1XGNA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 93
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgnA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgnA01
1Y1NA 2EJRA 4G6DA 2MD5A 4AIJA 2DO7A 2O8XA 1R7JA 1FY7A 4LJZF 1QGPA 1FZPB 4RS8A 1BC7C 1WQ2A 5H20A 1FBUA 2E7XA 3LFKA 2YSRA 5BQTA 1ZG5A 4ASNA 4MTEA 3M7GA 1B6AA 5HS7A 1MZBA 1TTYA 5CIKA 2EV0A 3R6SA 2FA5A 4LB5A 3E97A 2VE8A 2P5KA 3R4KA 3GVAA 2XKOA 1D8JA 1DDNA 2B3LA 1W2MA 2VOPA 4ENNA 1IAWA 2CWEA 4HV6A 3TO9A 3TO6A 3H3UA 4KFCA 3V7RA 1J7KA 1DPUA 3OOPA 3LAPA 1JHHA 5K5OA 3EDPA 1OPCA 3FF5A 4D0PA 5BPIA 1AOYA 2JPBA 4L18B 3F6OA 2IW5A 4IVNA 4S00A 3P9KA 1P2FA 3MWMA 3B02A 2E1CA 2BH3A 1QO0D 2EK5A 2BV6A 2XHKA 3GWZA 3WGIA 1S3JA 3EQLF 1SFUA 3ISPA 4MEXF 2RNJA 1YS6A 4ESJA 4HOBA 2YPRA 2EVOA 5J8CA 3DQVC 2QQ9A 4MQVA 2GZ5A 2VT2A 3KETA 3L7WA 4I0AA 4KIGA 4OOKA 2IVMA 4L9VA 4UUVA 1RIOH 5K1YA 4A0ZA 3QPHA 4KICA 3WG9A 2YU3A 2BWXA 1ZGJA 2PEXA 4HW0A 3KP2A 1MJBA 4P9UA 5HLGA 4PZJA 3GZ6A 4KM3A 2BWUA 4U6WA 2FRHA 1PV9A 2OA4A 2K86A 5D4SA 2CSOA 2KIMA 2L02A 1TW2A 4GXOA 2JTVA 1LB2A 1C0WA 3BY6A 2Q2EA 3FM3A 4CICA 4ZWOA 3F8FA 4G9YA 1B9MA 3SFZA 3BIPA 2ACJA 5D8LB 1TQPA 1FBQA 5LHIA 2NQ7A 1O3RA 4AIKA 3ZMSA 4BXUA 5FLXZ 4M9ZA 3REOA 2BE5F 3F6VA 3GYHX 2BWVA 1EV7A 4HQMA 3IC7A 3TDUC 4U71A 3CTAA 1IN5A 2BHAA 1YVMA 2M87A 1F9NA 4FLJA 3HIFA 4HQEA 2JPCA 3GZ5A 3OV8A 1QNTA 2GWRA 1XGNA 3ZQ7A 4N9IA 3DPLC 1SFEA 4CZZA 2A61A 1T6SA 1MATA 4S01A 4ZWUA 3WU0A 3HSRA 3PQKA 4RB1A 2RDPA 5D5WB 4ON0A 1IXSB 4JK1X 3GFMA 4G6QA 4AIHA 1G6NA 4RAZA 2B3KA 2CW0F 3T1BA 1SD7A 3J80K 2R3SA 4A0XA 3J7AO 5LRRA 4ZYEA 5LGUA 5ICCA 1WSUA 2AS5F 4L9JA 1ON1A 3IU7A 2ADUA 3QOPA 3RDIA 3GXOA 2O6GE 2WC2A 3PKDA 2A68F 1R1TA 3KEQA 1P6RA 2DW4A 4ZZLA 3U2RA 5EEGA 1TW3A 2EVMA 2HQNA 1ZRCA 4YIIA 4F7ZA 4RGUA 2Y0MA 2P98A 3LA2A 1S6LA 2NNYA 1UFMA 3C7JA 1M35A 3FXUA 1C22A 3IHUA 4N9HA 2G7UA 2RKHA 1OKRA 1ZAOA 3W6KB 5E1XA 2MBFA 2PMUA 2KKOA 2XVCA 3IWFA 2ZXJA 4M6XA 3GW2A 4LB6B 1WBQA 3SHFA 5F64A 2FOKA 3RYRA 1G3YA 4IRGA 2GG9A 3LWFA 4MGRA 1O7LA 1WKMA 2RN7A 3M8EA 2P8TA 3TKYA 1KU9A 4ZH4F 4EJOA 2FNPA 2EA4A 4PCQA 3T0YA 3CO6C 4HXXA 1W7PD 2FMYA 4ZYHA 1BN5A 2DLLA 2QZ8A 5IT9K 2OD5A 3MQ0A 2YR2A 4OIRF 1L3LA 2D2WA 2W57A 4EGZA 3F21A 1DUXC 5DEQA 5CVVA 3RPQA 4IPAA 4HV5A 5DV5A 3ROUA 2PLYA 3HYIA 2BN7A 2STTA 5KVRA 3ECHA 1F5TA 2YX4A 3QP5A 4Q47A 1O3QA 3MAJA 4EGYA 4LLGF 2P4WA 2CO5A 1BIAA 1FNNA 4ZZDA 2E7WA 1FP1D 2LDUA 3BROA 1P92A 5TJJA 4IXAA 1DP7P 1HW1A 5HDNA 3CO7C 4FO8A 1P4WA 2FBIA 1C24A 4A6WA 4QLCU 3E6BA 2NYXA 4O6JA 3F23A 4U6EA 4FLLA 5DCMA 2R7FA 2IA2A 1KYWA 2E1NA 2VC0A 3R0AA 3MZHA 5ICFA 5JHUA 3WTUC 3WTWC 2BWWA 4EM2A 5LEKA 2GU6A 2V79A 1KU2A 1XMKA 1GVJA 1O57A 3EETA 4G7ZF 2RQPA 5LHGA 2EWNA 4CGZA 1YQAA 3QRFF 3PQJA 4KMUX 2XAGA 2CGPA 2GU7A 2BYVE 4RGZ1 5JVTA 4RGSA 1IRFA 2QQBA 2IT0A 4HAMA 4HX4A 2GZWA 1ZG1A 2CYYA 2D1HA 2NRAC 2MA3A 4XSXF 1GHCA 3V7SA 3GUDA 4M71A 2OQRA 2EFPA 2K4BA 1H9TA 3S6BA 4Q5SF 4P96A 1IF1A 1QZZA 4DQ2A 4MQ9F 2HTSA 1LDDA 2Y75A 3ZMDA 2P5VA 4R60A 2VXZA 1KGSA 2FMLA 4MHGA 1YJ3A 3SXYA 4LK0F 1JE8A 4YG2F 1LEAA 3M8FA 3RYPA 1FYMA 3S2WA 4U88A 1I6XA 4A5MA 3IKVA 1J2XA 3HTUA 2EFQA 4FHTA 1MDMA 