUFA 3HUGA 3OS2A 1P7IA 1I50J 1TNTA 3CDIA 9ANTA 2CSOA 4N9HA 3SFZA 3TOBA 4AIDA 1FZPB 2CW0F 2HOWA 4LGWA 1ZGAA 3MMYB 4A3FJ 2VJ5A 4IHWA 4A3BJ 5JHUA 5IT9K 2CV2A 2JPBA 2IJLA 3PKEA 4PNCA 4ZWOA 3HKZN 1X1AA 5LGUA 2BGCA 4IOAF 1OCZH 3RYRA 1YE9A 4YEJA 1LFUP 1R5GA 3VYRB 2IGNA 3WTZA 3QYEA 4MNUA 1O0XA 5E5BA 1TC3C 3JAMK 4WK8F 2EINH 5CYVA 3F21A 2OCCH 4U6ZA 3QP6A 2OZUA 3E1SA 2EQRA 4JX6A 1IN5A 3K4MA 3KX2A 4E4HA 2MD5A 4HSRA 3I55I 5CVIA 3GTQJ 4L9TA 3E6CC 3OL4A 4M6YA 1W36C 1J7KA 4BYYA 1ORKA 1VQMI 1WH5A 2EBIA 4S04A 1W5TA 2XIGA 2VC1A 3CLOA 5JVTA 3S1MJ 1ETWA 3HOUJ 1S5LC 3CDHA 4WXHA 1RPWA 5KK1A 2GOXB 2Y31A 1MD0A 1TP4A 4PSWA 4XK4A 1F36A 2XAQA 1F9NA 2E2HJ 5FLXZ 2MGQA 4Q47A 5EF6A 3CC7I 2ZB9A 1B8IA 1Z3XA 4IZZA 2XKOA 4ASNA 3AAFA 2P6TA 2NQ7A 2BV6A 1C23A 2WB1N 4AM3A 4EJWA 5EZGA 4DYRA 3N4MA 1G3TA 4ZNGA 3GTGJ 2CU7A 2DPDA 2IS4A 1G3YA 2JT1A 3TW7A 2X4HA 3U1DA 3RKQA 4BQAA 2E36A 2EZHA 2ZCWA 4UB8C 5CLSA 1MBGA 4UHTA 4CCLA 3HPHA 4CCKA 1Z21A 1R49A 1E0EA 4O3MA 4U1BA 1ZH5A 2XGEA 3KEYA 4RDUA 1WHUA 2W1OA 2JA6J 4N0BA 4JOMA 2W25A 3RCOA 5LEJA 4M6XA 3LAJA 2ZXIA 3HTUA 4YG2F 3U9GA 2Q94A 2YUSA 2V6EA 5EJCA 5HLTA 5D5VB 3JW4A 2JA5J 4QR8A 2RQPA 2HTSA 1BR1A 3J80Z 3FXMA 3EETA 2VBXA 3QU3A 3ULQB 2KPMA 2NAZA 3EQLF 2R7WA 2XASA 3M1EA 3RZDJ 4II3A 3JR9A 3L2VA 3GTOJ 1VFCA 2GZ5A 4NDLA 2CMPA 4PDKA 3DU6A 3K70D 2ICWG 1FOXA 3RORA 2ZNYA 4MGRA 3BDDA 4RLFA 2V3XA 1W7PB 3KETA 4DQ2A 1SANA 4BACA 3TOAA 2NOJB 4O6JA 2XAJA 2V9KA 4G94A 4X0GA 3RI4A 1KYZA 1BI2A 3S8PA 4RZYA 4B44A 1UFMA 2ZXWH 3WHBA 1MZBA 3QOEA 4C30A 2A07F 3GMEA 1YG2A 1T6SA 4UVCA 2MD0A 3O8HA 1Q1HA 2F5VA 2V9VA 2RGVA 1YIOA 2UV1A 2COBA 1Y0NA 3KLNA 2W24A 3C18A 2PLYA 5EEGA 4B43A 4FLLA 2GG2A 2XRLA 4IDYA 4EMSA 4ZYEA 3GTMJ 1OLTA 4NQWB 3I58A 2O0YA 1QHGA 1P2FA 3BP8A 2ISZA 4F3QA 2EFNA 1JUMA 2YX4A 3HOWJ 3IWZA 1BW5A 4X1EA 3SJMA 3PSFA 4CH7A 2XAHA 2LBFB 3TQNA 3ECHA 4XKBA 1BJZA 1XGMA 1FSEA 4BU2A 1C0WA 1G8XA 3NRVA 2QYOA 4U87A 3M4OJ 2Q93A 1SEUA 3V4GA 2LKPA 3FMQA 1JT6A 3O3KA 2R5ZB 3DEUA 2VBZA 1ZYRF 2O6GE 2MYSA 3A2KA 4FT8A 4HEA2 1BR4A 1Y6IA 2VXDA 4LLLA 3CO6C 4B47A 1A5JA 2DMPA 2GGBA 3L2WA 1S29A 5E3OA 2VL8A 5F1JA 3Q5FA 2ZMEA 1MW7A 2QQ8A 4XKWA 5F64A 3T5XA 2QF7A 3CZ6A 4PFOA 2M0CA 4A3JJ 