1XGNA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
b'MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 93
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgnA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgnA01
4M9SA 4I02A 2BWWA 2P6TA 4B09A 1YQAA 5FCHA 3SZPA 3SXYA 2VE8A 1E2XA 4AVPA 3JTGA 4L9JA 1G3SA 1P4AA 1R5GA 1O3SA 1N51A 2GZ5A 1GXQA 5K5OA 1Z7UA 1QNTA 3M7GA 4OMYA 4FLKA 2ZNYA 4EJTA 2F5EA 4EMSA 3FXQA 3L00A 1IUYA 4EQQA 2EFPA 2UXNA 2CG4A 3O3KA 2WV0A 2FRHA 2CGPA 2K86A 2ZKZA 1XDUA 2LNBA 4HXXA 4AIJA 2PFBA 2XAFA 2KIFA 1OYWA 4U7DA 2BBYA 4GCVA 1RNLA 2Q2EA 5HS9A 2BWXA 4PV4A 5HS7A 1LB2A 4OOIA 4NB5A 3SZTA 4OIRF 1R1VA 4PDKA 1BN5A 4EM2A 3QP5A 3T5XA 1W5TA 2MC3A 4XSZF 4Y13A 5D4SA 3LA7A 1G6NA 3HUGA 5LHHA 4L5JA 2A61A 1MDMA 5AONA 1YS7A 1HW2A 4WWCA 2P7VB 2ZXJA 4FUKA 4IKUA 2HEOA 2GG0A 2M45A 2F2EA 3H92A 1I6XA 2OD5A 3K1PA 4UUVA 1P2FA 2BV6A 4HAMA 5K1YA 3ZMDA 3FMQA 1ZARA 2HYFA 1LJ9A 4YG2F 2X0LA 5DD4A 2A07F 1FWZA 3TO6A 3RYPA 4CO8A 3L7WA 1R36A 3F8BA 4HF2A 3ULQB 4U75A 3PKBA 4KIBA 1U2WA 3F3XA 3JAMK 2YPRA 1S29A 2JTVA 2Z5UA 3KEQA 4KICA 3GXOA 3I53A 1C22A 3J7AO 3E5XA 3WU1B 2EFWA 1Z05A 1O57A 4KN4X 2DPUA 3G73A 2P8TA 3QP6A 3I0TA 3P9KA 2XASA 2VBWA 2GG5A 2PEXA 4M73A 4RGUA 5L3CA 4GYGA 3F8MA 3QU3A 4OOKA 1R22A 2H94A 1WWXA 2QENA 4KT5C 4UVCA 1PUEE 3PKDA 1J9IA 1RIOH 2FNAA 4CICA 3I5UA 1BC8C 1T38A 1USTA 1ZLJA 4I0BA 1HSTA 3HRSA 1P92A 5DEQA 3HIFA 4IKSA 4F7ZA 4A5NA 3V7CA 3Q9SA 1XNZA 4U1BA 4U0YA 5D8LB 2HQNA 3N97A 4U6ZA 5DYMA 2V9VA 1K79A 1I1GA 4LJZF 5L3BA 5DCMB 2O3FA 1QXWA 5CNXA 2FU4A 4EV0A 2CYYA 1O7FA 2O61A 3V8KA 2IW2A 2C6YA 5HVQC 1KQ9A 1LEAA 3MQ0A 3BPVA 1XSVA 2MD5A 1J5YA 2WC2A 1RUNA 4N0BA 1OMIA 3GLXA 3M9AA 3E6MA 3GFJA 1KU9A 2DQRA 2P7CB 4I01A 3B73A 1CF7A 5ICEA 4L9NA 2Y48A 2XUBA 2G6PA 2BE5F 4HDVA 2GAUA 2A5YB 2FE3A 5E17F 1U5TC 2EVMA 2GQQA 3ECHA 3BIPA 2V3ZA 3TO9A 1TNSA 2FSWA 4IF7A 1SFUA 4MTEA 1LDKB 5D5WB 3ZN1A 3GW2A 1U78A 2CWEA 2DO7A 2D1VA 3WTYC 3QPTA 1T2KA 1YTYA 4BXUA 2A69F 1BI0A 2YU3A 1FYMA 4A6WA 2DK5A 4ESJA 4FX0A 2MBFA 5E1ZB 1Q1HA 3TDUC 3ZMZA 4RGSA 4YIFA 1KQ0A 4G8XA 3CUOA 1DDNA 2KIUA 2NRAC 2QUFA 2FBKA 3PQJA 4G7OF 3WTXC 4KNYA 2ISZA 3ECOA 2XAGA 6PAXA 4FO8A 2MH2A 2Y0MA 3GFIA 3V8JA 1J7KA 4MGRA 3PKAA 2PBIA 4ZH4F 2J5PA 3KZYA 2ETHA 3ZMSA 1XGMA 3R4KA 2IPQX 1WI9A 4E70A 3E5UA 1IXCA 2XHKA 3WTVC 4DNCA 3FMSA 3BP8A 1SFXA 3K9TA 1W7PB 3KP6A 2V6CA 2LF8A 4ESFA 5FFZA 3F6OA 3QRFF 2ESNA 2GXBA 2RC4A 4JQFA 1ZRDA 3I59A 4G7ZF 2FNPA 5A2QZ 2O0YA 1XMAA 2IA2A 2L54A 3KP2A 5FD6A 4I7HA 5HDGA 4WF2A 3FWEA 4P55A 4ENMA 2P98A 1C0WA 4IXAA 1B4AA 1HW1A 2MATA 2XAHA 4GXOA 4QLCU 4IHSA 5DCFA 4DQ2A 1PV9A 4U6WA 2GG2A 1TQMA 3TDZC 4G9YA 4EM0B 2Q92A 2KRFA 3V8LA 1PDNC 2GG9A 2GU5A 3CJNA 2P5VA 2QZ8A 2RVCA 4LLLA 4Q47A 5E8IA 4A6EA 2BHCA 5H20A 2P9AA 3KZZA 2B3HA 5TRDA 3WU0A 1XMKA 1G3TA 5CVUA 4FLIA 1WBQA 4RGZ1 3RDIA 3CUQB 4PCQA 3CB6A 2GXGA 4S05A 3P7NA 3FM3A 1ZLKA 3R0JA 4PNCA 3GX4X 2KJBA 4WX9A 1HKTA 1Z91A 3J81K 2BGCA 2RGVA 1H9TA 2CO5A 4LK1F 1R7JA 5LRRA 3ZMTA 3EQLF 3QAHA 1B9MA 1P6RA 4PZJA 5LEJA 3TB5A 2H27A 2DK8A 4TV7A 1R23A 1K78A 1HW5A 3C1DA 3E97A 2GA2A 1OPCA 3HYIA 4AWXB 1F4KA 4YFNF 4PGHA 5KK1A 3WTUC 1TBXA 2PN6A 3JSOA 2Q94A 4KA4A 2DI3A 4BAYA 2JRTA 1B59A 3TKYA 2HOEA 3IL2A 3IU8A 1F5TA 4YIIA 3JTHA 2VBYA 5LEKA 2RDPA 2BWSA 4WXHA 5E20A 2Z33A 2RNJA 4U0WA 1XGSA 3HHGA 5CDLA 4LK0F 2ELHA 2PQ8A 4XRFA 4G6DA 1R58A 4U0VA 2EV5A 5ICFA 5CLSA 3V7SA 3IWZA 3DEUA 2G7UA 3H3UA 4OU0A 4EGYA 2BEOA 1O7LA 2OQRA 1ULYA 2DBBA 4U73A 4ZWPA 3EYIA 1B9NA 4IVNA 3B02A 2V3XA 1IN6A 4A12A 1MDMB 4O5VA 3W6KB 3E6BA 3Q5FA 5E5BA 3GZ6A 4P96A 3BJAA 5E8GA 2NAZA 3FM5A 2UZKA 4MQ9F 4MEYF 1IRGA 3TOBA 2NNYA 4L9VA 3HTUA 3ELKA 4LG0A 3LWFA 4A0XA 4MNUA 1U8RA 2R7DA 5J8CA 5BMZA 2BH3A 5FLXZ 3K2ZA 3ZMUA 1O3TA 1FSHA 4BH9A 4BYYA 3U1DA 2EA2A 3J80K 4UVAA 2ISYA 5DDGA 4BHBA 5BQTA 5LLQA 5HDNA 2A68F 4U69A 3WGHA 5F64A 1KGSA 5FO5A 4FX4A 2XAQA 5CVRA 1SAXA 2CW0F 1KP0A 5ICCA 1Z9CA 3GO5A 2YSRA 3IRQA 3O2PE 3U2RA 4EVIA 4ZYHA 5HS8A 4HF0A 5F6FA 4L9TA 4RZZA 3ZMVA 3PKEA 4MEXF 3R61A 4L18B 4QR8A 5D6EA 3LA2A 3RKXA 3S2WA 2ZMEA 4HW0A 5CVJA 2VBXA 5FB2A 1HXDA 2BYVE 1AOYA 3KP5A 1QXYA 3KP7A 1J2XA 2K4BA 1VTNC 1YYVA 2B0LA 4Y17A 4LB6B 2UWMA 3FMRA 5FD5A 3JSPA 5ERIA 2XRNA 2OU2A 2MLKA 3T8TA 1XN7A 3L09A 1SFEA 5J8FA 1ZAOA 4EGZA 3HHHA 3CB5A 3BPXA 3VODA 4GYIA 1W7VA 2QQBA 2E7WA 3I4PA 3DFGA 3KEOA 1MKMA 1DP7P 3FHZA 1QO0D 2GTXA 3NQOA 3BITA 3TOAA 1HQCA 1UFMA 2OBPA 2HTJA 4O3MA 4KFCA 3KP4A 3RI4A 4ZZLA 1GXPA 4GO1A 1C23A 3T8RA 1U6GA 5IT9K 4HA8A 4I0AA 3RJPA 2HKXA 3WE2A 3P9IA 4XSXF 5AIPA 2HS5A 4LGWA 5KVRA 4CDGA 1BIAA 2QBYA 1PP8F 2K7LA 4ZZDA 3L2CA 3E5QA 5BPDA 3HOSA 5D6FA 1UHWA 3KP3A 1G3WA 1SD7A 3LQRA 3DPTA 1XCVA 3BY6A 1JHHA 1HSJA 3K0LA 2EVOA 3I71A 4ZYGA 2JSCA 3C3WA 2DU9A 1ZHFA 1L3LA 1OYIA 5LHGA 5L3GA 1WQ2A 1GHCA 5FGMA 2PG4A 1A04A 4M9ZA 3FF5A 3M8FA 1ZH5A 5CVIA 2XGXA 4IDYA 4I2OA 3I58A 4U71A 1WL6A 1V3FA 2H6CA 4G7HF 4Y15A 4ON0A 1YW7A 3K69A 2Y75A 4RGRA 1ZREA 1SD6A 2E7XA 2GU4A 1GVJA 4OIPF 3F8NA 4JBAA 1JE8A 3SHFA 1IXRC 3K1NA 2FBHA 4KMFA 2RQPA 4KIFA 2QVOA 1T39A 1IAWA 4U6JA 3CO6C 1YJ3A 4UHTA 3H3ZA 