3N4MA 3MFKA 1K78A 3BP8A 1IN4A 4B09A 2CQKA 2EV5A 1QZYA 4YFNF 3GFJA 2KJBA 2P7VB 4WXDA 2P7CB 2HDCA 2XRNA 1OYIA 1KQ8A 2L3DA 1IN8A 3B73A 3ZPLA 1WN1A 2FQ3A 4Y15A 4OIPF 2VONA 5IT9Z 3BJOA 3BZ6A 1BJAA 2COMA 3HRUA 3U9GA 4WK8F 4EJVA 3TB5A 2WWYA 1ZRDA 3F8CA 3V8KA 2L4MA 4A6DA 4IKTA 3Q9SA 2RC4A 1B4AA 2VBXA 1HQCA 4PV4A 5DCMB 1I1SA 4R8HA 4XBFA 2EFOA 1XD7A 3L09A 1K7AA 3IWZA 4A5NA 5FD5A 1EH6A 2M45A 1O3SA 3ZN1A 4IRIA 5LHHA 2H94A 4M9XA 2F5DA 1HSJA 2UZKA 1W5TA 1UHMA 1I5ZA 1WY2A 4KIBA 3RKYA 3CB5A 4M73A 3KCCA 2O3FA 3W6JB 3D5LA 4YFXF 4BHBA 3F72A 2VOOA 3HUGA 2HGCA 4WWCA 1I27A 2OQGA 2B3HA 3T5XA 3JSOA 2C6YA 1FX7A 4U0WA 3K2ZA 3L9FA 3IRRA 3LSTA 4A0YA 3K1PA 5CLSA 3E5UA 2PFBA 4KDPA 4IF4A 3IKTA 1LEBA 2A07F 1T2KA 4CXFA 4I01A 3KP7A 1S29A 3IU9A 4MNUA 5FGMA 1SFXA 3HTSB 3H92A 1TLHB 3KZYA 1MDMB 3JAMK 4Q4ZF 3WE2A 1K78B 2GA1A 1PP8F 2EB7A 1XCBA 2BHBA 3I71A 2A5YB 1PP7U 3PKEA 3FMSA 1RZ4A 3LAJA 1FC3A 2W25A 4TV7A 3WTZA 2Z3YA 1LVAA 2LF7A 3HRSA 4I98B 1Z05A 4EV0A 3T8RA 3MEXA 1OYWA 1RUOA 1LDKB 3WTTC 2DAOA 2IP2A 2DK5A 5CJ9A 3WODF 4PGGA 4U1BA 4FT8A 2HEOA 1J9IA 2KIFA 3I58A 4HF2A 4KMFA 1IW7F 4MTDA 3QP6A 1ZRFA 3BITA 5FCHA 2M30A 1ZHFA 2V1XA 2LNBA 2ZBKA 3P9IA 5FD6A 2Z99A 1Q1HA 3FMQA 1YG2A 4B8XA 3NQOA 4CHUA 2V3YA 1CF7A 1P4XA 2DFIA 2BHCA 5AIPA 1LNWA 3TDZC 2FBKA 4JUQA 2O0YA 1O3TA 1HXDA 3G3ZA 1ZH5A 2F5EA 1R1VA 2KRFA 2MH9A 2VE9A 3ABTA 2W85A 5BPDA 2WV0A 2WTEA 2NS0A 4RZYA 4L9NA 2VBYA 3E5XA 2BEOA 4LLLA 1ULYA 2W24A 4HF0A 2FEZA 2P9AA 2A69F 3HSEA 2OAZA 2BWYA 2BGCA 3KEOA 5E17F 2A6HF 3H3ZA 5AIQA 5BS6A 3J81K 4EJWA 2V3ZA 1AWCA 2FU4A 1BC8C 4P55A 2O03A 4P9FA 3GO5A 2PQ8A 3F8MA 1QBJA 5J8FA 4ENMA 3IL2A 4Y17A 1USTA 4UVAA 2XAQA 3O6BB 2EFWA 4IDYA 4U6JA 4Y13A 4LG0A 4RB2C 4OMZA 3WTXC 2OBPA 3JAMZ 4UVCA 3RI4A 3O2PE 3CDHA 4FO7A 1UHWA 1WRJA 2K27A 5D5VB 3ERED 3DP7A 1XN7A 2QUFA 3FWEA 1L0OC 3HRTA 1W7PA 2EA2A 2M5WA 4L0YB 3FXQA 3BWGA 3I64A 3RVAA 4G94A 2PBIA 4EGEA 3QU6A 4U69A 1TQMA 5AONA 2Q94A 4RAYA 1CF7B 4S2RP 5ICEA 4KNYA 1D5VA 5E1WA 4I2OA 1JHFA 1YW8A 5L3GA 1CGPA 1BI3A 3KP5A 2ESNA 1MKMA 1WWXA 5FFXA 2F2EA 3GFIA 2J5PA 5CVIA 3EUHA 3C18A 1ODDA 2D45A 3PKCA 2DBBA 1WL9A 3E6DA 5LEJA 4KA4A 1KU7A 4ENJA 4LK1F 5ILUA 1ONVA 3BDDA 4GGGA 5D6FA 2L4AA 4XSZF 1G3WA 4A6EA 1HKTA 4KN4X 2M8EA 3MZYA 5CVUA 4KUMA 2XV4S 4EJUA 1HBXG 2IPQX 1HW2A 5JFRA 3PKAA 4U76A 1JXSA 2BBYA 5ILSA 4O3MA 4IHTA 1E17A 1U6GA 2XIGA 4O5VA 1N51A 3I0TA 3V8JA 5DD4A 3IU8A 2BWSA 4E70A 3DPTA 1SD4A 4ZNGA 2GXGA 1HKQA 1YO5C 4LG0B 4M74A 3J81Z 2PI0A 2P6SA 1A16A 3GEZA 2VT3A 2Z9OA 4OU0A 3E6MA 1YW9A 3FZVA 3KLNA 5CVJA 5HLIA 3I54A 1W7PB 4KIFA 2HOWA 2R7DA 2ZCWA 1V3FA 3RJPA 3JSPA 5J6XA 2JSCA 4BYYA 2EV6A 1BIBA 3F22A 4P5OA 2EFNA 4HLXA 5DDGA 3LA3A 3DF8A 3HSFA 3ZP5A 1MD0A 2BB7A 4KYWA 1BM9A 5ED4A 1R23A 4U75A 2LKPA 2NNNA 3I5UA 3VOEA 3E6CC 2W84A 2Z33A 3LQQA 1U5TA 4OMYA 1WLRA 3R0JA 5IT3A 4HDUA 1ON2A 4GYGA 3C1DA 1FPQA 2ZNZA 1JGSA 4YFKF 5H6RA 1IXRC 2K7LA 3IRQA 3K9TA 1S8NA 1KQ0A 3VEPA 2Q95A 2X4HA 4L0ZB 2KJCA 3D0SA 2XAJA 3M9AA 2MC3A 2GIVA 2ZKZA 1R36A 3QU3A 5KK1A 3G73A 2Q92A 4S04A 2VODA 2H6BA 1C27A 2QWWA 1QXZA 2DU9A 1YLFA 1ZARA 1T39A 5HLHA 2TDXA 4DNCA 3QPTA 2GGCA 5DCFA 3L00A 