4KA4A 4EGYA 3CB6A 2EFPA 2VJJA 4Y4RA 3A01B 1WJFA 2VT2A 4CYDA 2JTVA 4S01A 4CUGA 4EM2A 3BJAA 2IS1A 3K0LA 3HOZJ 1YW9A 4A3LJ 3FXRA 4FE7A 4M9XA 1UAAA 1MNEA 1B9MA 1NG7A 2PMUA 3H9GA 4ZZDA 1JJ8C 1YRNA 1RI7A 2DQRA 1GUUA 2R7ZJ 4FASD 3JRHA 3OYFA 3PKDA 2VKVA 4OIQF 2DO7A 2XV4S 2R7SA 1QRYA 4QTRA 2GOMA 1WI9A 3K1NA 3I53A 2F2EA 4R1HA 2HQNA 2X85A 5IY5H 2XVCA 1HOMA 4IKSA 5CDEA 1N25A 1IC8A 4FKCA 4HZFA 4BBSJ 2R7VA 2CRGA 2XF6A 2OUMA 4AC0A 4AVPA 3LL7A 5HS9A 2BY1A 2K40A 4UXNA 4BS9A 1R9TJ 3VOEA 3TO6A 2STWA 1I3AA 2GQQA 4DBQA 1IJWC 2E7WA 2RNGA 2DMNA 3H1CA 5HVQC 3MKZA 1MSEC 2DMUA 4MO7A 4HF2A 4XLFA 3OIQA 1OMIA 3JRCA 3NWTA 3KCCA 1LNWA 2R7TA 2DA3A 1MH4A 1R00A 2KP6A 3ZN0A 1IN6A 4EV0A 5CQGA 2QKLB 5DUKA 2PQ8A 4ZDOA 5F04A 4IF4A 4XKVA 3DV8A 2L54A 4M6VA 3NAUA 4EATA 4PJNA 2VB6A 1BIBA 1JHFA 4CZZA 4KN4X 4FHTA 4CXFA 1TWCJ 2FSWA 2E34A 1FBSA 2PMHA 2WV1A 4XONA 3DQVC 1F1ZA 1W5SA 2WAEA 3VYTB 1J09A 2VLAA 3PKBA 1BJAA 3BJOA 2GG8A 2XGDA 5J4YA 1HDPA 4MATA 4IF7A 5EZHA 5L3EA 3SDGA 1BC8C 1D1CA 5J8CA 1ZRDA 3CTAA 1KYWA 5GAGJ 3S6BA 4ABZA 1O3QA 4YRVA 2KL4A 2HFHA 4AUXA 1TQMA 1HCRA 3FXOA 4HNTA 2VKDA 4ZTFA 1KU7A 2QQAA 2CS3A 1R4NB 5GTHC 3BTCA 3HOSA 1JUPA 1KQ8A 5DCMB 3ZQGA 2QA4I 4CSWA 1MNMC 3TO9A 5HNHA 2A69F 3KYCB 1H0MA 2HDCA 2OTLI 4KYWA 3RSNA 3BR3A 2N8GA 3KIOA 5IYCJ 1E2XA 3CQZJ 4L5EA 1ONVA 2K4JA 3IG4A 1IN4A 3W3CA 2R7FA 3ESWB 3V7SA 4KIFA 4G8XA 2ZSHB 3H0GJ 3OSGA 1JUSA 4ZZLA 1WCMJ 1T0FC 2BE5F 4LLNA 2CW7A 2FEZA 4A12A 1SD6A 3BPXA 1D5VA 1WRJA 2MABA 3LA7A 5BMZA 3ZMSA 4ZH4F 1H89C 3HIFA 1OCPA 1X4PA 2NRAC 3GWZA 4LD5A 3HG9A 5FKKA 4ESFA 2H8RA 4QWQA 3S3OA 1I27A 4UY8I 4BE1A 4FLKA 1G6NA 2P4WA 3PNVA 2XSJC 3E6MA 1I6HJ 1X1CA 1IRXA 3HGYA 3HOTA 5AIQA 1RZ4A 4I98B 2FA5A 4KIBA 4B28A 1B72A 2WADA 2M4GA 1F5TA 1MMSA 3D5SC 2RN7A 3BR5A 4JP0A 1ZG3A 5J1RA 1MBEA 3CCEI 2ME0A 2XF7A 3DTIA 4OIOF 3E3VA 3LFKA 5E17F 1IV8A 3BCBA 3GFMA 1WPKA 1I5ZA 5KNLA 3WTWC 2NS8A 1J2XA 3EYIA 1VTNC 5TJJA 1S7OA 4IX7A 2PJRA 4CCNA 2JVHA 3IH3A 1B6AA 4U6JA 3BLYA 2HTJA 4M3EA 4CYCA 5FD6A 3H36A 5F0FA 2R7RA 3V8LA 1A31A 2BHYA 5M5YJ 3S2DJ 1OFCX 4EM0B 2QQBA 4BEHB 2A68F 2HI3A 2DPUA 1G4DA 3HRUA 5ICEA 4D1QA 2M30A 2VJIA 3L2QA 1PUFA 4HQEA 2K86A 1YX3A 2HOSA 1UG0A 1UZCA 