3PQKA 3G3ZA 3DP7A 1E17A 3LFKA 1KYWA 2PLYA 3K1MA 4RB2C 3IC7A 2VE9A 5LGUA 4M6YA 3IHUA 1ZGJA 4HX4A 2BWYA 3CDHA 4U6CA 2XAJA 2RN7A 5BS6A 1W2MA 5JR3A 1HKQA 1BBYA 4ASNA 3GZ5A 3CTZA 4Z2YA 3I59B 1PP7U 2AXLA 4CGZA 2RKHA 5CJ9A 5JVTA 1WRJA 3IU9A 3T1BA 3ISPA 1ONVA 3DPLC 4H0EA 4R8HA 5CDEA 2IA0A 1OKRA 1UHMA 1XGOA 3GUDA 3BIQA 2D1HA 3MCZA 3CLOA 2NNNA 4IF4A 3F21A 4OMZA 2V1XA 3DF8A 3RTRA 3E6DA 3OV8A 1IN5A 2R7FA 5JFRA 2W24A 3CUQC 3F8FA 2DW4A 4FLLA 2HKOA 2HWVA 4CZZA 3PFIA 4U76A 1MD0A 2WTEA 4KN7X 4U70A 3EUHA 2XV4S 3WGGA 1D5VA 4KMUX 1O0XA 3D0SA 5AIQA 2EFNA 2FEZA 3ML6A 2QM3A 4RB3C 3LQQA 4HX8A 4JK1X 1T6SA 2VXZA 1W5SA 2VC0A 1EH6A 1QPMA 3WG9A 2EK5A 1FZPB 1BI2A 1QBJA 4KYWA 1XSXA 1XSDA 2GG7A 3KLNA 4NHJA 1MATA 2H09A 5HOOA 2COMA 1MJBA 3TO7A 3RYRA 1KQ8A 1HKSA 2JPCA 1K78B 2KKOA 5ILSA 4BNCA 2M5WA 3BJ6A 1S8NA 1HBXG 2Z3YA 4EGEA 5L3FA 2MH9A 2Z99A 1YW8A 4M6XA 5HLGA 5ILVA 5DUKA 1D3YA 4YFXF 1ZRCA 1YIOA 2QQ9A 3GYHX 1REPC 2BWTA 3BROA 2PJPA 3IKVA 1YLFA 3IRRA 2FOKA 4RAZA 1W4MA 1W7PD 4PGGA 4UV9A 5CYVA 2GIVA 2G9WA 2DTRA 4S01A 3BDDA 2EVCA 1U5TA 4A0ZA 2EJRA 1I1SA 4S00A 1ZG1A 2OA4A 1CHMA 3FXRA 1D8JA 1AWCA 4WXCA 1BJAA 4MHGA 1X3UA 5DV5A 3I64A 1S7OA 4KM3A 1BI1A 1BOAA 2DLLA 2CSOA 1Y1NA 4B8XA 2O6GE 3KETA 2FQ3A 4OIOF 4RGXA 4Q4ZF 3LAJA 3HSEA 4LG0B 5F1RA 2JT1A 1XGNA 2W57A 3AAFA 1LDDA 2ZFWA 4UVBA 2Q8KA 1BC7C 3ZQ7A 4MATA 1QZYA 2ZCWA 3RPUA 4RZYA 4IKRA 2J5OA 3C7JA 4M9XA 2CQKA 2Z9OA 1WLRA 2M8EA 2BHAA 3MATA 3E3VA 1F1ZA 3R0AA 5D4RA 4MTDA 1MJ9A 4WK8F 2EV0A 3U9GA 1FP1D 3CUQA 1P4XA 4ZYDA 1T0FA 2DAOA 3CTAA 3PKCA 3TGNA 1TTYA 1R5HA 2GZWA 4UV8A 1H0MA 3F22A 5J6XA 2NQ7A 2CFXA 4HDUA 3ZN0A 2IRFG 5K5QA 1C24A 4Q48A 2HR3A 3FXUA 1S6LA 2ZMEB 2GGBA 4S04A 3RIRA 4AIHA 3GF2A 4KIGA 1WY2A 3P9CA 1LDJA 1WKMA 2EWNA 2Q0OA 3V4GA 4L0ZB 3Q6DA 4CHUA 1Z6TA 1FC3A 3R6SA 1J0RA 2EV6A 2OZ6A 2BHBA 3JAMZ 3MFKA 1QQIA 2BB7A 5DD8A 1KA8A 1TQIA 5CDVA 1QZZA 4EJWA 4LD5A 1LVAA 2BWUA 2F5DA 1WSUA 5IT9Z 2V1UA 2XVCA 3RPQA 1BM9A 1TW2A 3EDPA 4U6EA 2VONA 1C21A 4CXFA 4HQMA 1LNWA 2P5KA 5FFXA 2W84A 3VB2A 1KYZA 2IJLA 2L3DA 4I98B 1J75A 2YR2A 5D5UB 3QOPA 1ZN2A 1TNTA 4RS8A 1IRFA 2W85A 3FZVA 3RORA 3NEUA 1UB9A 5K5RA 2QBYB 2IT0A 2ACJA 5CE6A 3IG4A 2ZO4A 1SMTA 4S2TP 1F9NA 1XD7A 5L3DA 2GA1A 3L7GA 1STZA 1O3QA 4ZYEA 1DPUA 3QU6A 5ED4A 2HOWA 2HDCA 2L02A 1YG2A 3ERED 2PMUA 2XIGA 2HFHA 4P5OA 1O3RA 5DUIA 4BHCA 2HZTA 1QGPA 5BPIA 1EH8A 3VFZA 4I09A 3T0YA 1FBQA 4LLGF 3KCCA 1BIBA 2XKPA 4M71A 1H9GA 3DKWA 3L24A 3ABTA 3GFMA 4IHTA 4ESBA 3MAJA 2BN7A 1C27A 1IN4A 1FT9A 3W6JB 2B3LA 2UXXA 3MWMA 5FLXK 4EJOA 4O6JA 4A2UA 3N4MA 1FBSA 4U7BA 1FNNA 4RAYA 4P9FA 1FOKA 4ZWUA 1T98A 2DT5A 1TW3A 3HOTA 4U88A 1JHFA 4IPAA 1DUXC 2DPDA 4N9IA 4GGGA 3SFZA 1UCRA 4G94A 2HTSA 4FKCA 1G3YA 1CF7B 5HLHA 2X4HA 2A6EF 4HLYA 2AS5F 1ZRFA 2ZBKA 3E6CC 5HDKA 2DQLA 2M1BA 1MJAA 1ON2A 1YW9A 1IW7F 4NQWA 2LKPA 4HLXA 4B28A 3R60A 1QXZA 4RB0A 2ZNZA 4A6VA 3GVAA 2P99A 4M74A 2STTA 3HRTA 1CGPA 4OIQF 2K02A 2VT2A 4ENKA 5BOXA 2OAZA 2A3SA 2OKNA 2O03A 3D5LA 5LGTA 4CYDA 2R3SA 4R79A 2VN2A 1Y0UA 1FLIA 1MGTA 2O8XA 4IRHA 4ETSA 4G6QA 2KJCA 1XDSA 2PI0A 1IN8A 1IF1A 1USSA 4LLNA 2FMYA 1IZ1A 4L0YB 1P4WA 2MLGA 2G7HA 1Z1DA 5LRSA 2B3KA 3DV8A 1EV7A 1G4DA 2ZJ2A 4A0YA 2LDUA 3WODF 3IKTA 2ZSGA 3TAVA 1FX7A 4FT8A 5LGNA 1Z6RA 4RB1A 1TLHB 2EB7A 2VT3A 4HOBA 4A5MA 1FBUA 3BOQA 2FXAA 4HF1A 2D2WA 2JZYA 2RV8A 1FSEA 4ENNA 4Q5SF 3HTSB 3KLOA 1JAWA 2KIMA 4A6DA 4UNOA 2H6BA 2E1CA 4HBLA 3SQNA 2EA4A 4R60A 5ICGA 5L3EA 3JW4A 2A6HF 3IU7A 3BWGA 1EH7A 4Z7MA 5DCMA 2P5LC 2LSOA 4ZWOA 2IVMA 5D8KB 1FPQA 4UXNA 5ILUA 2E1NA 1B1BA 4S2RP 2ADUA 4ENJA 1SD4A 4HX7A 3COAC 3WTSC 4WXDA 2TDXA 4HV6A 4HQEA 2VOOA 3S6BA 3BJOA 3HSRA 5E1XA 3O6BB 2DFIA 4KUMA 4K2EA 3HRUA 4WCGA 1YFHA 3KFWX 3GFLA 4AD9A 1FYKA 2Q95A 3MZHA 1S7AA 2GWRA 1SMYF 2XROA 1R00A 2OZUA 4JUQA 3WTZA 1FYLA 4IKTA 5CIKA 3REOA 1RUOA 1R1TA 2HGCA 2VBZA 5EEHA 5IT3A 1RI7A 2HYGD 2L4AA 3I54A 3EYYA 3J81Z 3DXJF 1ODDA 4MQVA 2EFQA 5JI6A 1JGSA 2MA3A 1ZG3A 1K7AA 3C18A 1OR7A 3GWZA 3LAPA 2FBIA 2NS0A 2FA5A 1U5TB 4XLNF 2LF7A 2VOPA 1ZGAA 1SD5A 2V1DA 3NRVA 4EJVA 1L0OC 2XKOA 4BQAA 3LSTA 3FX3A 4XLPF 5FCFA 4HV5A 5D5VB 1JXSA 2QWWA 3M1EA 3WTTC 1FP2A 1RZ4A 4LMYA 5LHIA 5E18F 2M30A 4D0PA 3Q9VA 3LA3A 3GEZA 3MZYA 2GG3A 4P9UA 4FLJA 3F72A 1KU3A 5H6QA 2YX7A 1FY7A 5JHUA 2IW5A 3RKWA 2IP2A 1BI3A 3F23A 3L9FA 4QWQA 5TJJA 1KU2A 1U3EM 2NYXA 3M8EA 3QPHA 2STWA 3ROUA 2BHDA 2IA1A 2V3YA 2PMHA 2W25A 1TQPA 1W7PA 1ZYRF 5HLIA 3V7RA 3MR1A 4ZNGA 4IECA 2F5CA 1IXSB 1D8KA 2BWVA 3ZP5A 2QQAA 1M35A 4IRGA 3F6VA 2D45A 3WTWC 2P6SA 1ON1A 1R1UA 4BHPA 1J59A 3WGIA 3D27A 4FO7A 4OINF 4KDPA 1WL9A 4IU6A 3F8CA 5D5XB 1I5ZA 2K27A 4LFUA 1S3JA 4M72A 1YVMA 4L5IA 1IN7A 4LB5A 2GGCA 3KE2A 3MX6A 5A2QK 3DQVC 4YFKF 1B6AA 2JPBA 2VODA 2FMLA 3IWFA 2EFOA 2NQ6A 1LQ1A 3J80Z 2Q96A 5CVVA 2FF4A 4N9HA 2M87A 2HQRA 2Q93A 4HYEA 1XB4A 3VEPA 4IJAA 3OOPA 3CO7C 4EJUA 5H6RA 1A16A 4IRIA 2L01A 2WWYA 3RVAA 2VC1A 1I27A 3TQNA 3EETA 3BZ6A 2QLZA 5E1WA 3HRMA 2F5FA 4R1HA 3ZPLA 3WE3A 2OQGA 2K4JA 3RKYA 1WN1A 3ABUA 1YO5C 2GU6A 4EM1A 1OYYA 1XCBA 1LEBA 2L4MA 2YX4A 2P4WA 1K6OA 1V4RA 2V79A 3VOEA 2GU7A 4HZFA 1YS6A 5EEGA 3MEXA 1MZBA 1KU7A 5LBQA 3HSFA 1NHAA 4XBFA 4FHTA 4AIKA 2QYOA 2GG8A 1ZG5A 2ESHA 1DPRA