3SZTA 1I1GA 2H09A 5FO5A 3TQNA 2GU4A 1X3UA 1T38A 4WX9A 3V7CA 1K79A 4IKRA 4UV9A 4FX0A 3I59B 4BHPA 2HWVA 1C21A 1R5GA 4IKUA 2IA0A 5HS8A 2Q0OA 2CG4A 2G9WA 3Q9VA 3AAFA 3MR1A 3K1NA 5HDKA 1JAWA 1BI2A 1SMYF 3HRMA 1R00A 3ECOA 4HDVA 1PDNC 1QXWA 4QR8A 2QQAA 4EM0B 4L9TA 2GU5A 1ZLJA 1B1BA 3F8NA 1Z9CA 3Q6DA 5DD8A 3JTGA 4PNCA 2ZO4A 2H6CA 4G7HF 4BNCA 2HFHA 2XAFA 3VB2A 4R79A 3U1DA 3DFGA 1YW7A 2ISYA 2K02A 1ZREA 1Z6RA 5HDGA 3K69A 1YS7A 1XSXA 1E2XA 1U5TB 1FLIA 5FFZA 2HOEA 4U70A 4ESBA 1XDUA 2H27A 5FCFA 4RGRA 1HSTA 1MJAA 3ZN0A 3SQNA 3V4GA 1H9GA 1EH8A 1HW5A 1YTYA 5BMZA 1IUYA 4ENKA 4RB0A 6PAXA 2P5LC 4IU6A 2ZJ2A 4YIFA 4AWXB 3BPXA 3I53A 1SD6A 4BQAA 2GA2A 3ZMUA 4NHJA 4U0VA 4LMYA 4M9SA 2GG8A 3F8BA 4JQFA 4H0EA 3BJ6A 2MLGA 3I4PA 2XAHA 1OMIA 3FX3A 5E18F 1ZN2A 4AD9A 1MGTA 2ELHA 4S05A 4K2EA 3TGNA 5L3FA 3KFWX 4U7BA 2GTXA 2D1VA 5LRSA 4FLKA 1T98A 1W4MA 2ZNYA 5K5QA 2JRTA 4XLPF 3CUQB 3DXJF 3T8TA 2VC1A 1VTNC 3SZPA 1GXPA 2QENA 2O61A 1SD5A 4R1HA 5L3CA 2FXAA 2XROA 3L7GA 4XRFA 1J0RA 3CUOA 2V1DA 3WTSC 2ZMEA 2Q96A 4LGWA 2HKOA 2RGVA 5CDEA 3BPVA 1UCRA 4HF1A 5E5BA 1QPMA 1QXYA 1XSDA 1G3SA 1Z7UA 4Z2YA 3HHHA 1YIOA 1D3YA 2ESHA 4HZFA 4HYEA 5D4RA 2Q8KA 2PG4A 3L2CA 2K4JA 2HZTA 2V6CA 3ULQB 3GFLA 1TNSA 4B28A 3TOAA 4IJAA 4IRHA 2PN6A 1YYVA 2XUBA 3CTZA 5HOOA 1P4AA 2Q93A 4EVIA 2FSWA 1D8KA 5DUKA 3JTHA 1EH7A 4U6CA 3IG4A 4I02A 2P99A 3TOBA 4IKSA 3CLOA 4EJTA 4HBLA 5CDLA 4XLNF 2FF4A 1ZG3A 4Q48A 3ML6A 2DT5A 3FXRA 1NHAA 3C3WA 3BJAA 5D6EA 4I7HA 1G4DA 1Z1DA 5D5UB 1TBXA 3M1EA 1LQ1A 5LBQA 1YFHA 2HQRA 2V3XA 2MLKA 3MATA 3F3XA 1O0XA 4KN7X 1Y0UA 2A3SA 2UXXA 3TAVA 3EYIA 2UWMA 3KP6A 1BI1A 4OIOF 3BIQA 5CE6A 1U2WA 4GYIA 5HVQC 2GG0A 4BH9A 4LD5A 1R58A 3PFIA 1FT9A 4HX8A 4IHSA 1SAXA 2ZMEB 4G7OF 3DV8A 4OOIA 5CYVA 5F6FA 1FSHA 2XKPA 3FHZA 1W5SA 4BHCA 4OINF 2ZFWA 3WTYC 5L3DA 3FMRA 3Q5FA 1RI7A 3N97A 1B59A 1FWZA 2QM3A 2PJPA 1G3TA 1RNLA 2JT1A 1TNTA 2QBYA 4KT5C 5HS9A 3ABUA 2DI3A 2F5CA 3WTVC 2DK8A 1FSEA 3EYYA 4CO8A 3ZMZA 3CB6A 2QVOA 4IECA 3VODA 3KLOA 4GCVA 4NB5A 4U73A 3MCZA 2GXBA 2DQLA 1FYKA 1IZ1A 3KE2A 4HX7A 2ZSGA 1XSVA 2FE3A 3E3VA 2M1BA 3JW4A 2VBZA 3DKWA 4CDGA 2DPUA 2HYGD 4L5IA 2BWTA 4FKCA 2GGBA 1U5TC 2GG7A 2DPDA 2ISZA 1PUEE 1XMAA 5L3EA 2G7HA 4I0BA 1BOAA 1MJ9A 1KA8A 2HR3A 5ERIA 2GG5A 3HHGA 2L54A 2FBHA 4EM1A 2LSOA 3ZMVA 2CFXA 3R61A 2IRFG 4RB3C 4MEYF 1KP0A 4PGHA 3L24A 4PDKA 4ETSA 2FNAA 5F1RA 5E8IA 1W7VA 3WGGA 2KIUA 3KP4A 3QAHA 1IN7A 2OU2A 2L01A 2QYOA 2GQQA 4CYDA 1O7FA 3CJNA 1R22A 1FOKA 5ILVA 1KQ9A 3TO7A 4UHTA 2PMHA 4Z7MA 5DUIA 5LLQA 2A6EF 3I59A 2HKXA 3RIRA 2F5FA 4ZYGA 4EQQA 2AXLA 3DEUA 3MX6A 1U8RA 3NRVA 1J59A 4ESFA 2BHDA 4FLIA 1SMTA 1BBYA 4UVBA 4GO1A 4HA8A 4WXCA 1ZYRF 3NEUA 4A12A 3CUQC 5E20A 1F4KA 1LDJA 2V1UA 1V4RA 3KP3A 2QBYB 3VFZA 1GXQA 3ZMTA 1OYYA 1U78A 1RUNA 4U7DA 2OZUA 4HLYA 3K1MA 4WXHA 3GLXA 1F1ZA 3V8LA 2X0LA 1ZGAA 5A2QK 4RZZA 2IA1A 1J75A 2HS5A 4M6YA 2V9VA 2QLZA 3BOQA 2GG2A 5CDVA 3R60A 2EVCA 1KU3A 2OKNA 2RVCA 1R5HA 2P6TA 3RORA 1R1UA 1B9NA 4JBAA 2GG3A 4UXNA 4LLNA 1XB4A 2HYFA 1XNZA 3J80Z 3D27A 3P9CA 4AVPA 4S2TP 4BAYA 3O3KA 4N0BA 1C23A 3WE3A 2HTJA 5TRDA 4U0YA 1S7AA 2NAZA 4FX4A 3GX4X 2IW2A 1WL6A 1DPRA 