3LA2A 5F27A 2O8KA 5JVGF 2DFEA 3FIWA 3RQ4A 4F91B 3P9IA 3WG9A 2Y0SA 1EA3A 2E1CA 3IU8A 4OWRB 1LQ1A 2HYGD 2IW2A 3FK6A 4I99C 2F48A 4M9ZA 1USTA 3S17J 2Z16A 2JSPA 1DU6A 2OD5A 1TQIA 4CCJA 5B1BH 1P4AA 3N05A 1XDSA 1HW1A 3V42A 4Y13A 4BH9A 2HR3A 1SMYF 4FLIA 3SEZA 4FQGA 2NNNA 2LVSA 3ZQIA 1LPQA 1T98A 4RGZ1 1U8RA 3QPSA 2LTPA 4IRGA 2MG4A 1E3HA 1TW3A 2CGPA 3LQQA 2WY8Q 1O57A 2CUJA 2FQ3A 3RDIA 4J01A 4U6EA 1P4XA 2DLLA 4ZYGA 2X0LA 4XL9A 4RM2A 3V7RA 1ZAOA 4AYBA 1Y1WJ 3N97A 1VQPI 3WTYC 1IRGA 2DK8A 4CDGA 1SD5A 3TP3A 3DBHB 4K2EA 5DCFA 5D4RA 4A3IJ 2YR2A 6PAXA 2V6CA 2Z5UA 3L1PA 1W2MA 1ZKGA 1WVRA 4FCYA 2K7LA 2W82A 2L9VA 4IOCF 3LOCA 2LKXA 3QRFF 4FISA 2QZ8A 2VN2A 3E5XA 2Z33A 2Y48A 4KMUX 4D0PA 1B4AA 1DP7P 1VQKI 3ZMUA 2OBPA 2A61A 2KLOA 2HEOA 1OYYA 3R0JA 2PMZN 3W2WA 3MD2A 4G6QA 1I6XA 3ZR8X 1YO5C 4BJTA 5K5RA 5E3NA 2NYXA 4CZCA 3CUQA 4IO9F 1CF7A 2DFHA 5DM7F 4AIKA 1U8BA 4ZWPA 1SFXA 2L0KA 3LSGA 4DBRA 4B4CA 2WY7Q 2R5YA 1IZ1A 1UHWA 4V2GA 4XQFA 1S7EA 2QBYB 2FD5A 4OOIA 3BTLA 4EVIA 4G12A 2VPLA 1Z7LA 3BG3A 5K7FA 1DQUA 2NVTJ 4LITA 1A04A 3ZCOA 1MGTA 2BB7A 1H9GA 3E0JB 1XPXA 4RB2C 3WHCA 3GF2A 4M3GA 2WBMA 3QODA 3L2UA 3OYJA 5E3LA 5D5UB 2VC0A 5E1WA 5IT9Z 4DW6A 2BW3B 2EFWA 2OC6A 2DA1A 2X51A 2CW8A 4M3BA 1Y1VJ 2VOPA 3MN2A 4M72A 3EPZA 3VYUB 3MX6A 3JRBA 1WQ2A 2EB7A 3DXJF 5LGNA 4A3MJ 3OOUA 2DA4A 1YITI 3JRDA 4HRIA 5D5XB 3HRTA 1YIJI 1X19A 4HSTA 3PIPF 2HZDA 4BQQA 1RKTA 3QOPA 5HLHA 3GFLA 2K9MA 3A0HC 1T2KA 1GHCA 1R58A 2DOAA 4PFPA 3B6CA 1WN1A 3D5LA 2BXYA 4DJAA 4PGGA 3RVAA 5HODA 3IUOA 4Z2YA 1XB4A 3FMRA 3K9TA 2A05A 1OYWA 3ASOH 1YYVA 4U73A 3GX4X 3G1OA 3I4PA 3J81K 2HVRA 3T8RA 3IC7A 1W5CC 1GXQA 4S00A 5ILSA 2CQQA 2JPCA 3TO7A 4A6DA 2E5ZA 1YX5A 2B3KA 2BYVE 5GADJ 4BL0B 2AXLA 5E3MA 5K5OA 1LE8B 3QPTA 1BOBA 2WV0A 5CJ9A 3QAHA 2LG4A 1K7AA 2LY1A 2H6CA 3WODF 3FZVA 5C3EJ 2Y75A 4BBRJ 5CVUA 4IL6C 4E7IA 2I5UA 1PVEA 4PV4A 1AU7A 1Y1NA 2HOTA 4RGXA 4AWXB 1N77A 5M5XJ 4E7ZA 1H9TA 2CJJA 1EV7A 4BQOA 2P8TA 5TISC 4UUVA 4RB1A 2P7VB 1R1TA 2GG3A 4OU0A 3CLQA 1HBXG 2BBYA 3OYAA 3BQZA 1A6QA 3E5UA 4Q4ZF 1OKRA 1YW8A 1QXZA 1DGWY 3I71A 3DKXA 3DPLC 3KZIC 2M9HA 4YELA 2NVXJ 4OMYA 2M87A 4KDPA 2OAZA 4PUSA 4H4KC 2W00A 3HRSA 1R5HA 2M2EA 4S0HB 