chains in the Genus database with same CATH superfamily
1TWHJ 4M9SA 3G1MA 2DMQA 4I02A 2BWWA 2P6TA 4B09A 1YQAA 2V9KA 5FCHA 3SZPA 1MBGA 3SXYA 1SFOJ 1PUFA 2VE8A 5GAGJ 1VI0A 1E2XA 4AVPA 2COBA 1Z0XA 3JTGA 2QKLB 4L9JA 4A93J 1G3SA 4H4KC 1ZELA 2LG4A 1ACIA 1P4AA 5E3NA 1R5GA 1VQLI 2ICWG 1O3SA 1N51A 2GZ5A 4W1UA 1X4OA 1GXQA 5GAHJ 5K5OA 3VYUB 1Z7UA 1QNTA 3M7GA 1MIJA 4HSRA 2KPMA 4OMYA 3KEYA 4FLKA 2XPUA 3DKYA 3H0DA 2ZNYA 4XQFA 4EJTA 3FDYA 1DU6A 3VYRB 2F5EA 4D1QA 4EMSA 2DODA 2LBFA 3FXQA 3L00A 2R7TA 4EQQA 1IUYA 2KLOA 2EFPA 2E71A 2UXNA 2CG4A 3QODA 5H2FC 4Y33A 3O3KA 2QEXI 4CCOA 2WV0A 1Q1VA 4RDUA 3BR6A 1HC8A 3ZQGA 2KDOA 2ZJRF 2FRHA 2CGPA 2K86A 2ZKZA 1XDUA 5TGTA 2LNBA 4HXXA 4AIJA 2PFBA 2XAFA 1QZEA 1UJ8A 5DS9A 3OYJA 1IDZA 2KIFA 1OYWA 4U7DA 2ME0A 2BBYA 2TCTA 3CF2A 3PNYA 4GCVA 1RNLA 2Q2EA 3UR3C 5HS9A 4BXXJ 2BWXA 3G6EI 2NOJB 4PV4A 5HS7A 1LB2A 4OOIA 3J7AY 1W36D 4NB5A 1RR7A 1WGXA 2JVHA 3SZTA 4II3A 4BQNA 4OIRF 1R1VA 4BE2A 2DA2A 4DGWB 4PDKA 1BN5A 4EM2A 1MH3A 5KAFC 3QP5A 2BW3B 2XDVA 1W5TA 3T5XA 2MC3A 4XSZF 4Y13A 1GVDA 5D4SA 5HNFA 3LA7A 4PUSA 4BQOA 1G6NA 2MFZA 3HUGA 4KT6A 1LFUP 2ZXHA 5LHHA 3ZQLA 4L5JA 2A61A 2ZSIB 1MDMA 5AONA 1YS7A 3IAM2 3OYHA 4PK4A 3CCEI 1HW2A 4WWCA 2M2EA 2P7VB 2ZXJA 1B72B 4FUKA 4IKUA 2R7QA 2HEOA 4JX6A 2GG0A 2M45A 5J3LA 2VQHA 2ZFUA 2F2EA 3H92A 1T95A 1I6XA 2OD5A 3CMMA 3K1PA 4UUVA 1WJDA 1P2FA 4NQWB 2X6WA 1OCOH 2BV6A 4HAMA 5FKLA 5K1YA 3ZMDA 3FMQA 4A3GJ 1QHGA 1ZARA 2HYFA 1Y39A 1LJ9A 4YG2F 3L2WA 1D1BA 2X0LA 5DD4A 4CCKA 2A07F 1FWZA 2E1MC 4D5FA 1K4TA 2XSJC 2XSDC 1R71A 1R9TJ 4PJLA 4LIVA 3TO6A 2XB5A 3DU5A 3RYPA 1E3OC 1T33A 4CO8A 3L7WA 1R36A 3F8BA 4MLOA 2W1OA 4HF2A 3ULQB 2DMTA 1WH5A 3O8HA 4U75A 3PKBA 4KIBA 1U2WA 3F3XA 2VJ4A 3JAMK 1H89C 2YPRA 1S29A 2JTVA 2Z5UA 3KEQA 4KICA 3GXOA 3I53A 1C22A 3J7AO 5J40A 3E5XA 3HOVJ 3WU1B 2EFWA 4C3HJ 4NBQA 1Z05A 1O57A 4KN4X 2DPUA 3G73A 2P8TA 3GTQJ 3QP6A 3I0TA 1RETA 3OS2A 3P9KA 2XASA 1SVLA 2VBWA 1XMXA 3AG1H 2GG5A 2PEXA 4M73A 4RGUA 1Z77A 3OYNA 5L3CA 1TWAJ 4GYGA 1ETQA 3OSGA 3F8MA 2K9MA 3OYIA 3MMYB 1WFXA 3QU3A 1A5JA 1R22A 4OOKA 2H94A 1JKRC 1POGA 4FQGA 2CH0A 1MMNA 2Y9YA 1WWXA 2QENA 4KT5C 4UVCA 2CS3A 1PUEE 3H9QA 3PKDA 3HBLA 1J9IA 1QA6A 1RIOH 3SDBA 2FNAA 4CICA 2Y69H 2OCCH 3I5UA 3A01B 1YJNI 1BC8C 2V26A 2CV0A 3LFUA 1NK2P 1T38A 1USTA 3KZIC 3AG4H 1ZLJA 4I0BA 3C2HA 1HSTA 3HRSA 4JX4A 3PIOF 5B1AH 1JUSA 1P92A 1WJAA 5DEQA 4NUBA 3HIFA 3M3YJ 4IKSA 4F7ZA 4CCNA 4A5NA 3V7CA 3Q9SA 1XNZA 4U1BA 4U0YA 5D8LB 2HQNA 4PSWA 4C9YA 3N97A 4DZJA 4U6ZA 5DYMA 2V9VA 3BLYA 3GTKJ 2FJ1A 3FHNA 1K79A 1I1GA 1IO2A 4LJZF 5L3BA 2BHYA 3OYEA 1S72I 5DCMB 2O3FA 1QXWA 5CNXA 2FU4A 1Y8QB 4EV0A 2JQ7A 2BVMA 2ID6A 2KRCA 2CYYA 1O7FA 2NVYJ 3UNGC 2EINH 2O61A 2QCOA 3V8KA 2IW2A 4GRIA 2C6YA 3BQYA 4JOMA 5HVQC 1WI3A 3A4CA 4XL9A 1JGGA 1KQ9A 1LEAA 3MQ0A 3BPVA 3JRIA 1XSVA 2MD5A 1J5YA 3M4OJ 2FUG2 2WC2A 1RUNA 4CA0A 4N0BA 1JKQC 5FRMA 1OMIA 3FIWA 2IEKA 3GLXA 1Z3XA 3M9AA 3E6MA 2X6YA 5EEAA 1XS9A 4KISA 1MMAA 3GFJA 3H5NA 1KU9A 2E5ZA 2DQRA 2HXIA 2LMDA 2ZC2A 2P7CB 4I01A 1A36A 3BZKA 2K9LA 2O7OA 3KPHA 4OAZA 1WZ2A 4HG2A 5B3SH 3B73A 4PJ0C 1CF7A 5GTIC 5ICEA 1LKXA 1SFKA 1XPXA 4L9NA 2Y48A 3TEDA 4BACA 2XUBA 1GUUA 2G6PA 2CUJA 2BE5F 4HDVA 2GAUA 2MD0A 2R7ZJ 2A5YB 2FE3A 3OYDA 5E17F 1U5TC 2EVMA 2GQQA 3ECHA 5IOYA 3BIPA 2CMPA 3TO9A 1BOBA 3VDXA 5J4VA 2V3ZA 1TNSA 1MMSA 4BUPA 2FSWA 3BCBA 3AKZA 2X48A 1H88C 1SFUA 4MTEA 4IF7A 1LDKB 3HZJA 2VI6A 2JMWA 4U87A 1X1CA 5D5WB 3ZN1A 3GW2A 1V5GA 1ERDA 1U78A 1K61A 5EG0B 4IL6C 3GMEA 2CWEA 2DO7A 2D1VA 3H5RA 3L2RA 4EATA 4PJMA 2WB1N 3WTYC 3QPTA 1T2KA 1X1PA 3L2UA 1YTYA 4KJZA 4BXUA 2A69F 1BI0A 3GTOJ 1EF4A 2YU3A 1FYMA 2CUFA 4HPQA 4A6WA 2DK5A 4ESJA 3K4NA 4HEA2 4FX0A 2MBFA 3H9JA 5E1ZB 2Y0SA 1Q1HA 5LFAA 3TDUC 3ZMZA 4RGSA 4YIFA 1OCZH 1KQ0A 4G8XA 3FBIB 3CUOA 5HODA 4PFOA 2M4KA 1DDNA 2KIUA 3IP4B 2NRAC 2QUFA 4A3CJ 2FBKA 4PSXA 3WHCA 2K9SA 5F0FA 3PQJA 4IOAF 4G7OF 3WTXC 4KNYA 2ISZA 3ONQA 3ECOA 2XAGA 4ZDPA 3OYFA 4NC8A 6PAXA 4FO8A 5HNHA 3NWSA 1Z67A 3ZRGA 2MH2A 2Y0MA 3GFIA 1U9NA 3QWLA 1J7KA 2DA3A 3V8JA 3LSGA 1LE8A 4MGRA 3PKAA 2PBIA 4ZH4F 2LR8A 4AIDA 3CMAI 1VQ7I 2DA7A 2J5PA 3OSFA 5F04A 3KZYA 2ETHA 3ZMSA 3QPSA 2ME6A 3PO2J 1XGMA 1JTYA 3R4KA 5J1YA 2IPQX 2JVGA 1WI9A 3M8JA 4E70A 3E5UA 4X0GA 1T0FC 2H8WA 4D5CA 3DPUA 1D1AA 1A31A 1IXCA 2XHKA 3WTVC 2Z2SB 4DNCA 4YIRX 3FMSA 1RR8C 2B7EA 3BP8A 1SFXA 2K3PA 3K9TA 1W7PB 1OJLA 2Y9ZA 3KP6A 1UAAA 2V6CA 2LF8A 4ESFA 5CQEA 5FFZA 3F6OA 3ZXSA 2DDAA 4BEHB 3QRFF 3K7AJ 2LY1A 2DA6A 2ESNA 2GXBA 1DU0A 2RC4A 4JQFA 1ZRDA 3I59A 3BT9A 4ZTJA 2IS4A 4G7ZF 2FNPA 2O0YA 3LSJA 1XMAA 5A2QZ 2IA2A 2P0WA 3G1OA 4E4HA 2L54A 3I4NJ 4HNVA 3KP2A 5FD6A 4I99C 4I7HA 5HDGA 4V19K 1PYVA 4WF2A 3FWEA 1U9OA 4P55A 1ENHA 4ENMA 2P98A 1C0WA 2GBYA 2JRMA 2XF7A 4IXAA 4CCMA 1B4AA 2BY1A 2DCEA 2EIJH 1IGNA 2CV1A 1HW1A 2MATA 2XAHA 1MBJA 3EUAA 4GXOA 3KYCB 5DCFA 4DQ2A 4QLCU 2HQAA 4IHSA 1PV9A 4HNTA 2HDDA 1MBFA 2IGOA 4U6WA 2GG2A 1VQMI 1TQMA 3TDZC 4G9YA 5FKKA 1N75A 4EM0B 2Q92A 1YX3A 2LVSA 3HEFA 3OS1A 