5EEHA 2ETHA 2LF8A 1OR7A 4MATA 2IJLA 2Y48A 5CVRA 4U6ZA 1FP2A 3WU1B 1A04A 3COAC 1TQIA 1CHMA 4A2UA 1H0MA 1WI9A 4EMSA 3HOTA 3K0LA 4L5JA 3RKXA 5E8GA 5FB2A 1XCVA 3P7NA 1IN6A 4A6VA 4UV8A 3WGHA 1LJ9A 2J5OA 3RTRA 4IF7A 5JI6A 5LGTA 3PKBA 2YX7A 3CUQA 1XGMA 4RGXA 2RV8A 3E5QA 2STWA 3FM5A 4UNOA 3ELKA 2Z5UA 5L3BA 1QQIA 1Z91A 5CNXA 3GF2A 1HKSA 1REPC 4FUKA 1XGSA 4M72A 1J5YA 1Z6TA 2XGXA 4WCGA 1XGOA 4WF2A 1XDSA 1IXCA 4ZWPA 1K6OA 4QWQA 1U3EM 2DQRA 2UXNA 2GAUA 1ZLKA 2VBWA 5E1ZB 4NQWA 1STZA 5BOXA 3HOSA 5JR3A 4OIQF 5DYMA 1KYZA 2DTRA 4G8XA 1T0FA 5D5XB 5A2QZ 2G6PA 3KZZA 5D8KB 3LA7A 1FYLA 1UB9A 3LQRA 5ICGA 1BI0A 2OZ6A 5LGNA 1S7OA 5H6QA 4ZYDA 2JZYA 1FBSA 3RKWA 4LFUA 4I09A 1IRGA 5K5RA 2NQ6A 1USSA 3RPUA 2XASA 2MH2A 2B0LA 2VN2A 5FLXK 2MATA
chains in the Genus database with same CATH superfamily
2M8GX 4M3DA 2JQ7A 1Y1NA 2EJRA 3S3OA 4G6DA 2MD5A 4AYBA 4AIJA 2DO7A 2O8XA 5J1UA 2KISA 4XQFA 1R7JA 1FY7A 4LJZF 1QGPA 1FZPB 4RS8A 1BC7C 1WQ2A 5H20A 1FBUA 2E7XA 3LFKA 2KMUA 4LIUA 2YSRA 2BW3A 1S72I 5BQTA 1ZG5A 4ASNA 4MTEA 3M7GA 1B6AA 5HS7A 1MZBA 1TTYA 5CIKA 4CCJA 1ZQ3P 2EV0A 5HNFA 3R6SA 2FA5A 4LB5A 3E97A 2VE8A 4A3IJ 1EKEA 1LFBA 4ANJA 4ABZA 3ZQCA 2P5KA 2HDWA 3GVAA 2XKOA 3R4KA 1D8JA 5HNHA 5DS9A 1DDNA 2B3LA 3ABLH 2VOPA 4ENNA 1W2MA 1X1DA 2LLKA 1A31A 1IAWA 2CWEA 4HV6A 3TO9A 1FEXA 3TO6A 3PSIA 3H3UA 4KFCA 3V7RA 1ERDA 2ECCA 1J7KA 3OYMA 3OOPA 3LAPA 2HOTA 1DPUA 3VYSB 1JHHA 5K5OA 1A6QA 3EDPA 1OPCA 2V4JC 3FF5A 4D0PA 5BPIA 2IS1A 1AOYA 2VPLA 1RESA 4MO7A 1EF4A 2YUSA 2JPBA 4L18B 3F6OA 3L2WA 2IW5A 4IVNA 4S00A 3P9KA 2ID3A 3Q0VA 5J40A 1A5JA 4JP0A 1FMWA 2W7NA 2LR8A 1P2FA 3MWMA 3B02A 2E1CA 2BH3A 1QO0D 2EK5A 2BV6A 2XHKA 3GWZA 1QU3A 3WGIA 1ZGWA 4E7JA 4PJNA 3CMAI 1S3JA 3EQLF 1SFUA 3ISPA 4XRMA 4MEXF 2RNJA 4CCLA 1YS6A 2DN0A 5IP9J 4ESJA 4HOBA 4IQJA 5IOZA 4XN0A 2YPRA 2EVOA 5J8CA 3DQVC 2H1KA 2QQ9A 4MQVA 1O4XA 2GZ5A 2VT2A 2PMZA 3IH4A 3KETA 3L7WA 1WI3A 4I0AA 4KIGA 4OOKA 2IVMA 1X1BA 4L9VA 4UUVA 4BU2A 1RIOH 5K1YA 1IJWC 4A69C 4A0ZA 3QPHA 4KICA 3WG9A 2YU3A 4X6AJ 2LY9A 4IL6C 1T56A 2KRHA 1ZGJA 3OOUA 2BWXA 2PEXA 1LE8B 4HW0A 4BL0B 1U0JA 3DPUA 3KP2A 1MJBA 2DOEA 4P9UA 5HLGA 4G12A 4PZJA 3GZ6A 4KM3A 2BWUA 4U6WA 2FRHA 1HDPA 3M3YJ 2XGCA 1PV9A 1U9NA 1ETWA 2OA4A 3HUGB 2EQRA 2K86A 5D4SA 4IZZA 2O9LA 5E3NA 2CSOA 3BZKA 2D5VA 2KIMA 2CW7A 2L02A 3U1KA 1TW2A 1XS9A 4GXOA 2JTVA 3RSNA 1LB2A 3NWSA 1C0WA 3C2GA 3BY6A 2Q2EA 3FM3A 3CCRI 3HGYA 4CICA 2HVQA 2KP6A 4ZWOA 2JN6A 3F8FA 1U8BA 4G9YA 3SEZA 2WADA 1B9MA 5CKTA 2BW3B 2VKEA 3SFZA 3BIPA 2EBIA 2ACJA 5D8LB 1TQPA 1EA3A 1OCPA 4UB6C 1F36A 1FBQA 5M5YJ 4GRIA 5LHIA 2NQ7A 1O3RA 4AIKA 5J4VA 2NVUB 2LRDA 4A3LJ 2R0QC 3ZMSA 4XK4A 4BXUA 3W2VA 5IP7J 5FLXZ 3M1CA 1NG6A 2XB5A 3BC8A 3OL4A 3AKZA 4M9ZA 3REOA 2R7SA 2BE5F 3F6VA 3GYHX 2BWVA 1EV7A 4HQMA 3IC7A 3TDUC 4U71A 2Q1ZB 2ZB9A 1GV5A 3CTAA 1ZR2A 1IN5A 5B5EC 2AHQA 4QTRA 2BHAA 2NS7A 2WB1N 1YVMA 2M87A 1F9NA 4MIMA 4FLJA 5FKOA 2VJ5A 3HIFA 4HQEA 1Z21A 2JPCA 3GZ5A 1YITI 3OV8A 1QNTA 1BW5A 2GWRA 2VQLA 1XGNA 3ZQ7A 3GMEA 1FIAA 2X1CA 4N9IA 3DPLC 1SFEA 3BG9A 4CZZA 4CH7A 2A61A 1T6SA 1MATA 4S01A 4ZWUA 1IGNA 3NARA 3WU0A 3HSRA 3PQKA 1MNMC 4RB1A 3GTPJ 