1IF1A 2TCTA 3IH4A 5HNFA 4G7HF 3RTRA 1I3QJ 4YFXF 1XGSA 3H0DA 5E1ZB 3U2RA 1Y8RB 5KHDA 2V1DA 2BHZA 4D7NA 4XSZF 3L7GA 4WXCA 3OY9A 5E1XA 4A3KJ 1Z6RA 4R79A 4BDZA 4KISA 1VI0A 1TWFJ 3Q9VA 5JFRA 5CE6A 1FBQA 1NHAA 3IRQA 2R7OA 1MDMB 2LR8A 2MLGA 1PP7U 2ZXHA 3F8BA 3HEFA 4LIVA 1OCRH 2YS9A 3LNQA 2P6SA 2Y30A 1LFBA 1VQ5I 2CWEA 3CCLI 1BW6A 1T95A 3K4KA 3L2RA 2ZBKA 3JRGA 4N4OB 3GXOA 2HQAA 4MEXF 1D8JA 3E6BA 3DLLF 5HDNA 3OOPA 1P4WA 1XDUA 1Y8QB 2HS5A 1JT0A 3PQJA 1XSVA 3H5RA 2RDPA 5GTIC 3P9CA 1Z9CA 2PFBA 1BR2A 2MATA 5D6EA 1RRJA 1G3WA 2R0QC 1UHMA 3NEUA 4U70A 2O7OA 1W7PA 3RPQA 1WSUA 3ZPLA 4XNFA 3RQIA 5IP7J 3FXJA 4HAMA 3ZP5A 5BPDA 4U6WA 3FDYA 2AHQA 5HS8A 3G6EI 2FMYA 3C2BA 5BQTA 5ED4A 4C2TA 2MH2A 3WU2C 3LWFA 3PFIA 2A3SA 3C7JA 2HOEA 3BG9A 2BY3A 3HM5A 4QPOA 3I59B 2KIMA 1MMGA 1VNDA 2DT5A 3RYPA 2FMLA 3GBGA 4HX8A 3MATA 1K83J 3W6KB 4A6EA 3GYHX 1QQIA 1JE8A 4FO7A 2ZXJA 4NQWA 3LSJA 3CTZA 3OYLA 2ETHA 4FX0A 5LHIA 1X3UA 2L4AA 2LK2A
chains in the Genus database with same CATH topology
1TLHB 2Y0MA 4HW0A 3KP4A 2ISYA 3L7WA 4R60A 3ZMDA 1U5TC 1TQPA 2CQKA 2W85A 4LK0F 3TAVA 2ZKZA 2PI0A 1HSTA 3WGHA 3NQOA 2GG5A 1ZRFA 2A6EF 4IKRA 5HS7A 2M5WA 4DNCA 1J5YA 4I02A 1ZREA 1V4RA 1BM9A 1K6OA 5L3FA 4WX9A 1QXYA 3BPVA 2V1UA 1FLIA 2EA2A 3DPTA 1TTYA 3ECOA 1RUOA 2ZFWA 5A2QK 5F1RA 4LFUA 1K78B 3WTVC 2L3DA 1WL6A 3Q9SA 2VE9A 1BI0A 5FD5A 1LDDA 4BNCA 3FXUA 4M73A 2GIVA 2QLZA 4I7HA 4L0ZB 2P99A 3BITA 1ZHFA 2LNBA 3G73A 2P7CB 4JQFA 2UXNA 3F6OA 2G6PA 5J6XA 5FB2A 4WF2A 2Q95A 4MQVA 2MLKA 5HLIA 3LQRA 2EFOA 4U76A 3TGNA 2IW5A 1OR7A 2EK5A 1WWXA 2W84A 1LEBA 4UVAA 1Z91A 4EGEA 4M9SA 3J7AO 2V1XA 4ON0A 4A0ZA 5J8FA 2FBHA 3WGIA 3GVAA 4M71A 4S2RP 2OU2A 2EV6A 3IU9A 1G3SA 1HKTA 3JSPA 2BN7A 1YW7A 4A6WA 5D4SA 1O7LA 1GXPA 1ULYA 2ZSGA 5DCMA 1MJ9A 4IVNA 4HX4A 1R36A 3L24A 1SAXA 2UXXA 3V8JA 1P92A 3Q6DA 1O3RA 2BWVA 4HDVA 3PKCA 3J80K 3QP5A 2ELHA 2D2WA 1R1VA 2ZO4A 5L3GA 5FFZA 2HZTA 3GFJA 4YIIA 1MJBA 3KZZA 5ICGA 2RC4A 2LSOA 2VBYA 2GG7A 4KIGA 2BWTA 2COMA 3O6BB 2JRTA 1ZN2A 4GYGA 2XGXA 1R22A 4P9FA 4HQMA 2GXBA 2P5KA 2GGCA 1WBQA 4U6CA 4WXDA 2EJRA 5IT3A 4KUMA 4HYEA 1FP1D 3P9KA 4H0EA 1USSA 1ZLKA 1LVAA 3ABTA 4RZZA 4ESJA 5E8IA 1PUEE 1LEAA 2QVOA 3KP6A 