1G59A 2M9HA 4FTHA 3DEWA 4XN0A 2PJRA 2R7RA 2KRFA 4RBOA 1GV2A 3V8LA 1MBHA 1PDNC 4XKVA 3SEQA 2GG9A 2GU5A 3CJNA 2K5CA 2X51A 2P5VA 2QZ8A 2RVCA 3GBGA 4LLLA 3S93A 4Q47A 5E8IA 4CUGA 4A6EA 3H1CA 3ABKH 2QKMB 2BHCA 1VQNI 5H20A 2P9AA 1WJ5A 3KZZA 3CCJI 2B3HA 3A2KA 3IUOA 5TRDA 3WU0A 1XMKA 1G3TA 3O8GA 5CVUA 1WBQA 4FLIA 3IV5A 4RGZ1 2VIXA 2CUZA 2EIMH 3RDIA 3CUQB 4PCQA 3CB6A 2GXGA 2DFFA 2HYJA 4S05A 1SVOA 2JK3A 1UHSA 3DBRB 3P7NA 4FE4A 3FM3A 4V2FA 2QA4I 1ZLKA 1WH7A 5EYRA 2DXIA 4Y4RA 2HOAA 3R0JA 2OV7A 4B3AA 4PNCA 1H8AC 3FXMA 3GTGJ 3GX4X 2VJIA 2NXNB 2KJBA 1RKTA 4WX9A 2LYCA 4XRMA 1HKTA 5DM6F 1Z91A 3BG7A 4I76A 5E3MA 3J81K 2BGCA 2RGVA 1H9TA 3ABMH 5IYBJ 2CO5A 4LK1F 3HJEA 1R7JA 1IDYA 5LRRA 3ZMTA 1AKHB 3EQLF 3ESWB 3QAHA 1B9MA 1P6RA 1PUFB 4PZJA 5LEJA 4CCJA 3TB5A 2HPMA 2H27A 2DK8A 1T56A 1X19A 1HF0A 3C2BA 4D7NA 3DBLB 4TV7A 1R23A 2LREA 1K78A 1W0UA 1HW5A 3C1DA 3E97A 2GA2A 1OPCA 3HYIA 1HOMA 4AWXB 1F4KA 4YFNF 2YS9A 3HC7A 1X1DA 4PGHA 2QSGX 3OIPA 5KK1A 2LFBA 3WTUC 3A0HC 4GDFA 1TBXA 2PN6A 2N8GA 3JSOA 2Q94A 3HKZN 4KA4A 2DI3A 4JX5A 4BAYA 2JRTA 2DA4A 2DYRH 1Y6IA 1B59A 3BC8A 3TKYA 2HOEA 3IL2A 3IU8A 3HG9A 1F5TA 4YIIA 3JTHA 2LBFB 2VBYA 5B1BH 3RPUD 5GTHC 5LEKA 1IRXA 1LVKA 2MW8A 3DTKA 4C3IJ 2CRGA 4DYQA 2RDPA 3NARA 1IC8A 2BWSA 4F91B 3QYFA 4WXHA 1X1AA 3BTCA 5E20A 4DW6A 3OYMA 3OOUA 2I8DA 2DJNA 2D5VA 2LTPA 2Z33A 2RNJA 4U0WA 1XGSA 3HHGA 5F1JA 3PUBA 5CDLA 1IV8A 2Q2EB 4LK0F 4Y52J 2ELHA 3K6GA 2PQ8A 4XRFA 4G6DA 1R58A 4U0VA 2EV5A 3TMOA 2M8GX 5ICFA 5CLSA 3MKZA 4IEJA 3V7SA 3OIQA 3GZNB 3PL8A 3IWZA 3FK6A 1UG2A 5EDNA 3DEUA 3V42A 1V5EA 3G71I 2V6EA 1FTZA 3OIOA 3P5JA 2G7UA 2Y2ZA 4EEFG 3H3UA 4PFPA 4OU0A 4EGYA 1X2MA 2BEOA 1ETXA 1O7LA 3CCQI 2YU9J 2OQRA 5B5EC 1ULYA 3H35A 4J00A 2DBBA 4U73A 2M7BA 2X6XA 4XLAA 3JRHA 4ZWPA 3EYIA 1B9NA 3HUGB 4XKWA 4IVNA 1OCCH 3B02A 2V3XA 1IN6A 4A12A 3RQIA 1MDMB 1D1CA 3GCMA 3E6BA 4O5VA 3W6KB 3Q5FA 5E5BA 3GZ6A 3MD2A 3GLLA 4E7KA 3BG5A 4P96A 3BJAA 5E8GA 2L2OA 4AUXA 1NK3P 3OWTA 2NAZA 3CMYA 3FM5A 2UZKA 4MQ9F 4MEYF 3TBIA 1RRJA 2VQLA 2E2HJ 2OJED 1IRGA 1YI2I 3TOBA 2NNYA 4L9VA 3HTUA 1W5CC 3ELKA 4LG0A 3LWFA 4A0XA 4MNUA 3WU2C 1YJ9I 1U8RA 2R7DA 5TISC 5J8CA 2H1LA 3UKGA 4QPQA 3QQAA 5BMZA 2OTLI 2BH3A 3CD6I 5FLXZ 3K2ZA 3ZMUA 1O3TA 3AG3H 4CSWA 2L9SA 4KITB 1FSHA 3L1PA 4BH9A 4XRSA 4BYYA 4M3BA 3U1DA 2EA2A 2XC7A 3J80K 4UVAA 2ISYA 5F0CA 5DDGA 4BHBA 5BQTA 5LLQA 5HDNA 3K4BA 4AU7A 2KISA 4DBRA 3JREA 2A68F 5GP9A 3W2VA 4U69A 2K40A 3WGHA 2H8RA 5F64A 1KGSA 2MG4A 2UV1A 5FO5A 4FX4A 2XAQA 4XLHA 5CVRA 2XF5A 5EZHA 1U8BA 1SAXA 2CW0F 1KP0A 5ICCA 1Z9CA 2L9RA 3GO5A 2YSRA 3IRQA 3O2PE 3U2RA 2W48A 4EVIA 1LPQA 4ZYHA 5HS8A 4HF0A 5F6FA 4L9TA 4RZZA 3ZMVA 3PKEA 4MEXF 2DA1A 3R61A 4L18B 4QR8A 2VKEA 2BXZA 3M07A 3LA2A 5D6EA 3RKXA 3S2WA 2FX0A 1X1BA 2ZMEA 4HW0A 4XICA 5EZGA 4OWRB 3D1NI 5CVJA 2VBXA 5FB2A 1HXDA 2BYVE 1AOYA 3KP5A 4RLFA 1QXYA 3KP7A 1J2XA 2K4BA 2M3AA 1VTNC 1YYVA 2R7WA 2B0LA 4Y17A 4LB6B 2UWMA 4F52A 1MBKA 3FBNB 3FMRA 5FD5A 3JSPA 1X2NA 1JI8A 5ERIA 4BY1J 2XRNA 3F9KA 1TWCJ 2BZTA 2OU2A 2MLKA 1OCPA 5C4JJ 3T8TA 2EZKA 4BKXA 1XN7A 5DM7F 3L09A 1SFEA 2VLAA 5J8FA 1ZAOA 4EGZA 3HHHA 3CB5A 1OQYA 2CQ7A 4ZDOA 3BPXA 2CW7A 3VODA 4GYIA 1W7VA 2QQBA 3KIOA 2E7WA 3I4PA 4BL0B 1O4XA 3DFGA 3KEOA 1MKMA 2NOGA 1DP7P 3FHZA 1QO0D 2EBIA 4MO7A 2DMPA 2GTXA 3NQOA 2LKXA 2RQQA 3BITA 1NTCA 1HQCA 3DTEA 3TOAA 3S2HJ 3I3LA 1ETVA 2JA8J 1UFMA 2OBPA 2HTJA 4O3MA 4KFCA 1UG0A 3KP4A 3RI4A 4ZZLA 2B9SA 1GXPA 4GO1A 4HNUA 2AXTC 1C23A 5FLVA 3T8RA 2FOWA 1U6GA 5IT9K 4HA8A 2A05A 4I0AA 2HU9A 3IH4A 3RJPA 2HKXA 3WE2A 2CQNA 3P9IA 4XSXF 5AIPA 1WHUA 2HS5A 4BY7J 4A3LJ 2WBMA 4LGWA 5KVRA 3LL7A 4CDGA 1BIAA 3DEEA 2QBYA 1PP8F 2K7LA 4ZZDA 3BCAA 3L2CA 3E5QA 1UZCA 2HDWA 1XG1A 3EUHC 4M3DA 3HOSA 4NNJA 5BPDA 3DBHB 4J19A 5D6FA 1UHWA 1VQKI 3OYBA 3A0BC 3KP3A 1G3WA 1SD7A 3LQRA 2HI3A 2GIZA 4L5EA 3DPTA 5C3EJ 1LUJB 1JUPA 1OR7C 3H0GJ 2HNHA 1XCVA 3E1SA 5IYCJ 1K4SA 3BY6A 1JHHA 1HSJA 2L9NA 3K0LA 2EVOA 2V4JC 2LH9A 3I71A 1HLVA 4ZYGA 3CP8A 2JSCA 1ZR2A 3C3WA 2DU9A 1RC9A 4ZYAA 1ZHFA 2ZSHB 2RREA 4B47A 1L3LA 3LMMA 1OYIA 3C2GA 3TW6A 5LHGA 5L3GA 1WQ2A 2WY8Q 3W2WA 3S2DJ 2V7FA 3S14J 1GHCA 4IO9F 5FGMA 2PG4A 5K7HA 1A04A 4M9ZA 2NVTJ 3VSKA 3FF5A 3AL0B 3M8FA 1ZH5A 3B6CA 5CVIA 3AG2H 1PJRA 2XGXA 4GFBA 1HA8A 4I2OA 4IDYA 3ZCOA 4BE1A 4BJ5C 3I58A 4U71A 1WL6A 1DP3A 1V3FA 1B8IA 1IV6A 5KHDA 2H6CA 1KONA 4G7HF 4Y15A 3K4LA 4XMYA 4ON0A 1QPIA 5K7FA 1YW7A 3K69A 4AYBA 2PX9A 1Z3YA 4A3BJ 2E2IJ 2Y75A 4RGRA 3PO3J 1GLNA 4CYCA 1ZREA 1SD6A 4YEJA 1ETYA 2E7XA 5J4YA 1FJLA 2GU4A 1GVJA 1RKWA 4OIPF 3F8NA 3MZ8A 4JBAA 1JE8A 3SHFA 1IXRC 2LRDA 3K1NA 2XPVA 2FBHA 3MKYB 4KMFA 4LOCA 3ERMA 2RQPA 2X6OA 2E60A 4KIFA 2QVOA 2JA7J 1QVUA 5IP7J 1T39A 1IAWA 4IHWA 2HPIA 4U6JA 5M5XJ 3CO6C 1YJ3A 4UHTA 3PNVA 3H3ZA 3PQKA 3ASNH 2JSPA 3G3ZA 1GDTA 4BDYA 3DP7A 1E17A 2KRHA 1RESA 3LFKA 1KYWA 2VQCA 2PLYA 3GTJJ 3K1MA 4RB2C 3IC7A 4HRIA 2VE9A 4IHYA 4JP0A 5LGUA 4MIMA 4M6YA 3IHUA 1ZGJA 3DU6A 4HX4A 3RCOA 1E0EA 3CZ6A 3CDHA 2MC4A 4Y3OA 2BWYA 4U6CA 2F4MB 3S8PA 1MNMC 3S17J 1V5FA 2XAJA 2R5ZA 2RN7A 3SZGA 2JWTA 5BS6A 2NS7A 2BOLA 1KZHA 1W2MA 1MSEC 