2RDPA 5D5WB 4ON0A 1IXSB 4JK1X 3GFMA 4G6QA 5F0HA 2CV2A 4AIHA 3Q3SA 1G6NA 2DMQA 4FETA 4RAZA 4JYKA 2B3KA 2CW0F 2OF7A 2HYJA 4DOZA 2LD5A 1IC8A 3T1BA 1SD7A 2EILH 3J80K 1IDYA 2R3SA 4A0XA 3J7AO 5M3FJ 4M3FA 1AKHA 5LRRA 5JLXA 3ZQQA 2VB6A 2Y9YA 2L2OA 3N05A 2M7BA 4XRSA 4ZYEA 5LGUA 5ICCA 4XORA 1WSUA 2AS5F 2DMUA 4L9JA 4QPOA 1ON1A 3IU7A 2ADUA 4DYQA 2DT7B 4A3MJ 3OWTA 3OYBA 4IHYA 3QOPA 4XM3A 1MH3A 3RDIA 4B48A 1DU0A 1JKPC 3FHNA 1SAUA 4D5FA 3GXOA 2O6GE 2WC2A 3PKDA 2A68F 1R1TA 1TWGJ 1SANA 5H2FC 3KEQA 3SFIA 1P6RA 2DA1A 2DW4A 3SZGA 4ZZLA 3U2RA 5EEGA 3JRGA 3CC7I 1TW3A 2EVMA 2HQNA 3JRAA 3VYRB 1ZRCA 4AC0A 2R7VA 3A0BC 3AL0B 4YIIA 4F7ZA 4RGUA 2Y0MA 4EEFG 2P98A 3LA2A 4D1QA 1BR1A 1S6LA 4FE7A 2NNYA 1UFMA 4OWRB 3C7JA 5JHFA 1M35A 3EUKL 3FXUA 1FMVA 4JX4A 4NUBA 1C22A 2W00A 3IHUA 2XPUA 4N9HA 2G7UA 2RKHA 1OKRA 1ZAOA 2EIKH 4NC7A 3W6KB 4BJ5C 1DGRM 2DT6A 5E1XA 2R7ZJ 2MBFA 2PMUA 2KKOA 3OYJA 1JT6A 2XVCA 3IWFA 2ZXJA 4M6XA 4BDZA 4KITB 3P5JA 2LBFB 3GW2A 4LB6B 1TZLA 3CCSI 3SHFA 1WBQA 2X6WA 5F64A 1RR8C 2FOKA 2MGQA 3H9JA 3RYRA 3A01A 1G3YA 1MNEA 4IRGA 1SC7A 2GG9A 3LWFA 4MGRA 3S2DJ 1O7LA 3FDYA 2L9NA 2IGOA 3OR1C 1WKMA 2E5ZA 2AXTC 2XAUA 2RN7A 3M8EA 3J7ZI 2P8TA 3DBLB 3TKYA 3S32A 1KU9A 4AM3A 4ZH4F 4EJOA 2OTJI 2FNPA 2JJ7A 2BOLA 2EA4A 3K6GA 4PCQA 4XLAA 3T0YA 3CO6C 4HXXA 3CCQI 5CQGA 2LKSA 2YS9A 1W7PD 1HA8A 1FJLA 2FMYA 4ZYHA 1BN5A 4B44A 2L0KA 2DLLA 2QZ8A 3CJTB 2OD5A 5IT9K 3MQ0A 2YR2A 4E7IA 4F92B 1NK3P 4OIRF 1L3LA 4X1EA 2D2WA 2W57A 4EGZA 3F21A 4UB8C 1DUXC 5DEQA 1LFUP 1ETOA 5CVVA 3RPQA 3I4MJ 3S1NJ 1WFXA 4IPAA 4HV5A 5DV5A 3ROUA 2PLYA 2JA6J 3HYIA 2BN7A 3AG4H 1LUJB 5IYCJ 1W0UA 1YRNA 1JUSA 2DJIA 2STTA 5EG0A 5KVRA 2KQRA 4BE2A 3K4MA 2EIJH 3ECHA 1F5TA 4M3EA 1TT0A 1OFCX 4PFOA 2YX4A 3QP5A 4XICA 4Q47A 1O3QA 3MAJA 4EGYA 5C4XJ 4LLGF 2P4WA 4IKFA 4A93J 3LSGA 2CO5A 1BIAA 1FNNA 4ZZDA 3LSJA 2E7WA 1FP1D 2LDUA 3BROA 1P92A 5EJCA 1K4TA 5TJJA 2R5ZB 4IXAA 3NAUA 1DP7P 1HW1A 5HDNA 3CO7C 4FO8A 1P4WA 2FBIA 2NOGA 1AKHB 1WJEA 2R93J 3SEQA 1SEUA 1C24A 3IUOA 1JUPA 4A6WA 3ZQIA 2CRGA 4QLCU 3E6BA 3HG9A 1PUFA 3JRFA 2NYXA 4O6JA 2V9KA 3F23A 4BEHA 4U6EA 3ERMA 4FLLA 2NVYJ 5DCMA 2R7FA 3GTLJ 2IA2A 4CCOA 2MSYA 3DBRB 1KYWA 2E1NA 2BZTA 3K4KA 5TGTA 2VC0A 3R0AA 3MZHA 1QVUA 5ICFA 5JHUA 3WTUC 4CZCA 1H8AC 3WTWC 2HZDA 5F1JA 2BWWA 4H4KC 2E2IJ 2JMWA 4EM2A 4XLHA 5LEKA 1WJBA 3FXOA 3H0DA 2GU6A 2V79A 4DZJA 2E19A 4C2TA 1SFKA 1KU2A 1XMKA 1GVJA 1O57A 2F48A 3EETA 1QZEA 4G7ZF 2RQPA 2VUMJ 3K4NA 3OYIA 5LHGA 2EWNA 3KIOA 1YQAA 4CGZA 3QRFF 2KHMA 3PQJA 4KMUX 2XAGA 2CGPA 2GU7A 2BYVE 4RGZ1 5JVTA 2Y0SN 5GTHC 4RGSA 1IRFA 2QQBA 3BQYA 2IT0A 4HAMA 4HX4A 2GZWA 1ZG1A 1UELB 2BXYA 1ETXA 4Y33A 2CYYA 1POGA 2D1HA 2IBDA 2NRAC 2YU9J 3DEEA 3I9V2 2MA3A 4XSXF 1GHCA 1ZR4A 3V7SA 2TCTA 3GUDA 4M71A 3A01B 2H1LA 2EFPA 2OQRA 3BR2A 1Y0NA 1WH7A 4XKVA 2COBA 2K4BA 1H9TA 3S6BA 4Q5SF 4P96A 1IF1A 1QZZA 2CQXA 4DQ2A 4MQ9F 2HTSA 1LDDA 1RR7A 2VQHA 2Y75A 5K7HA 3ZMDA 2P5VA 4R60A 2VXZA 4FE4A 1KGSA 1WGXA 4A3EJ 1E3PA 2FMLA 4MHGA 2V26A 4N4OB 1YJ3A 3SXYA 2ELJA 1V54H 4LK0F 2EZIA 1JE8A 3QODA 3PIOF 4YG2F 1Y39A 1LEAA 3M8FA 3RYPA 1FYMA 3S2WA 4NC6A 4U88A 3LL7A 1I6XA 4A5MA 4PUSA 