4LK1F 3HYIA 1LDKB 5LRRA 1N51A 4NHJA 4I09A 2MH9A 2OA4A 3L00A 4XLPF 4BXUA 2KRFA 2W57A 2STTA 4L9VA 1O3SA 4KN7X 2Z99A 4IHSA 2B3HA 3PKAA 2FNPA 3RKXA 2F5CA 4FX4A 5FCFA 3RIRA 2V3ZA 3M9AA 4L9JA 2VE8A 3WTXC 2D1VA 3F72A 3F8MA 1S8NA 5FFXA 4L0YB 2KIFA 4A2UA 2IPQX 5CIKA 3R60A 1XNZA 5CNXA 3BIPA 1IN7A 4O5VA 1QO0D 2K02A 2Q96A 4G9YA 2O8XA 4JBAA 1O7FA 4Y15A 1CGPA 2G7UA 3MZYA 4IRHA 2V3YA 3ZMVA 1FPQA 2D45A 4OOKA 1XMAA 1YFHA 4A5NA 4IKTA 2GU4A 2G9WA 2L02A 1DPUA 2CO5A 3GEZA 5HDGA 2HWVA 3R61A 3MEXA 1U3EM 2HYFA 5ICFA 3F22A 3BY6A 3HSFA 5E20A 2OZ6A 2QBYA 4IJAA 1SD4A 3ZQ7A 1KGSA 2A5YB 4Q48A 3WU1B 1ZGJA 4RS8A 3VEPA 3MZHA 4LLGF 1IXRC 3GW2A 3HHGA 4B8XA 5BOXA 2F5FA 3KEOA 2EFQA 4RGRA 2DBBA 5H6QA 1IN8A 1XCBA 4HLYA 2ZJ2A 1KQ9A 4HF1A 1XSDA 4ENKA 3MR1A 3LAPA 1FOKA 3ML6A 4HA8A 2PG4A 2O3FA 2IA2A 3V7CA 4ZYDA 2FE3A 2OKNA 4EGZA 3F6VA 2XKPA 3S2WA 3SZPA 3F3XA 1U5TB 1J0RA 3FHZA 4TV7A 3E97A 1HKQA 4BAYA 1D8KA 1KA8A 2QM3A 3LSTA 1R7JA 1HQCA 2J5PA 4EQQA 4ZWUA 1F4KA 2HGCA 4OIPF 2VXZA 5H6RA 3TKYA 1C27A 2GWRA 1EH8A 4MQ9F 1QZZA 1HW5A 2DU9A 2E1NA 3T0YA 5LLQA 4JK1X 2P9AA 1RNLA 2E7XA 2R3SA 2ZNZA 2FBKA 2ADUA 5DD4A 2XHKA 4YFNF 2Q92A 1KQ0A 2H6BA 1JAWA 1R1UA 3ZN1A 1FC3A 3I5UA 2FOKA 4P96A 1U6GA 2BWWA 5HDKA 4EJOA 1S3JA 4RAYA 3JAMZ 2EVCA 3WTTC 2BEOA 2M45A 5LEKA 4LB6B 3VFZA 3RPUA 2GU7A 3H3UA 4I0AA 3W6JB 2GXGA 1IAWA 3JTHA 4RGSA 4ENJA 1C21A 5K1YA 1IW7F 3CB5A 2RV8A 2V79A 3MCZA 3I64A 1MDMA 2P98A 2F5DA 3MWMA 1W4MA 3HRMA 3ISPA 4F7ZA 3BIQA 2FBIA 3O2PE 3IKVA 4GO1A 1C24A 5ERIA 1QXWA 2M1BA 4ENNA 1RUNA 3IWFA 4XLNF 5F6FA 5E18F 2D1HA 2WWYA 1CF7B 3MFKA 1BN5A 3FM3A 2IVMA 2EV0A 2M8EA 2BHCA 2A6HF 4MTDA 4HV5A 1ZLJA 3EDPA 2L4MA 1T0FA 3DP7A 2PN6A 2Z9OA 5E8GA 4KMFA 5KVRA 2CFXA 4EJVA 1K79A 3I59A 2GU5A 3FM5A 2BHDA 3IL2A 4LG0B 1ZRCA 2Q8KA 5EEHA 2DAOA 3C3WA 2CG4A 1JXSA 2GG9A 1HW2A 1OPCA 1IXSB 2H94A 1BBYA 5TRDA 2BWUA 4I2OA 1AOYA 4KT5C 3ELKA 1XCVA 3BWGA 1FT9A 4GCVA 3JTGA 5D5WB 4QLCU 3R6SA 1QNTA 2WTEA 2CYYA 4GYIA 3KE2A 5A2QZ 4I01A 1FYKA 4U7DA 2BWSA 2UWMA 3HSRA 1BI1A 4YFKF 4MHGA 4S2TP 4U0WA 1IUYA 4G7ZF 4L18B 3G3ZA 4CGZA 2JSCA 3SXYA 5CDLA 4IXAA 3RKWA 4PGHA 1WLRA 3ABUA 4IECA 2KIUA 2ACJA 1YLFA 3IHUA 1SFUA 1Z6TA 4LJZF 1K78A 2BWXA 