5JR3A 4UB6C 1HKQA 1BBYA 1AHDP 1F36A 3BG9A 4ASNA 2ECBA 3GZ5A 3CTZA 3S1RJ 4Z2YA 3I59B 3I4MJ 1PP7U 1BW6A 4JYKA 2O5RA 3W3CA 4YELA 2AXLA 4CGZA 2RKHA 5CJ9A 3ZQHA 3RZOJ 1YX5A 2OC6A 1WRJA 5JVTA 2KDZA 3IU9A 3T1BA 4A69C 3ISPA 3QOEA 4QTRA 1W0TA 2O9LA 1ONVA 3DPLC 4M3EA 2F48A 4H0EA 2M7AA 3CC2I 1FIPA 4R8HA 1A35A 5CDEA 2IA0A 5HLTA 1OKRA 1UHMA 1XGOA 1XX5A 3FISA 3GUDA 3BTJA 2L7MP 3BIQA 2D1HA 4F3QA 1A6IA 3MCZA 1MMDA 4F93B 3CLOA 2NNNA 4IF4A 3PSFA 3F21A 2DYSH 5E3LA 3CDIA 2EZIA 5IYDJ 4OMZA 1BR4A 2V1XA 1DQUA 3DF8A 4XRSG 3RTRA 3L2VA 3E6DA 3HOXJ 5F0HA 2OF7A 3OV8A 1IN5A 4M6VA 3OMYA 2L9VA 2WAFA 2R7FA 3CCUI 5JFRA 2W24A 3CUQC 3F8FA 4G12A 4A3EJ 2DW4A 1DGWY 2Q1ZB 4FLLA 2HKOA 4BXFA 5K7ZA 2HWVA 1V55H 3K4KA 3MKWB 1YOVB 1JKPC 4CZZA 3PFIA 2IS1A 3SFIA 3PJRA 3BG6A 5B66C 9ANTA 4U76A 1MD0A 1MW7A 2WTEA 1DGRM 3W2AA 4KN7X 4U70A 2DMNA 2OTJI 3EUHA 2XV4S 3WGGA 4D7MA 3GTPJ 4X1EA 1D5VA 4A3IJ 2E19A 2XAUA 2DN0A 4IHVA 1JKOC 4KMUX 1O0XA 3BR0A 3D0SA 3EUKL 5AIQA 2EFNA 2FEZA 3ML6A 2QM3A 4RB3C 3LQQA 2KP6A 4HX8A 2LKSA 3WG7H 1P7JA 1T6SA 3A03A 3QYBA 1PVEA 2VXZA 4JK1X 3ZQIA 1W5SA 2F4OB 4DZPA 2VC0A 1EH6A 1QPMA 3WG9A 2EK5A 1WCMJ 4BJTA 1FZPB 1BI2A 1FTTA 1QBJA 4D9JA 3ZR8X 3FKJA 2XGEA 3CMEI 1I50J 1XSXA 4KYWA 1XSDA 2X1EA 2JA6J 4B4CA 1Y1VJ 1GT0C 3JRDA 2R7OA 1E3HA 3JRFA 2GG7A 3KLNA 4NHJA 1MATA 2H09A 3H9GA 5HOOA 2COMA 1E3PA 2VUMJ 2OUMA 1MJBA 3TO7A 3RYRA 1KQ8A 1D5YA 2BHZA 1HKSA 2VKHA 2JPCA 3CCSI 1ZGWA 1K78B 1OCTC 3GTLJ 2KKOA 5E79C 4ZDLA 5ILSA 4BNCA 2M5WA 3BJ6A 4XIDA 2G0EA 3K4CA 1S8NA 1HBXG 2Z3YA 4EGEA 5L3FA 4UUSA 2MH9A 2Z99A 3G2BA 1YW8A 4M6XA 5HLGA 4S0HB 5ILVA 1FMVA 2HVRA 2IGMA 2HZDA 3PIPF 5DUKA 1MH4A 1D3YA 4YFXF 3MN2A 1ZRCA 1YIOA 2F6CA 2QQ9A 3U1KA 3GYHX 3HM5A 2OCEA 1REPC 2BWTA 3BROA 2PJPA 3IKVA 2EH3A 2E1OA 3CDLA 2MSYA 1YLFA 4ZJZA 4M3FA 2KMUA 3IRRA 3S3MA 2LLKA 1QRYA 1QHHD 4C2TA 3VYTB 2FOKA 1ORKA 4RAZA 4A3JJ 4PJJA 1W4MA 2VL8A 1W7PD 1XTAA 4PGGA 1W1WE 4UV9A 3BTLA 5CYVA 2GIVA 4XKCA 2G9WA 3FK7A 2BY0A 1P9QC 1MBEA 1T08B 2DTRA 2H1KA 3BDDA 4S01A 2Y31A 1NG6A 3CQZJ 2EVCA 3J7YJ 1U5TA 3FXOA 3KYLA 3PFYA 5EGOA 4RM2A 2Y0SN 2A5WA 2IGNA 4A0ZA 2EJRA 2XGDA 2L0KA 5J1RA 1I1SA 1IRZA 4S00A 3FKIJ 4BQQA 1ZG1A 2NVQJ 5IPAA 2OA4A 1A6QA 1CHMA 3FXRA 1D8JA 1AWCA 2JJ7A 4WXCA 1BJAA 2JUCA 1BW5A 2QQ8A 4MHGA 1X3UA 4BU2A 1XC5A 2Z16A 5DV5A 2HOSA 3K70C 4DIQA 1HCRA 5FLMJ 1WVRA 3JRGA 3I64A 5CKTA 4CCLA 1S7OA 3W6VA 4KM3A 1BI1A 5J47A 1BOAA 4G6TB 2DLLA 2CSOA 1Y1NA 4B8XA 3ABLH 2JA5J 2O6GE 1FEXA 2VJJA 3KETA 3JRAA 2ZJPF 2FQ3A 1MSFC 4OIOF 4RGXA 3DLLF 4Q4ZF 3LAJA 2ZB9A 3HSEA 1TWFJ 5GADJ 3ASOH 4XOTA 4LG0B 5F1RA 2JT1A 1XGNA 2W57A 3AAFA 1LDDA 2ZFWA 3DKXA 4UVBA 2Q8KA 3RZDJ 1R4MB 1BC7C 3ZQ7A 5J1UA 4MATA 2BXYA 2KHMA 4AC0A 1HDDC 1QZYA 2ZCWA 3RPUA 4RZYA 1SC7A 2X9DA 4ITVA 4IZZA 3JRBA 1BA5A 4IKRA 2K3FA 3OS0A 2J5OA 3TL4X 3C7JA 4M9XA 2QSFX 2M34A 2CQKA 2Z9OA 1WLRA 2M8EA 2WV1A 2BHAA 3MATA 3E3VA 1F1ZA 3R0AA 5D4RA 2ZXIA 4MTDA 1MJ9A 5CPRB 2CU7A 2IS2A 1OISA 4WK8F 2EV0A 2MGQA 1ZK8A 3OR2C 2GXAA 3U9GA 1FP1D 2DJIA 3CUQA 1VNDA 2E36A 1P4XA 3HXLA 2CV2A 2XB0X 1RPWA 4ZYDA 1T0FA 2R7UA 1LFBA 2RAEA 2DAOA 2I5UA 3CTAA 3DLAA 4AVZA 3LNQA 2GLOA 1JT0A 3PKCA 3TGNA 1TTYA 2VASA 1R5HA 3U21A 3K10A 1EKEA 2GZWA 2R5YA 1APLC 1VQOI 3H36A 3SJMA 4UV8A 2XF6A 4X6AJ 1WPKA 1H0MA 3F22A 1WJBA 3H3VK 2EIKH 5J6XA 2NQ7A 5FKOA 2R7XA 2CFXA 4XKBA 4HDUA 4DYCA 3ZN0A 2IRFG 5K5QA 1C24A 1IG7A 4Q48A 2HR3A 3FXUA 1S6LA 2ZMEB 1D0XA 2GGBA 4S04A 3RIRA 4AIHA 3GF2A 3H5AA 4KIGA 1EJ9A 2AQFA 1WY2A 2IAIA 3P9CA 4XNFA 1LDJA 1SANA 1WKMA 2EWNA 2Q0OA 3V4GA 1TZLA 4L0ZB 3Q6DA 4RLQA 1TC3C 3HPGA 3N05A 4CHUA 1BJZA 1Z6TA 1FC3A 2BVLA 3FXKA 3R6SA 1I3QJ 4YRVA 4RM3A 1J0RA 2EV6A 2OZ6A 2BHBA 3JAMZ 3MFKA 1OCRH 1QQIA 3HGGA 2BB7A 1TWGJ 3HOUJ 5DD8A 3SEZA 1KA8A 1TQIA 4RAGA 2LY9A 4UUTA 1X4PA 1V54H 1Y1WJ 5CDVA 1QZZA 4EJWA 4LD5A 3DCFA 1LVAA 2BWUA 2O8KA 2F5DA 1WSUA 5IT9Z 4IX7A 2V1UA 2XVCA 3RPQA 1YJWI 1G2HA 1BM9A 2VB6A 2QGUA 3D5RC 1TW2A 2DT7B 3EDPA 4U6EA 2VONA 2VQGA 1C21A 1D0YA 4CXFA 4HQMA 4DJAA 1LNWA 5FJ8J 2P5KA 3MVPA 4HSTA 5FFXA 2W84A 4LG3A 3VB2A 1KYZA 2WY7Q 3HPHA 2IJLA 2L3DA 3E0JB 4I98B 1J75A 2YR2A 5D5UB 2X85A 2W4SA 3QOPA 1ZN2A 3OL3A 1TNTA 3LSKA 2HQ5A 1R6RA 4RS8A 1JT6A 2Z1DA 2GM4A 1YRNA 1IRFA 2W85A 3FZVA 4II2A 1TT0A 4N4NB 5DTDA 3NEUA 1UB9A 1IJWC 3RORA 3LOCA 5K5RA 2QBYB 2K85A 2IT0A 4C2MJ 1S7EA 3LSIA 2ACJA 2F4IA 2V1NA 5CE6A 2JUGA 3IG4A 1VQ8I 2ZO4A 1SMTA 1J09A 1QU3A 4S2TP 2WADA 2R92J 1F9NA 1XD7A 2QSHX 2R93J 2OPTA 1K6YA 5L3DA 2GA1A 4DYRA 2K9QA 1VQ4I 3L7GA 1STZA 2WA0A 1O3QA 5C4XJ 3AFHA 2E5NA 2DA5A 1Y0NA 2IXSA 4ZYEA 1DPUA 2P81A 4BE0A 1MMGA 3QU6A 4UB8C 5ED4A 3K4JA 3K70D 3J7ZI 2HOWA 3FXJA 2HDCA 5GAEJ 2L02A 1YG2A 3ERED 2PMUA 1QVTA 2XIGA 2HFHA 3CESA 4P5OA 1R4NB 2MABA 2DOEA 1O3RA 5DUIA 2L5QA 2PMZA 4BHCA 2HZTA 3AL0C 3S3OA 2IGKA 1QGPA 5BPIA 1EH8A 3S32A 3VFZA 4I09A 3PM1A 3T0YA 1FBQA 4LLGF 2XGCA 5IOZA 3JRCA 3KCCA 1BR2A 1BIBA 2CQQA 2LOOA 1VFCA 1YITI 4B44A 1Z7LA 2XKPA 2DDBA 5FKNA 2R4GA 4M71A 3IAS2 1H9GA 3DKWA 1BL0A 2UUZA 3L24A 3ABTA 3BTIA 3GFMA 2MYSA 2RNGA 4IHTA 4B3XA 4ESBA 2VPLA 3MAJA 2B63J 3CCMI 2BN7A 4BBSJ 1C27A 1D0ZA 1IN4A 