3IKVA 1J2XA 3HOXJ 3HTUA 2DA3A 2EFQA 4FHTA 1MDMA 1R71A 3N4MA 2QKLB 3MFKA 1N25A 1K78A 1FOYA 3BP8A 4BQNA 1IN4A 4B09A 5EGOB 3H9QA 2QF7A 2CQKA 4DBQA 2EV5A 1QZYA 4YFNF 3GFJA 3HJEA 2KJBA 2WAQA 2P7VB 4WXDA 2P7CB 3GTQJ 2HDCA 2JK3A 2XRNA 3OYAA 1OYIA 3DU5A 2JA2A 4PFPA 3BCBA 5TISC 2L3DA 1KQ8A 1IN8A 3B73A 3ZPLA 1WN1A 1QPIA 2FQ3A 4Y15A 4OIPF 3WHBA 1SVOA 3CCVI 2VONA 5IT9Z 3BJOA 2ZXHA 1W5CC 2HQ5A 3BZ6A 2JSPA 1BJAA 3A03A 2L9SA 4N4NB 2COMA 3HRUA 4B43A 3U9GA 4WK8F 4I76A 4OAZA 4EJVA 3TB5A 3L2RA 2WWYA 1ZRDA 3F8CA 3V8KA 2L4MA 4A6DA 1PUFB 3VYTB 4IKTA 2E60A 3Q9SA 2RC4A 1B4AA 2VBXA 1HQCA 4JOMA 4PV4A 2KZGA 5DCMB 1I1SA 2LMDA 4R8HA 2B9SA 4XOTA 2EFOA 4XBFA 3J7AY 1XD7A 3L09A 1K7AA 4ZDOA 3IWZA 4A5NA 2E35A 5FD5A 1EH6A 2F6CA 4UUSB 1A35A 2DCEA 2WA0A 2M45A 2IGNA 1O3SA 5E79C 3ZN1A 3OSFA 4PK4A 4IRIA 3SDGA 2ME6A 5LHHA 2H94A 2VJJA 4M9XA 4E6KG 2F5DA 3BTCA 1HSJA 1NG7A 2UZKA 2A5WA 2R7OA 1ZKGA 1Z7LA 3JR9A 3FXJA 1W5TA 1UHMA 2EZKA 1I5ZA 1PYVA 1WY2A 4GDFA 2K9QA 4J01A 3PJRA 5KNLA 1GUUA 4KIBA 2IXSA 3RKYA 2BVMA 2M4GA 3CB5A 4M73A 3KCCA 2BXZA 2O3FA 3W6JB 2FX0A 3D5LA 3ZR8X 4YFXF 4A3CJ 4BHBA 3F72A 2VOOA 3JRHA 3M07A 1LKXA 1WZ2A 3HUGA 2K9LA 1YE9A 2QSHX 1LPQA 2AQEA 2HGCA 4WWCA 1I27A 2K40A 2DDAA 2OQGA 2X6YA 3S1MJ 2B3HA 3T5XA 3JSOA 3MVPA 2C6YA 1FX7A 4U0WA 3K2ZA 3L9FA 2OCCH 1VI0A 1MBFA 1V5FA 3IRRA 3LSTA 4ZTJA 3AL0C 4A0YA 3K1PA 5CLSA 3E5UA 2PFBA 3FKIJ 2WAEA 5B3SH 3MKWB 4IF4A 3IKTA 4KDPA 1LEBA 2Y31A 2A07F 1ETKA 1T2KA 2XPWA 3S1RJ 4CXFA 4I01A 4XRSG 3KP7A 4XMYA 4B3AA 1S29A 3IU9A 4MNUA 1MIJA 4PJMA 4BE0A 2ZFUA 4JX5A 1SFXA 5FGMA 1Y8QB 3HTSB 3H92A 1S7EA 1TLHB 3KZYA 3GLLA 4CCNA 3JAMK 1K61A 1MDMB 4Q4ZF 2MW8A 3WE2A 3G6EI 4IO9F 1K78B 2GA1A 5EDNA 1PP8F 1S9HA 2EB7A 1XCBA 3SDBA 1P9QC 2BHBA 4E7KA 4IOAF 3I71A 2A5YB 1W36D 1PP7U 3PKEA 3FMSA 1RZ4A 3LAJA 1FC3A 1VQ8I 2W25A 4TV7A 3K2AA 3WTZA 2Z3YA 1E0EA 1LVAA 4E4HA 3CC2I 2K3FA 2LF7A 3G1MA 4AVZA 3HRSA 4I98B 4E7SA 1Z05A 3GTKJ 1F43A 2E1OA 2VI6A 3D5RC 3T8RA 4EV0A 1WJCA 3S14J 3ZXSA 2X1EA 3MEXA 1OYWA 4YELA 1RUOA 3HDDA 1LDKB 4ZYAA 3WTTC 1YJ9I 2DAOA 2IP2A 4F93B 3BG5A 2DK5A 2QCOA 5CJ9A 3WODF 4W1UA 3OL3A 4PGGA 3W2AA 2CJJA 4U1BA 4FT8A 2HEOA 5LFAA 1J9IA 2KIFA 3I58A 4IHVA 3NWTA 4HF2A 4KMFA 1IW7F 3A1YA 2E36A 4MTDA 3OYEA 3QP6A 1ZRFA 4RLFA 4RA2A 1QHHD 3BITA 1KONA 5FCHA 2M30A 1ZHFA 2V1XA 2LNBA 2ZBKA 3P9IA 5FD6A 2MD0A 2Z99A 1Q1HA 3FMQA 1YG2A 4B8XA 3J7YJ 3NQOA 5M3MJ 3CQZJ 3BTIA 4PJLA 4CHUA 5F08A 2V3YA 1CF7A 1P4XA 2DFIA 2IEKA 2BHCA 5AIPA 1LNWA 3TDZC 2FBKA 2JA8J 2BHZA 4JUQA 3CCMI 1T8IA 2O0YA 2HXOA 3BZCA 1TWAJ 3PNVA 4MFEA 2UUZA 4C3IJ 1HDDC 2OV7A 3FK7A 1HXDA 1O3TA 2FOWA 4ZDPA 3VSLA 3G3ZA 3K70C 1ZH5A 2F5EA 1R1VA 2KRFA 2MH9A 2VE9A 3ABTA 4BY1J 2W85A 5BPDA 1VQ6I 3CJQB 2WV0A 1I6HJ 2WTEA 2NS0A 3CP2A 5F0CA 4BGDA 4JX6A 4RZYA 4L9NA 1WCMJ 5IOYA 2VBYA 1B72B 3E5XA 2BEOA 4LLLA 3LSIA 1ULYA 2W24A 4HF0A 2FEZA 2P9AA 3GCMA 1R4MB 4XKWA 2A69F 4XLCA 1YX3A 3HSEA 2OAZA 2BWYA 2BGCA 3KEOA 5E17F 4S0HB 1HF0A 2LBFA 2A6HF 1G8XA 1XMXA 3H3ZA 1QVTA 5AIQA 2H8RA 2M9HA 3HOWJ 5BS6A 3J81K 4EJWA 1MBGA 1KZHA 2V3ZA 1AWCA 2FU4A 4Y52J 1BC8C 4P55A 1E3OC 2O03A 4P9FA 2DOAA 3A02A 2M2EA 3GO5A 1WJDA 2PQ8A 