2FXAA 2R7DA 1QZYA 4AD9A 1HKSA 2F5EA 3RKYA 4A6VA 1FBUA 3P7NA 3R0AA 1KP0A 3DF8A 4P5OA 1FNNA 3QPHA 2EVOA 1RIOH 4UV9A 2Q2EA 1UB9A 5CVVA 1FYMA 1GVJA 1ZG5A 1LJ9A 5FGMA 1YS7A 2L01A 5ICCA 4Z7MA 3LA3A 1HSJA 4HLXA 3T1BA 4OIRF 3E6DA 2BWYA 2IA1A 3ZMTA 3EYYA 3BJ6A 1YQAA 4HX7A 5H20A 5FO5A 3L09A 1XMKA 1E17A 2FNAA 1IRFA 2G7HA 1M35A 2BHAA 2EWNA 2OQRA 2C6YA 2FU4A 4L5IA 3BROA 2RKHA 2YX7A 4IKUA 3TDUC 4IU6A 5HLGA 1XGNA 4KICA 1T39A 2QUFA 3GUDA 4U0VA 3GZ6A 4FO8A 1W7VA 4AIHA 2H27A 3K69A 2EA4A 2H09A 1YVMA 2QENA 1ODDA 4S05A 1ON2A 3F8CA 1I1SA 1J75A 1KU9A 4CO8A 2VONA 4EM1A 2NQ6A 5FLXK 3SHFA 4L9NA 2PBIA 2GAUA 4HV6A 3L2CA 1ZG1A 2HKXA 2MC3A 2XROA 3V8KA 1Z05A 2PEXA 3CUOA 1QBJA 1W7PD 3KP3A 3H92A 2DW4A 3WU0A 1REPC 3VODA 1EH6A 1L0OC 2P5LC 3CUQC 2FRHA 2ESHA 2AS5F 3BOQA 4P9UA 2DTRA 3H3ZA 3M8EA 5ILVA 3SZTA 4B09A 5L3CA 1JHHA 3WE2A 3JSOA 4U0YA 2ESNA 3B73A 4G7OF 4OINF 2YSRA 3F8NA 2O03A 4WWCA 3BZ6A 3SQNA 1I1GA 4U75A 5JR3A 5CDVA 4HXXA 1Z7UA 2GA1A 2P5VA 4YIFA 1FP2A 1ON1A 3MQ0A 4CHUA 2DQLA 3M8FA 1B59A 1TBXA 2K4BA 2NS0A 4XRFA 3GFIA 1IXCA 3M7GA 1PP8F 2RNJA 4WCGA 3GLXA 3DFGA 4E70A 1DPRA 4XBFA 5HOOA 2ZMEB 4RAZA 1KU3A 4BHPA 4OMZA 2Z3YA 3IRRA 5LBQA 5DD8A 1A16A 4L5JA 2FF4A 2VBWA 3TDZC 2LF7A 4EJTA 5CVRA 2J5OA 5DYMA 3E5QA 3KZYA 1CHMA 2GTXA 3REOA 3COAC 1FSHA 1WKMA 3KFWX 2EVMA 3FWEA 1S6LA 5L3DA 3K1PA 2IA0A 2JZYA 5LHHA 4IRIA 3PQKA 1MKMA 4U88A 5K5QA 2QWWA 2GU6A 4BHBA 4UV8A 2TDXA 3R4KA 1QPMA 5D6FA 3KLOA 1O3TA 3IKTA 3GO5A 3F23A 5BS6A 1PDNC 3HHHA 3I54A 5DDGA 2VT3A 1XGOA 3EUHA 2EV5A 4FUKA 4ESBA 2IRFG 3C1DA 4HOBA 4U71A 2GA2A 1V3FA 3FMSA 4A0YA 1U5TA 2HQRA 3F8FA 3ZMZA 2VOOA 4PZJA 1MJAA 5AONA 3D27A 3TB5A 1TNSA 4RGUA 4HBLA 3VB2A 5D8LB 4MTEA 4Q5SF 3HTSB 3QU6A 3KP2A 1FYLA 1YTYA 5JI6A 1D3YA 2MBFA 1B9NA 1ZARA 4IHTA 2O61A 3KP7A 1YS6A 1EH7A 1LDJA 1S7AA 2XRNA 3I0TA 3CJNA 1DDNA 3KP5A 1B1BA 4ZYHA 3D0SA 2DFIA 3GZ5A 1Z1DA 2B0LA 5DV5A 2NNYA 3J81Z 4A5MA 3KEQA 3MAJA 3IU7A 4FLJA 4GGGA 2KJCA 4EJUA 3ROUA 3B02A 4UNOA 4UVBA 5LGTA 4XSXF 4KNYA 1WL9A 2GG0A 2DI3A 1QGPA 2KJBA 3OV8A 4M74A 1BI3A 5CVJA 1P6RA 5FCHA 1BOAA 4KFCA 3FX3A 3CO7C 1J9IA 4CICA 1XSXA 2XUBA 1AWCA 3WTSC 3RJPA 2MA3A 5L3BA 1FX7A 2LDUA 4I0BA 4HF0A 3L9FA 4G6DA 