1FT9A 2WB1A 3W6JB 2UXXA 3CF5F 2B3LA 3MWMA 3OR1C 5FLXK 2YUSA 4XN3A 5C44J 4EJOA 4O6JA 1B8IB 1SAUA 2IBDA 4A2UA 3N4MA 2HOTA 4C2UA 1FBSA 4U7BA 2M0MA 2NVUB 1I39A 3BR3A 1FNNA 1IUFA 5F27A 4RAYA 4P9FA 4CYCB 3BR2A 1Y8RB 4F92B 1FOKA 4ZWUA 1T98A 2DT5A 1TW3A 3HOTA 2EILH 4U88A 2DMUA 2BW3A 3DWLE 1FOYA 4V2GA 2VXDA 2GOXB 5M5YJ 1JHFA 3NWTA 1SEUA 4IPAA 1DUXC 2DPDA 4N9IA 4GGGA 3SFZA 1UCRA 4G94A 3OYCA 2HTSA 4FKCA 1G3YA 2DOFA 1CF7B 2TRTA 5HLHA 2X4HA 2A6EF 4HLYA 3DTIA 2AS5F 1ZRFA 2ZBKA 3E6CC 1AA7A 3SDGA 5HDKA 2EQRA 4B1RA 1B72A 2DQLA 2VJ5A 5IP9J 2M1BA 2ID3A 3FXLA 3HB9A 1MJAA 1ETOA 1ON2A 1YW9A 1IW7F 4RAFA 4NQWA 2LKPA 3CJQB 4HLXA 4B28A 3K4MA 1FOXA 2DFHA 3PNTA 1BR1A 3R60A 4F55A 2XPWA 2LY2A 1YE9A 1QXZA 4RB0A 2ZNZA 4A6VA 3S1QJ 2R5ZB 3NAUA 3Q0UA 4ZTFA 3GVAA 3HGYA 2P99A 4M74A 2STTA 4IQ4A 2Y30A 3HRTA 1CGPA 4OIQF 2LC2A 3S1MJ 2K02A 2VT2A 4ENKA 5BOXA 4FASD 4E7HA 4QSHA 2OAZA 3CCLI 2A3SA 2OKNA 1ITYA 2O03A 3D5LA 2E1MB 2WAQA 4J01A 1T8IA 5LGTA 3CLQA 3CJTB 2DT6A 4A3DJ 4CYDA 1OLTA 3QYEA 3BR5A 4B43A 2JN6A 4FETA 3JCUC 3F0CA 3WHBA 4A3KJ 2R3SA 4XLEA 1HDPA 4R79A 2VN2A 1VQ6I 1Y0UA 1FLIA 1MGTA 2L7FP 4FE7A 2O8XA 4XM3A 4IRHA 2L7KA 4ETSA 1LE8B 4G6QA 4FISA 2KJCA 2W7NA 1XDSA 1S5LC 3X2QH 2PI0A 1IN8A 1IF1A 1USSA 4LLNA 2FMYA 4IQJA 1P7IA 1IZ1A 4L0YB 1P4WA 2MLGA 2BY3A 4NC6A 3CC7I 2G7HA 1Z1DA 2A6TA 4XORA 5F08A 5GPCA 5LRSA 2B3KA 3DV8A 1VQ9I 1EV7A 1G4DA 1N25A 3A02A 2ZJ2A 4A0YA 2LDUA 3WODF 3LSPA 3IKTA 1AU7A 2ZSGA 1X58A 3TAVA 1FX7A 1JTXA 4FT8A 4LITA 2KZGA 5LGNA 1ZR4A 1Z6RA 2R7VA 4RB1A 3A01A 1TLHB 1Y56A 2EB7A 2ZXWH 4MFDA 2PMZN 5FKMA 2VT3A 4HOBA 4A5MA 4B48A 1FBUA 3BOQA 2FXAA 3S16J 3SYTA 4HF1A 2D2WA 2JZYA 1UELB 2E34A 2RV8A 1FSEA 2R0QC 1I6HJ 4ENNA 4Q5SF 3HTSB 2EZHA 3ZQCA 3KLOA 3RKQA 1JAWA 2KQRA 2GOMA 2KIMA 4A6DA 2X1DA 4UNOA 2EZLA 3B6AA 1X3ZB 2H6BA 2E1CA 2AHQA 4E7JA 4HBLA 3SQNA 2EA4A 4OAYA 3I9V2 4R60A 3OYKA 5ICGA 5L3EA 3JW4A 4DBQA 3BQZA 2A6HF 4IHXA 3IU7A 3BWGA 2VKDA 1EH7A 1M1EB 1Z21A 2LSOA 5DCMA 2P5LC 4Z7MA 4ZWOA 2KZVA 2IVMA 5D8KB 1FPQA 4UXNA 1CQTA 3K2AA 5ILUA 2E1NA 2VKVA 1B1BA 2FD5A 2LP0A 1JJ6C 4S2RP 1N77A 2ADUA 3KYDB 1SD4A 4HX7A 3COAC 1WJFA 3WTSC 4ENJA 4WXDA 2TDXA 1F43A 4HV6A 4P1WA 4HQEA 2VOOA 2PJRB 3S15J 3S6BA 3JR9A 3HDDA 3BJOA 3HSRA 4NC7A 4E7ZA 5E1XA 3E7LA 3O6BB 4XR6A 4FCYA 2DFIA 3BG3A 2ZJQF 3VWBA 4KUMA 2AO9A 4UUSB 4K2EA 3I56I 1UMQA 3HRUA 2KIQA 4WCGA 1R5ID 4ZC3A 4BGDA 3OYLA 1YFHA 3OYGA 3KFWX 2HVSA 4C30A 3GFLA 2CUEA 4AD9A 4XLFA 2F5VA 4CZCA 1FYKA 2Q95A 5IY5H 3MZHA 1S7AA 2GWRA 2HXOA 1SMYF 1R00A 1FIAA 1WJCA 2OZUA 2XROA 3WTZA 4JUQA 3TP3A 1FYLA 4IKTA 1R49A 1EA3A 1X3WB 5CIKA 3REOA 3HOZJ 3HKZA 2X1CA 1RUOA 3ZGKA 4RA2A 1R1TA 2HGCA 2KL4A 2VBZA 5EEHA 5JVGF 4C3JJ 1TP4A 1RI7A 2HYGD 2L4AA 3I54A 3EYYA 5IT3A 3J81Z 3DXJF 1ODDA 4MQVA 2EFQA 1VQ5I 1OFCX 1G8XA 3LSHA 5JI6A 1JGSA 2MA3A 4W97A 1ZTRA 3TW7A 1ZQ3P 3HOWJ 1ZG3A 1K7AA 4DOZA 2NVXJ 3C18A 1ETKA 2DTZA 1OR7A 2VPRA 3GWZA 3CP2A 3LAPA 2FBIA 2ELKA 2NS0A 3Q0VA 5EG0A 2FA5A 1U5TB 5LD2C 5EGOB 3LSMA 4XLNF 5KNLA 1JJ8C 4AM3A 2LF7A 2VOPA 1ZGAA 1SD5A 2V1DA 2I10A 2WAQN 3GTMJ 3NRVA 4EJVA 3G1LA 4AYBN 1L0OC 1FMWA 5EF6A 4E7LA 4BBRJ 2XKOA 3Q0WA 4BQAA 3L2QA 4A3MJ 3LSTA 3HOYJ 4XOPA 3FX3A 4XLPF 5M3MJ 5FCFA 2FQ4A 4CH7A 4HV5A 5D5VB 1S9HA 1JXSA 2BY2A 2QWWA 5FROA 3M1EA 3WTTC 3BR1A 1FOWA 1FP2A 1RZ4A 4LMYA 5LHIA 5E18F 4UY8I 2M30A 4BDZA 1MNEA 3Q9VA 3LA3A 4D0PA 2DOAA 3GEZA 3MZYA 2GG3A 1N78A 4P9UA 2CW8A 4FLJA 2HVQA 3F72A 1KU3A 5H6QA 1TL8A 4N4OB 2YX7A 1FY7A 5JHUA 2IW5A 3RKWA 3G4SI 2E35A 3A1YA 4ABZA 3I55I 2IP2A 1VQPI 4E7IA 1ZKGA 2W00A 3VYSB 1BI3A 4NDLA 4RMNA 3ZQQA 3F23A 1VF9A 3L9FA 1ETWA 1SVMA 4QWQA 3ZQFA 5KAIC 3Q3SA 4M3GA 5TJJA 2KT0A 1KU2A 1U3EM 2NYXA 2WAEA 4E6KG 1WJEA 2R7SA 1LFPA 3M8EA 1K83J 4XK4A 3QPHA 2STWA 1I3AA 3ROUA 2BHDA 2IA1A 2V3YA 2PMHA 3CCVI 3RQ4A 5JLXA 4XONA 2W25A 1MNDA 1TQPA 1W36C 3EPZA 1W7PA 1ZYRF 1TT5B 2L7ZA 5HLIA 5BNGA 3HL2A 3V7RA 3MR1A 4ZNGA 4IECA 3BZCA 2F5CA 4BEHA 1IXSB 1D8KA 2BWVA 3ZP5A 3OYAA 3OL4A 2QQAA 3S3NA 1M35A 4IRGA 3F6VA 2D45A 4E7SA 3WTWC 2P6SA 5GPAA 2R5YB 2ZMEC 1ON1A 1R1UA 4BHPA 1J59A 3WGIA 3D27A 4FO7A 3M1CA 4OINF 2QF7A 2V9PA 4KDPA 1WL9A 4IU6A 3F8CA 2K27A 1I5ZA 4LIUA 5D5XB 4LFUA 1S3JA 4PJNA 4M72A 5IP6A 2LK2A 1YVMA 5E3OA 4L5IA 2NS8A 1IN7A 4LB5A 2GGCA 5JLWA 3KE2A 3MX6A 1GV5A 5A2QK 3DQVC 3PSIA 4IOCF 3CCRI 4YFKF 1B6AA 3IH2A 2JPBA 2M4GA 2VODA 3CCYA 2FMLA 3IWFA 2EFOA 3RSNA 2NQ6A 1LQ1A 3J80Z 2Q96A 5CVVA 2FF4A 4N9HA 4QIWN 4IKFA 2M87A 3CC4I 4BS9A 2XRLA 2M0CA 2HQRA 2Q93A 4HYEA 1XB4A 3VEPA 3VPRA 3QPLA 4IJAA 2LD5A 2CJJA 3OOPA 3CO7C 4EJUA 2ELJA 5H6RA 2AQEA 5JHFA 1NG7A 2W82A 5M5WJ 1A16A 3D5SC 2KFDA 4BJ6C 1YIJI 4IRIA 2L01A 1VZ0A 4ANJA 2WWYA 3RVAA 2VC1A 1I27A 3TQNA 3EETA 2IS6A 4MFEA 1YHQI 2K9NA 2JA2A 3BZ6A 2QLZA 5E1WA 2ECCA 3HRMA 2F5FA 4QPOA 4XLCA 5KCMA 4R1HA 4Z6YA 3ZPLA 3WE3A 2OQGA 2K4JA 3RKYA 1WN1A 1U0JA 4I6ZA 3ABUA 1YO5C 2GU6A 3TP0A 2CQXA 4EM1A 1NH3A 1OYYA 3PUFA 4Y7NJ 2E2JJ 1XCBA 1LEBA 2L4MA 2YX4A 3LSRA 2P4WA 1K6OA 3ZOBA 5EJCA 1V4RA 2V79A 3S1NJ 3VOEA 2GU7A 4HZFA 1YS6A 2DFEA 3MEXA 5EEGA 5M3FJ 2CFOA 1MZBA 2EPFA 1JUMA 4A3FJ 1KU7A 5LBQA 3KX2A 3MKLA 5FRNA 3IH3A 3HSFA 1NHAA 5CQGA 3CJRB 3OY9A 4XBFA 1YRNB 4FHTA 4AIKA 2QYOA 2GG8A 3VSLA 1ZG5A 2ESHA 1DPRA 1AKHA