2XRLA 4FASD 2BY3A 4A3KJ 3F8MA 1QBJA 3A0HC 5FKLA 3HPHA 4ZC3A 2VJ4A 4F55A 5J8FA 4ENMA 2JRMA 4D5CA 3IL2A 5CPRB 1D0XA 4Y17A 1USTA 4RMNA 2LC2A 4UVAA 2XAQA 3O6BB 1WPKA 2EFWA 3PIPF 4IDYA 2GOMA 4U6JA 3FXKA 1WH5A 2CV0A 4CA0A 4Y13A 3CCEI 2IS2A 4DJAA 2CQNA 1HLVA 4LG0A 4RB2C 1FOXA 4OMZA 3WTXC 2OBPA 3TW7A 3JAMZ 4UVCA 2W4SA 3RI4A 3O2PE 4C2MJ 4B47A 1GDTA 3CDHA 5GAEJ 1VQPI 1UHWA 4FO7A 2F4OB 1R9TJ 3LSRA 1WRJA 5J1RA 1XPXA 2K27A 3HOZJ 1MNDA 1MBHA 5D5VB 3DP7A 3ERED 1XN7A 2R4GA 2QUFA 3RCOA 3FWEA 2HQAA 1L0OC 4F91B 4IEJA 2GM4A 4BUPA 1MW7A 4II2A 5JVGF 3HRTA 1W7PA 2EA2A 2M5WA 4KT6A 4L0YB 3K4BA 2R5ZA 4BE1A 3PNTA 3FXQA 1Z3YA 3BWGA 3I64A 2M0MA 2KT0A 3DTIA 4G94A 3RVAA 2PBIA 4EGEA 4HG2A 2DFHA 3QU6A 2FD5A 4U69A 5E3OA 2DMPA 3DLLF 3FXMA 2JUGA 5KCMA 1TQMA 1UHSA 5AONA 2Q94A 4RAYA 1CF7B 4S2RP 5ICEA 4KNYA 1D5VA 2ZJRF 4AYBN 5E1WA 4M6VA 4I2OA 4RM3A 1JHFA 1JKOC 1YW8A 5L3GA 4ZJZA 4E7LA 1CGPA 1BI3A 3KP5A 3OYNA 2ESNA 1MKMA 2QGUA 1WWXA 1JTXA 5FFXA 1JTYA 1IV6A 3Q0UA 2CH0A 2F2EA 5FROA 1TL8A 3GFIA 3OYCA 2J5PA 4U87A 5CVIA 3EUHA 3C18A 1ODDA 4XLEA 3MKYB 4AIDA 3JRBA 2VKDA 2D45A 3PKCA 2DBBA 1WL9A 5K7FA 1VQ4I 3E6DA 4PSWA 5LEJA 1N78A 4KA4A 1KU7A 4ENJA 3IV5A 4CUGA 4LK1F 5ILUA 1ONVA 2FQ4A 2G0EA 3BDDA 4GGGA 3CDIA 1G59A 5D6FA 2L4AA 1W0TA 4XSZF 1G3WA 4A6EA 1HKTA 3ZGKA 2DDBA 5B1BH 2PJRA 3BR0A 4KN4X 1X58A 2M8EA 1ETVA 1GLNA 3MZYA 4KUMA 5CVUA 2XV4S 3K4CA 4EJUA 1HBXG 2IPQX 3CMYA 1HW2A 4V2GA 2ZXWH 5JFRA 3PKAA 2I5UA 4U76A 3MMYB 4DZPA 1UAAA 3K4JA 1JXSA 1Z3XA 2BBYA 5ILSA 1X4OA 1M1EB 4O3MA 2KDOA 4IHTA 1E17A 2P81A 5K7ZA 3BR3A 4I6ZA 1U6GA 1V5GA 2XIGA 2R7XA 1Z0XA 2RNGA 4BQOA 3FK6A 2KLOA 4O5VA 3S8PA 1N51A 4XONA 3I0TA 3V8JA 5DD4A 3JCUC 3IU8A 2JWTA 2BWSA 4E70A 3DPTA 1SD4A 3A4CA 4ZNGA 2X9DA 3LSHA 3CMEI 1BR4A 2PMZN 2GXGA 1HKQA 2ME0A 1YO5C 1I3AA 2B7EA 4LG0B 4M74A 3J81Z 5EGOA 1MMGA 2PI0A 2P6SA 1A16A 3GEZA 2CQ7A 2VT3A 4YRVA 2Z9OA 3S17J 2OPTA 3TP3A 1VQ7I 4OU0A 3H5RA 3E6MA 1IDZA 1YW9A 3FZVA 1K83J 3PNYA 3WHCA 1PJRA 3KLNA 3LSMA 3CC4I 2ZSIB 2HOSA 4Y3OA 2V9PA 4CSWA 1U9OA 1YX5A 3TBIA 1OQYA 5CVJA 5HLIA 3I54A 1W7PB 4KIFA 4A3DJ 2HOWA 2HVRA 3L2QA 1JKRC 2R7DA 2ZCWA 4BS9A 1V3FA 3RJPA 3JSPA 4BDYA 5J6XA 2JSCA 4BYYA 2EV6A 1VQLI 3ZQGA 1BIBA 3ESWB 5DTDA 3F22A 4YIRX 1A6IA 1V5EA 3D1NI 4DW6A 2Z16A 4P5OA 2EFNA 1TWFJ 4HLXA 1Y56A 2DJNA 5DDGA 3LA3A 3DF8A 3DWLE 4AUXA 3HSFA 3CCLI 2E71A 3ZP5A 1MD0A 2BB7A 2DXIA 4B4CA 4UUSA 1A36A 4DGWB 4KYWA 3G4SI 2HI3A 1BM9A 3I55I 5ED4A 1H88C 1R23A 4U75A 5IY5H 2LKPA 5EZHA 2NNNA 3I5UA 3VOEA 1I50J 3L1PA 1W36C 3E6CC 2W84A 3PM1A 3BR1A 1Y6IA 3H36A 2CS3A 2Z33A 3LQQA 1U5TA 5FLMJ 2BY0A 4OMYA 3DEWA 1WLRA 3R0JA 5IT3A 4HDUA 1ON2A 9ANTA 4GYGA 3C1DA 1T33A 1FPQA 2LOOA 2ZNZA 1JGSA 2HXIA 4YFKF 5M5XJ 1WHUA 5H6RA 1IXRC 2K7LA 3IRQA 3VPRA 3G71I 1ZK8A 3K9TA 1X1CA 1S8NA 1KQ0A 3VEPA 2Q95A 3HOVJ 2X4HA 3OSGA 2PJRB 4L0ZB 4HEA2 1H89C 2KJCA 3D0SA 3S15J 2XAJA 3M9AA 2MC3A 2GIVA 2IAIA 5EZGA 3GTGJ 3KYLA 2HVSA 5FKNA 2WY7Q 2ZKZA 4HSRA 1R36A 2R92J 5GAGJ 3QU3A 4FTHA 5KK1A 3G73A 2Q92A 4S04A 2VODA 2H6BA 1C27A 2QWWA 1QXZA 2DU9A 1YLFA 1ZARA 4V19K 3G2BA 1T39A 2L7MP 5HLHA 2TDXA 5FRMA 4E7HA 4DNCA 3QPTA 2GGCA 5DCFA 1QA6A 3L00A 