1OYIA 3HSEA 1U2WA 2KKOA 1UCRA 1STZA 5ILUA 1Y0UA 1SD7A 3WE3A 3FXQA 2BH3A 1SFEA 1KU2A 5DEQA 4KM3A 2DK5A 1FY7A 4RB3C 2QQ9A 2YPRA 4LG0A 4RB0A 1L3LA 1XD7A 5D8KB 4R8HA 3K2ZA 1TW2A 1DUXC 1LB2A 1WY2A 3FF5A 1HXDA 4PCQA 2UZKA 3ERED 4HDUA 2B3LA 2PJPA 2IP2A 2OQGA 4U7BA 2VODA 1J59A 4IPAA 4N9IA 3T8TA 1T38A 1YJ3A 1U78A 4LMYA 5AIPA 4Y17A 1XN7A 2WC2A 4P55A 3CUQB 2BHBA 4LB5A 1R23A 2IT0A 2XAGA 5LRSA 4ENMA 5LHGA 4BHCA 3K1MA 2RVCA 4NB5A 3WTUC 4GXOA 2K27A 2Q0OA 2YU3A 1FWZA 3DKWA 5DUIA 1PV9A 1SMTA 4JUQA 1MATA 1BIAA 1JGSA 1BC7C 1C22A 5BPIA 4AIJA 3WGGA 4ETSA 2XAFA 2HKOA 4MEYF 4U69A 2LF8A 2GZWA 4A0XA 3HUGA 1TNTA 2CSOA 4N9HA 3SFZA 3TOBA 1FZPB 2CW0F 2HOWA 4LGWA 1ZGAA 5JHUA 5IT9K 2JPBA 2IJLA 3PKEA 4PNCA 4ZWOA 5LGUA 2BGCA 3RYRA 1R5GA 3WTZA 4MNUA 1O0XA 5E5BA 3JAMK 4WK8F 5CYVA 3F21A 4U6ZA 3QP6A 2OZUA 1IN5A 2MD5A 5CVIA 4L9TA 3E6CC 4M6YA 1J7KA 4BYYA 4S04A 1W5TA 2XIGA 2VC1A 3CLOA 5JVTA 3CDHA 4WXHA 5KK1A 1MD0A 2XAQA 1F9NA 5FLXZ 4Q47A 2XKOA 4ASNA 3AAFA 2P6TA 2NQ7A 2BV6A 1C23A 4EJWA 3N4MA 1G3TA 4ZNGA 2DPDA 1G3YA 2JT1A 2X4HA 3U1DA 4BQAA 2ZCWA 5CLSA 4UHTA 4O3MA 4U1BA 1ZH5A 4N0BA 5LEJA 2W25A 4M6XA 3LAJA 3HTUA 4YG2F 3U9GA 2Q94A 5D5VB 3JW4A 4QR8A 2RQPA 2HTSA 3J80Z 3EETA 2VBXA 3QU3A 3ULQB 2NAZA 3EQLF 2XASA 3M1EA 2GZ5A 4PDKA 3RORA 2ZNYA 4MGRA 3BDDA 2V3XA 1W7PB 3KETA 4DQ2A 3TOAA 4O6JA 2XAJA 4G94A 3RI4A 1KYZA 1BI2A 4RZYA 1UFMA 1MZBA 2A07F 1YG2A 1T6SA 4UVCA 1Q1HA 2V9VA 2RGVA 1YIOA 3KLNA 2W24A 3C18A 2PLYA 5EEGA 4FLLA 2GG2A 4IDYA 4EMSA 4ZYEA 3I58A 2O0YA 1P2FA 3BP8A 2ISZA 2EFNA 2YX4A 3IWZA 2XAHA 3TQNA 3ECHA 1XGMA 1FSEA 1C0WA 3NRVA 2QYOA 2Q93A 3V4GA 2LKPA 3FMQA 3O3KA 2O6GE 3DEUA 2VBZA 1ZYRF 4FT8A 4LLLA 3CO6C 2GGBA 1S29A 3Q5FA 2ZMEA 5F64A 3T5XA 4KA4A 4EGYA 3CB6A 2EFPA 2VT2A 4CYDA 2JTVA 4S01A 4EM2A 3BJAA 3K0LA 1YW9A 3FXRA 4M9XA 1B9MA 2PMUA 4ZZDA 1RI7A 2DQRA 3PKDA 4OIQF 2DO7A 2XV4S 1WI9A 3K1NA 3I53A 2F2EA 4R1HA 2HQNA 2XVCA 4IKSA 5CDEA 4FKCA 4HZFA 4AVPA 5HS9A 4UXNA 3VOEA 3TO6A 2STWA 2GQQA 2E7WA 5HVQC 4HF2A 1OMIA 3KCCA 1LNWA 1R00A 3ZN0A 1IN6A 4EV0A 5DUKA 2PQ8A 4IF4A 3DV8A 2L54A 4CZZA 1BIBA 1JHFA 4KN4X 4FHTA 4CXFA 2FSWA 1FBSA 2PMHA 3DQVC 1F1ZA 1W5SA 3PKBA 1BJAA 3BJOA 2GG8A 4MATA 4IF7A 5L3EA 1BC8C 