chains in the Genus database with same CATH topology
4M9SA 4I02A 2BWWA 2P6TA 4B09A 1YQAA 5FCHA 3SZPA 3SXYA 2VE8A 1E2XA 4AVPA 3JTGA 4L9JA 1G3SA 1P4AA 1R5GA 1O3SA 1N51A 2GZ5A 1GXQA 5K5OA 1Z7UA 1QNTA 3M7GA 4OMYA 4FLKA 2ZNYA 4EJTA 2F5EA 4EMSA 3FXQA 3L00A 1IUYA 4EQQA 2EFPA 2UXNA 2CG4A 3O3KA 2WV0A 2FRHA 2CGPA 2K86A 2ZKZA 1XDUA 2LNBA 4HXXA 4AIJA 2PFBA 2XAFA 2KIFA 1OYWA 4U7DA 2BBYA 4GCVA 1RNLA 2Q2EA 5HS9A 2BWXA 4PV4A 5HS7A 1LB2A 4OOIA 4NB5A 3SZTA 4OIRF 1R1VA 4PDKA 1BN5A 4EM2A 3QP5A 3T5XA 1W5TA 2MC3A 4XSZF 4Y13A 5D4SA 3LA7A 1G6NA 3HUGA 5LHHA 4L5JA 2A61A 1MDMA 5AONA 1YS7A 1HW2A 4WWCA 2P7VB 2ZXJA 4FUKA 4IKUA 2HEOA 2GG0A 2M45A 2F2EA 3H92A 1I6XA 2OD5A 3K1PA 4UUVA 1P2FA 2BV6A 4HAMA 5K1YA 3ZMDA 3FMQA 1ZARA 2HYFA 1LJ9A 4YG2F 2X0LA 5DD4A 2A07F 1FWZA 3TO6A 3RYPA 4CO8A 3L7WA 1R36A 3F8BA 4HF2A 3ULQB 4U75A 3PKBA 4KIBA 1U2WA 3F3XA 3JAMK 2YPRA 1S29A 2JTVA 2Z5UA 3KEQA 4KICA 3GXOA 3I53A 1C22A 3J7AO 3E5XA 3WU1B 2EFWA 1Z05A 1O57A 4KN4X 2DPUA 3G73A 2P8TA 3QP6A 3I0TA 3P9KA 2XASA 2VBWA 2GG5A 2PEXA 4M73A 4RGUA 5L3CA 4GYGA 3F8MA 3QU3A 4OOKA 1R22A 2H94A 1WWXA 2QENA 4KT5C 4UVCA 1PUEE 3PKDA 1J9IA 1RIOH 2FNAA 4CICA 3I5UA 1BC8C 1T38A 1USTA 1ZLJA 4I0BA 1HSTA 3HRSA 1P92A 5DEQA 3HIFA 4IKSA 4F7ZA 4A5NA 3V7CA 3Q9SA 1XNZA 4U1BA 4U0YA 5D8LB 2HQNA 3N97A 4U6ZA 5DYMA 2V9VA 1K79A 1I1GA 4LJZF 5L3BA 5DCMB 2O3FA 1QXWA 5CNXA 2FU4A 4EV0A 2CYYA 1O7FA 2O61A 3V8KA 2IW2A 2C6YA 5HVQC 1KQ9A 1LEAA 3MQ0A 3BPVA 1XSVA 2MD5A 1J5YA 2WC2A 1RUNA 4N0BA 1OMIA 3GLXA 3M9AA 3E6MA 3GFJA 1KU9A 2DQRA 2P7CB 4I01A 3B73A 1CF7A 5ICEA 4L9NA 2Y48A 2XUBA 2G6PA 2BE5F 4HDVA 2GAUA 2A5YB 2FE3A 5E17F 1U5TC 2EVMA 2GQQA 3ECHA 3BIPA 2V3ZA 3TO9A 1TNSA 2FSWA 4IF7A 1SFUA 4MTEA 1LDKB 5D5WB 3ZN1A 3GW2A 1U78A 2CWEA 2DO7A 2D1VA 3WTYC 3QPTA 1T2KA 1YTYA 4BXUA 2A69F 1BI0A 2YU3A 1FYMA 4A6WA 2DK5A 4ESJA 4FX0A 2MBFA 5E1ZB 1Q1HA 3TDUC 3ZMZA 4RGSA 4YIFA 1KQ0A 4G8XA 3CUOA 1DDNA 2KIUA 2NRAC 2QUFA 2FBKA 3PQJA 4G7OF 3WTXC 4KNYA 2ISZA 3ECOA 2XAGA 6PAXA 4FO8A 2MH2A 2Y0MA 3GFIA 3V8JA 1J7KA 4MGRA 3PKAA 2PBIA 4ZH4F 2J5PA 3KZYA 2ETHA 3ZMSA 1XGMA 3R4KA 2IPQX 1WI9A 4E70A 3E5UA 1IXCA 2XHKA 3WTVC 4DNCA 3FMSA 3BP8A 1SFXA 3K9TA 1W7PB 3KP6A 2V6CA 2LF8A 4ESFA 5FFZA 3F6OA 3QRFF 2ESNA 2GXBA 2RC4A 4JQFA 1ZRDA 3I59A 4G7ZF 2FNPA 5A2QZ 2O0YA 1XMAA 2IA2A 2L54A 3KP2A 5FD6A 4I7HA 5HDGA 4WF2A 3FWEA 4P55A 4ENMA 2P98A 1C0WA 4IXAA 1B4AA 1HW1A 2MATA 2XAHA 4GXOA 4QLCU 4IHSA 5DCFA 4DQ2A 1PV9A 4U6WA 2GG2A 1TQMA 3TDZC 4G9YA 4EM0B 2Q92A 2KRFA 3V8LA 1PDNC 2GG9A 2GU5A 3CJNA 2P5VA 2QZ8A 2RVCA 4LLLA 4Q47A 5E8IA 4A6EA 2BHCA 5H20A 2P9AA 3KZZA 2B3HA 5TRDA 3WU0A 1XMKA 1G3TA 5CVUA 4FLIA 1WBQA 4RGZ1 3RDIA 3CUQB 4PCQA 3CB6A 2GXGA 4S05A 3P7NA 3FM3A 1ZLKA 3R0JA 4PNCA 3GX4X 2KJBA 4WX9A 1HKTA 1Z91A 3J81K 2BGCA 2RGVA 1H9TA 2CO5A 4LK1F 1R7JA 5LRRA 3ZMTA 3EQLF 3QAHA 1B9MA 1P6RA 4PZJA 5LEJA 3TB5A 2H27A 2DK8A 4TV7A 1R23A 1K78A 1HW5A 3C1DA 3E97A 2GA2A 1OPCA 3HYIA 4AWXB 1F4KA 4YFNF 4PGHA 5KK1A 3WTUC 1TBXA 2PN6A 3JSOA 2Q94A 4KA4A 2DI3A 4BAYA 2JRTA 1B59A 3TKYA 2HOEA 3IL2A 3IU8A 1F5TA 4YIIA 3JTHA 2VBYA 5LEKA 2RDPA 2BWSA 4WXHA 5E20A 2Z33A 2RNJA 4U0WA 1XGSA 3HHGA 5CDLA 4LK0F 2ELHA 2PQ8A 4XRFA 4G6DA 1R58A 4U0VA 2EV5A 5ICFA 5CLSA 3V7SA 3IWZA 3DEUA 2G7UA 3H3UA 4OU0A 4EGYA 2BEOA 1O7LA 2OQRA 1ULYA 2DBBA 4U73A 4ZWPA 3EYIA 1B9NA 4IVNA 3B02A 2V3XA 1IN6A 4A12A 1MDMB 4O5VA 3W6KB 3E6BA 3Q5FA 5E5BA 3GZ6A 4P96A 3BJAA 5E8GA 2NAZA 3FM5A 2UZKA 4MQ9F 4MEYF 1IRGA 3TOBA 2NNYA 4L9VA 3HTUA 3ELKA 4LG0A 3LWFA 4A0XA 4MNUA 1U8RA 2R7DA 5J8CA 5BMZA 2BH3A 5FLXZ 3K2ZA 3ZMUA 1O3TA 1FSHA 4BH9A 4BYYA 3U1DA 2EA2A 3J80K 4UVAA 2ISYA 5DDGA 4BHBA 5BQTA 5LLQA 5HDNA 2A68F 4U69A 3WGHA 5F64A 1KGSA 5FO5A 4FX4A 2XAQA 5CVRA 1SAXA 2CW0F 1KP0A 5ICCA 1Z9CA 3GO5A 2YSRA 3IRQA 3O2PE 3U2RA 4EVIA 4ZYHA 5HS8A 4HF0A 5F6FA 4L9TA 4RZZA 3ZMVA 3PKEA 4MEXF 3R61A 4L18B 4QR8A 5D6EA 3LA2A 3RKXA 3S2WA 2ZMEA 4HW0A 5CVJA 2VBXA 5FB2A 1HXDA 2BYVE 1AOYA 3KP5A 1QXYA 3KP7A 1J2XA 2K4BA 1VTNC 1YYVA 2B0LA 4Y17A 4LB6B 2UWMA 3FMRA 5FD5A 3JSPA 5ERIA 2XRNA 2OU2A 2MLKA 3T8TA 1XN7A 3L09A 1SFEA 5J8FA 1ZAOA 4EGZA 3HHHA 3CB5A 3BPXA 3VODA 4GYIA 1W7VA 2QQBA 2E7WA 3I4PA 3DFGA 3KEOA 1MKMA 1DP7P 3FHZA 1QO0D 2GTXA 3NQOA 3BITA 3TOAA 1HQCA 1UFMA 2OBPA 2HTJA 4O3MA 4KFCA 3KP4A 3RI4A 4ZZLA 1GXPA 4GO1A 1C23A 3T8RA 1U6GA 5IT9K 4HA8A 4I0AA 3RJPA 2HKXA 3WE2A 3P9IA 4XSXF 5AIPA 2HS5A 4LGWA 5KVRA 4CDGA 1BIAA 2QBYA 1PP8F 2K7LA 4ZZDA 3L2CA 3E5QA 5BPDA 3HOSA 5D6FA 1UHWA 3KP3A 1G3WA 1SD7A 3LQRA 3DPTA 1XCVA 3BY6A 1JHHA 1HSJA 3K0LA 2EVOA 3I71A 4ZYGA 2JSCA 3C3WA 2DU9A 1ZHFA 1L3LA 1OYIA 5LHGA 5L3GA 1WQ2A 1GHCA 5FGMA 2PG4A 1A04A 4M9ZA 3FF5A 3M8FA 1ZH5A 5CVIA 2XGXA 4IDYA 4I2OA 3I58A 4U71A 1WL6A 1V3FA 2H6CA 4G7HF 4Y15A 4ON0A 1YW7A 3K69A 2Y75A 4RGRA 1ZREA 1SD6A 2E7XA 2GU4A 1GVJA 4OIPF 3F8NA 4JBAA 1JE8A 3SHFA 1IXRC 3K1NA 2FBHA 4KMFA 2RQPA 4KIFA 2QVOA 1T39A 1IAWA 4U6JA 3CO6C 1YJ3A 4UHTA 3H3ZA 3PQKA 3G3ZA 3DP7A 1E17A 3LFKA 1KYWA 2PLYA 3K1MA 4RB2C 3IC7A 2VE9A 5LGUA 