5J8CA 1ZRDA 3CTAA 1KYWA 3S6BA 1O3QA 2HFHA 1TQMA 1KU7A 2QQAA 3HOSA 1KQ8A 5DCMB 3TO9A 2A69F 1H0MA 2HDCA 4KYWA 1E2XA 1ONVA 2K4JA 3IG4A 1IN4A 2R7FA 3V7SA 4KIFA 4G8XA 4ZZLA 4LLNA 2BE5F 2FEZA 4A12A 1SD6A 3BPXA 1D5VA 1WRJA 3LA7A 5BMZA 3ZMSA 4ZH4F 3HIFA 2NRAC 3GWZA 4LD5A 4ESFA 4QWQA 1I27A 4FLKA 1G6NA 2P4WA 3E6MA 3HOTA 5AIQA 1RZ4A 4I98B 2FA5A 4KIBA 4B28A 1F5TA 2RN7A 1ZG3A 4OIOF 3E3VA 3LFKA 5E17F 3GFMA 1I5ZA 3WTWC 3EYIA 1J2XA 1VTNC 5TJJA 1S7OA 4U6JA 1B6AA 2HTJA 5FD6A 3V8LA 4EM0B 2QQBA 2A68F 2DPUA 1G4DA 3HRUA 5ICEA 2M30A 4HQEA 2K86A 3LA2A 3P9IA 3WG9A 2E1CA 3IU8A 1LQ1A 2HYGD 2IW2A 4M9ZA 1USTA 2OD5A 1TQIA 1P4AA 1XDSA 1HW1A 4Y13A 4BH9A 2HR3A 1SMYF 4FLIA 2NNNA 1T98A 4RGZ1 1U8RA 4IRGA 1TW3A 2CGPA 3LQQA 3RDIA 1O57A 2FQ3A 4U6EA 1P4XA 2DLLA 4ZYGA 2X0LA 3V7RA 1ZAOA 3N97A 3WTYC 1IRGA 2DK8A 4CDGA 1SD5A 4K2EA 5DCFA 5D4RA 6PAXA 2YR2A 2V6CA 2Z5UA 1W2MA 2K7LA 3QRFF 2QZ8A 2VN2A 3E5XA 2Z33A 2Y48A 4KMUX 4D0PA 1B4AA 1DP7P 3ZMUA 2OBPA 2A61A 2HEOA 1OYYA 3R0JA 4G6QA 1I6XA 1YO5C 5K5RA 2NYXA 3CUQA 1CF7A 4AIKA 4ZWPA 1SFXA 1IZ1A 1UHWA 2QBYB 4OOIA 4EVIA 1A04A 1MGTA 2BB7A 1H9GA 4RB2C 3GF2A 5D5UB 2VC0A 5E1WA 5IT9Z 2EFWA 2VOPA 4M72A 3MX6A 1WQ2A 2EB7A 3DXJF 5LGNA 5D5XB 3HRTA 3QOPA 5HLHA 3GFLA 1T2KA 1GHCA 1R58A 1WN1A 3D5LA 4PGGA 3RVAA 4Z2YA 1XB4A 3FMRA 3K9TA 1OYWA 1YYVA 4U73A 3GX4X 3J81K 3I4PA 3T8RA 3IC7A 1GXQA 4S00A 5ILSA 2JPCA 3TO7A 4A6DA 2B3KA 2BYVE 2AXLA 5K5OA 3QPTA 5CJ9A 2WV0A 3QAHA 1K7AA 2H6CA 3WODF 3FZVA 2Y75A 5CVUA 4PV4A 1Y1NA 4RGXA 4AWXB 1H9TA 1EV7A 2P8TA 4UUVA 4RB1A 2P7VB 1R1TA 2GG3A 4OU0A 1HBXG 2BBYA 3E5UA 4Q4ZF 1OKRA 1YW8A 1QXZA 3I71A 3DPLC 4OMYA 2M87A 4KDPA 2OAZA 3HRSA 1R5HA 1IF1A 4G7HF 3RTRA 4YFXF 1XGSA 5E1ZB 3U2RA 2V1DA 4XSZF 3L7GA 4WXCA 5E1XA 1Z6RA 4R79A 3Q9VA 5JFRA 5CE6A 1FBQA 1NHAA 3IRQA 1MDMB 2MLGA 1PP7U 3F8BA 2P6SA 2CWEA 2ZBKA 3GXOA 4MEXF 1D8JA 3E6BA 5HDNA 3OOPA 1P4WA 1XDUA 2HS5A 3PQJA 1XSVA 2RDPA 3P9CA 1Z9CA 2PFBA 2MATA 5D6EA 1G3WA 1UHMA 3NEUA 4U70A 1W7PA 3RPQA 1WSUA 3ZPLA 4HAMA 3ZP5A 5BPDA 4U6WA 5HS8A 2FMYA 5BQTA 5ED4A 2MH2A 3LWFA 3PFIA 2A3SA 3C7JA 2HOEA 3I59B 2KIMA 2DT5A 3RYPA 2FMLA 4HX8A 3MATA 3W6KB 4A6EA 3GYHX 1QQIA 1JE8A 4FO7A 2ZXJA 4NQWA 3CTZA 2ETHA