4M6YA 3IHUA 1ZGJA 4HX4A 2BWYA 3CDHA 4U6CA 2XAJA 2RN7A 5BS6A 1W2MA 5JR3A 1HKQA 1BBYA 4ASNA 3GZ5A 3CTZA 4Z2YA 3I59B 1PP7U 2AXLA 4CGZA 2RKHA 5CJ9A 5JVTA 1WRJA 3IU9A 3T1BA 3ISPA 1ONVA 3DPLC 4H0EA 4R8HA 5CDEA 2IA0A 1OKRA 1UHMA 1XGOA 3GUDA 3BIQA 2D1HA 3MCZA 3CLOA 2NNNA 4IF4A 3F21A 4OMZA 2V1XA 3DF8A 3RTRA 3E6DA 3OV8A 1IN5A 2R7FA 5JFRA 2W24A 3CUQC 3F8FA 2DW4A 4FLLA 2HKOA 2HWVA 4CZZA 3PFIA 4U76A 1MD0A 2WTEA 4KN7X 4U70A 3EUHA 2XV4S 3WGGA 1D5VA 4KMUX 1O0XA 3D0SA 5AIQA 2EFNA 2FEZA 3ML6A 2QM3A 4RB3C 3LQQA 4HX8A 4JK1X 1T6SA 2VXZA 1W5SA 2VC0A 1EH6A 1QPMA 3WG9A 2EK5A 1FZPB 1BI2A 1QBJA 4KYWA 1XSXA 1XSDA 2GG7A 3KLNA 4NHJA 1MATA 2H09A 5HOOA 2COMA 1MJBA 3TO7A 3RYRA 1KQ8A 1HKSA 2JPCA 1K78B 2KKOA 5ILSA 4BNCA 2M5WA 3BJ6A 1S8NA 1HBXG 2Z3YA 4EGEA 5L3FA 2MH9A 2Z99A 1YW8A 4M6XA 5HLGA 5ILVA 5DUKA 1D3YA 4YFXF 1ZRCA 1YIOA 2QQ9A 3GYHX 1REPC 2BWTA 3BROA 2PJPA 3IKVA 1YLFA 3IRRA 2FOKA 4RAZA 1W4MA 1W7PD 4PGGA 4UV9A 5CYVA 2GIVA 2G9WA 2DTRA 4S01A 3BDDA 2EVCA 1U5TA 4A0ZA 2EJRA 1I1SA 4S00A 1ZG1A 2OA4A 1CHMA 3FXRA 1D8JA 1AWCA 4WXCA 1BJAA 4MHGA 1X3UA 5DV5A 3I64A 1S7OA 4KM3A 1BI1A 1BOAA 2DLLA 2CSOA 1Y1NA 4B8XA 2O6GE 3KETA 2FQ3A 4OIOF 4RGXA 4Q4ZF 3LAJA 3HSEA 4LG0B 5F1RA 2JT1A 1XGNA 2W57A 3AAFA 1LDDA 2ZFWA 4UVBA 2Q8KA 1BC7C 3ZQ7A 4MATA 1QZYA 2ZCWA 3RPUA 4RZYA 4IKRA 2J5OA 3C7JA 4M9XA 2CQKA 2Z9OA 1WLRA 2M8EA 2BHAA 3MATA 3E3VA 1F1ZA 3R0AA 5D4RA 4MTDA 1MJ9A 4WK8F 2EV0A 3U9GA 1FP1D 3CUQA 1P4XA 4ZYDA 1T0FA 2DAOA 3CTAA 3PKCA 3TGNA 1TTYA 1R5HA 2GZWA 4UV8A 1H0MA 3F22A 5J6XA 2NQ7A 2CFXA 4HDUA 3ZN0A 2IRFG 5K5QA 1C24A 4Q48A 2HR3A 3FXUA 1S6LA 2ZMEB 2GGBA 4S04A 3RIRA 4AIHA 3GF2A 4KIGA 1WY2A 3P9CA 1LDJA 1WKMA 2EWNA 2Q0OA 3V4GA 4L0ZB 3Q6DA 4CHUA 1Z6TA 1FC3A 3R6SA 1J0RA 2EV6A 2OZ6A 2BHBA 3JAMZ 3MFKA 1QQIA 2BB7A 5DD8A 1KA8A 1TQIA 5CDVA 1QZZA 4EJWA 4LD5A 1LVAA 2BWUA 2F5DA 1WSUA 5IT9Z 2V1UA 2XVCA 3RPQA 1BM9A 1TW2A 3EDPA 4U6EA 2VONA 1C21A 4CXFA 4HQMA 1LNWA 2P5KA 5FFXA 2W84A 3VB2A 1KYZA 2IJLA 2L3DA 4I98B 1J75A 2YR2A 5D5UB 3QOPA 1ZN2A 1TNTA 4RS8A 1IRFA 2W85A 3FZVA 3RORA 3NEUA 1UB9A 5K5RA 2QBYB 2IT0A 2ACJA 5CE6A 3IG4A 2ZO4A 1SMTA 4S2TP 1F9NA 1XD7A 5L3DA 2GA1A 3L7GA 1STZA 1O3QA 4ZYEA 1DPUA 3QU6A 5ED4A 2HOWA 2HDCA 2L02A 1YG2A 3ERED 2PMUA 2XIGA 2HFHA 4P5OA 1O3RA 5DUIA 4BHCA 2HZTA 1QGPA 5BPIA 1EH8A 3VFZA 4I09A 3T0YA 1FBQA 4LLGF 3KCCA 1BIBA 2XKPA 4M71A 1H9GA 3DKWA 3L24A 3ABTA 3GFMA 4IHTA 4ESBA 3MAJA 2BN7A 1C27A 1IN4A 1FT9A 3W6JB 2B3LA 2UXXA 3MWMA 5FLXK 4EJOA 4O6JA 4A2UA 3N4MA 1FBSA 4U7BA 1FNNA 4RAYA 4P9FA 1FOKA 4ZWUA 1T98A 2DT5A 1TW3A 3HOTA 4U88A 1JHFA 4IPAA 1DUXC 2DPDA 4N9IA 4GGGA 3SFZA 1UCRA 4G94A 2HTSA 4FKCA 1G3YA 1CF7B 5HLHA 2X4HA 2A6EF 4HLYA 2AS5F 1ZRFA 2ZBKA 3E6CC 5HDKA 2DQLA 2M1BA 1MJAA 1ON2A 1YW9A 1IW7F 4NQWA 2LKPA 4HLXA 4B28A 3R60A 1QXZA 4RB0A 2ZNZA 4A6VA 3GVAA 2P99A 4M74A 2STTA 3HRTA 1CGPA 4OIQF 2K02A 2VT2A 4ENKA 5BOXA 2OAZA 2A3SA 2OKNA 2O03A 3D5LA 5LGTA 4CYDA 2R3SA 4R79A 2VN2A 1Y0UA 1FLIA 1MGTA 2O8XA 4IRHA 4ETSA 4G6QA 2KJCA 1XDSA 2PI0A 1IN8A 1IF1A 1USSA 4LLNA 2FMYA 1IZ1A 4L0YB 1P4WA 2MLGA 2G7HA 1Z1DA 5LRSA 2B3KA 3DV8A 1EV7A 1G4DA 2ZJ2A 4A0YA 2LDUA 3WODF 3IKTA 2ZSGA 3TAVA 1FX7A 4FT8A 5LGNA 1Z6RA 4RB1A 1TLHB 2EB7A 2VT3A 4HOBA 4A5MA 1FBUA 3BOQA 2FXAA 4HF1A 2D2WA 2JZYA 2RV8A 1FSEA 4ENNA 4Q5SF 3HTSB 3KLOA 1JAWA 2KIMA 4A6DA 4UNOA 2H6BA 2E1CA 4HBLA 3SQNA 2EA4A 4R60A 5ICGA 5L3EA 3JW4A 2A6HF 3IU7A 3BWGA 1EH7A 4Z7MA 5DCMA 2P5LC 2LSOA 4ZWOA 2IVMA 5D8KB 1FPQA 4UXNA 5ILUA 2E1NA 1B1BA 4S2RP 2ADUA 4ENJA 1SD4A 4HX7A 3COAC 3WTSC 4WXDA 2TDXA 4HV6A 4HQEA 2VOOA 3S6BA 3BJOA 3HSRA 5E1XA 3O6BB 2DFIA 4KUMA 4K2EA 3HRUA 4WCGA 1YFHA 3KFWX 3GFLA 4AD9A 1FYKA 2Q95A 3MZHA 1S7AA 2GWRA 1SMYF 2XROA 1R00A 2OZUA 4JUQA 3WTZA 1FYLA 4IKTA 5CIKA 3REOA 1RUOA 1R1TA 2HGCA 2VBZA 5EEHA 5IT3A 1RI7A 2HYGD 2L4AA 3I54A 3EYYA 3J81Z 3DXJF 1ODDA 4MQVA 2EFQA 5JI6A 1JGSA 2MA3A 1ZG3A 1K7AA 3C18A 1OR7A 3GWZA 3LAPA 2FBIA 2NS0A 2FA5A 1U5TB 4XLNF 2LF7A 2VOPA 1ZGAA 1SD5A 2V1DA 3NRVA 4EJVA 1L0OC 2XKOA 4BQAA 3LSTA 3FX3A 4XLPF 5FCFA 4HV5A 5D5VB 1JXSA 2QWWA 3M1EA 3WTTC 1FP2A 1RZ4A 4LMYA 5LHIA 5E18F 2M30A 4D0PA 3Q9VA 3LA3A 3GEZA 3MZYA 2GG3A 4P9UA 4FLJA 3F72A 1KU3A 5H6QA 2YX7A 1FY7A 5JHUA 2IW5A 3RKWA 2IP2A 1BI3A 3F23A 3L9FA 4QWQA 5TJJA 1KU2A 1U3EM 2NYXA 3M8EA 3QPHA 2STWA 3ROUA 2BHDA 2IA1A 2V3YA 2PMHA 2W25A 1TQPA 1W7PA 1ZYRF 5HLIA 3V7RA 3MR1A 4ZNGA 4IECA 2F5CA 1IXSB 1D8KA 2BWVA 3ZP5A 2QQAA 1M35A 4IRGA 3F6VA 2D45A 3WTWC 2P6SA 1ON1A 1R1UA 4BHPA 1J59A 3WGIA 3D27A 4FO7A 4OINF 4KDPA 1WL9A 4IU6A 3F8CA 5D5XB 1I5ZA 2K27A 4LFUA 1S3JA 4M72A 1YVMA 4L5IA 1IN7A 4LB5A 2GGCA 3KE2A 3MX6A 5A2QK 3DQVC 4YFKF 1B6AA 2JPBA 2VODA 2FMLA 3IWFA 2EFOA 2NQ6A 1LQ1A 3J80Z 2Q96A 5CVVA 2FF4A 4N9HA 2M87A 2HQRA 2Q93A 4HYEA 1XB4A 3VEPA 4IJAA 3OOPA 3CO7C 4EJUA 5H6RA 1A16A 4IRIA 2L01A 2WWYA 3RVAA 2VC1A 1I27A 3TQNA 3EETA 3BZ6A 2QLZA 5E1WA 3HRMA 2F5FA 4R1HA 3ZPLA 3WE3A 2OQGA 2K4JA 3RKYA 1WN1A 3ABUA 1YO5C 2GU6A 4EM1A 1OYYA 1XCBA 1LEBA 2L4MA 2YX4A 2P4WA 1K6OA 1V4RA 2V79A 3VOEA 2GU7A 4HZFA 1YS6A 5EEGA 3MEXA 1MZBA 1KU7A 5LBQA 3HSFA 1NHAA 4XBFA 4FHTA 4AIKA 2QYOA