3SZTA 2OUMA 3QYBA 1I1GA 2H09A 5FO5A 4PJJA 3TQNA 1GV2A 2GU4A 3K4LA 4IX7A 1X3UA 2L9VA 1T38A 4WX9A 3RKQA 1R5ID 3CESA 3V7CA 1K79A 4IKRA 4UV9A 4FX0A 3ZOBA 3I59B 4BHPA 2A6TA 2HWVA 1OCCH 2NVTJ 2VPRA 1ZELA 1C21A 2DOFA 2Y69H 1R5GA 1VFCA 2DMTA 4IKUA 2IA0A 4RBOA 5HS8A 2XGDA 2Q0OA 1MBEA 2CG4A 2G9WA 3Q9VA 2KFDA 3AAFA 1JJ6C 3MR1A 3K1NA 3CF2A 2XSJC 5HDKA 1JAWA 1BI2A 1SMYF 3HRMA 5GTIC 2E5NA 2Z1DA 2NOJB 3S93A 1CQTA 1R00A 3ECOA 2GXAA 1IRZA 4HDVA 1PDNC 3AFHA 3L2UA 1QXWA 1YJWI 2XB0X 4D9JA 4QR8A 2HOAA 2QQAA 1MMDA 4L9TA 2VKVA 4EM0B 2GU5A 1ZLJA 1B1BA 2I10A 2XF7A 3F8NA 4C3HJ 4IOCF 1NTCA 3UR3C 1Z9CA 2VL8A 1D0YA 1G2HA 2W48A 3Q6DA 3ZQHA 5DD8A 3JTGA 4PNCA 1HC8A 2ZO4A 3W2WA 3EPZA 2H6CA 2KRCA 4G7HF 1Z67A 3H0GJ 3ASNH 2AO9A 1BR2A 2ZXIA 2Z2SB 2HFHA 4BNCA 4ITVA 2XAFA 3VB2A 1MSFC 4R79A 3U1DA 2DA2A 3DFGA 1YW7A 2ISYA 2K02A 1ZREA 3K7AJ 2KDZA 3AG2H 3OYLA 1Z6RA 2LREA 5HDGA 1RKTA 3K69A 1YS7A 2WB1A 1XSXA 3TEDA 1E2XA 1U5TB 1FLIA 2EINH 5FFZA 3CP8A 3OY9A 2HOEA 3E0JB 4U70A 4ESBA 1P7IA 1XDUA 2H27A 5FCFA 3JRIA 1OJLA 1UG2A 2VASA 4RGRA 3V42A 4M3BA 4GFBA 4BBRJ 1HSTA 3BR5A 1MJAA 2EZLA 3ZN0A 1RC9A 3SQNA 3PL8A 4F52A 3V4GA 1WJFA 1Q1VA 1EH8A 1H9GA 2Y9ZA 2JA5J 3HC7A 1K4SA 1HW5A 2XPVA 2QQ8A 4BJTA 3OYFA 4DYCA 1YTYA 4L5EA 2M34A 5BMZA 4RAFA 1IUYA 4ENKA 2L7KA 2KPMA 4RB0A 6PAXA 5F04A 2P5LC 4BBSJ 4IU6A 1B72A 2ZJ2A 2EPFA 2R7WA 4YIFA 2OCEA 4AWXB 1IG7A 3BPXA 3BQZA 3LSKA 5DM7F 1JT0A 3I53A 5GAHJ 5GPAA 1SD6A 1HCRA 3IH2A 3CJRB 3ABMH 4BQAA 2GA2A 3ZMUA 3A2KA 4NHJA 4U0VA 4LMYA 4M9SA 2GG8A 3C2HA 3F8BA 1P7JA 3EUAA 4JQFA 1AA7A 3ONQA 3ABKH 3CF5F 2L7ZA 3BJ6A 4QIWN 2MLGA 4H0EA 1IO2A 3I4PA 2XAHA 4HNUA 4RAGA 1OMIA 3FX3A 5J1YA 5E18F 1ZN2A 3E7LA 4NNJA 4AD9A 1MGTA 2ELHA 2DMNA 4S05A 1S5LC 3HKZN 4K2EA 5FKKA 3TGNA 5L3FA 2GBYA 1VZ0A 3KFWX 4U7BA 2ZC2A 4A3BJ 2HNHA 3HEFA 3G1OA 2E1MB 1X2NA 1IV8A 4CYCA 2GTXA 2D1VA 5LRSA 3HZJA 4XKCA 4FLKA 4RDUA 1T98A 3JRDA 1W4MA 2ZNYA 5K5QA 2RQQA 2JRTA 1Y1WJ 4XLPF 3CUQB 3DXJF 3HB9A 2VC1A 3MN2A 4V2FA 3T8TA 2R7QA 3GTJJ 3SZPA 1VTNC 2TRTA 1GXPA 4A3GJ 2RAEA 2QENA 4XR6A 2O61A 1SD5A 4R1HA 2ZJPF 1JI8A 2JUCA 2LK2A 5L3CA 4FQGA 2R7TA 2FXAA 2XROA 3L7GA 4XRFA 1J0RA 3QOEA 2ECBA 3DKXA 2R7RA 5F0FA 3CUOA 3K10A 1RETA 3OIPA 3QPLA 2V1DA 1VQ5I 3WTSC 3S1QJ 2ZMEA 2R5YA 1E3HA 2Q96A 4LGWA 2LY1A 2HKOA 2M3AA 2RGVA 1B8IB 5CDEA 1Z77A 3BPVA 5EF6A 3KPHA 5FKMA 1UCRA 4HF1A 2DTZA 3S3NA 5F27A 5E5BA 1QPMA 1SVLA 1QXYA 2F4IA 1XSDA 1WJ5A 1G3SA 1Z7UA 2ID6A 3ASOH 4Z2YA 3DTKA 3CCYA 3HHHA 3TL4X 2O5RA 1YIOA 1D3YA 2ESHA 1J09A 1UZCA 4HZFA 4BKXA 1D1BA 1MBJA 4HYEA 5D4RA 3GTOJ 2Q8KA 2K9MA 3M4OJ 2PG4A 3L2CA 2K4JA 5B66C 1NH3A 2HZTA 2V6CA 2K9SA 3ULQB 4NQWB 3GFLA 2EH3A 3RPUD 4C2UA 4IHXA 1TNSA 4B28A 3TOAA 2HPIA 4IJAA 2DA7A 4IRHA 4QPQA 2PN6A 2XF6A 1VF9A 3LSPA 5EEAA 1YYVA 2PX9A 2AQFA 2XUBA 1YIJI 3CCUI 3CTZA 5HOOA 1P4AA 4BXFA 3BG3A 4XLFA 3SJMA 2M4KA 4EVIA 3S3MA 2FSWA 2Q93A 5GADJ 1D8KA 5DUKA 3JTHA 1FTZA 1EH7A 4NDLA 3HOYJ 3H5AA 4U6CA 3IG4A 3KX2A 4I02A 3ZQFA 2P99A 3TOBA 1BOBA 3O8GA 3RQ4A 4IKSA 3CLOA 4EJTA 1MMAA 4HBLA 5CDLA 3EUHC 3QPSA 4XLNF 4C30A 2ZSHB 2FF4A 3HOUJ 2N8GA 3GTMJ 1ZG3A 4OAYA 2CU7A 4W97A 4BY7J 4Q48A 4J19A 2WAQN 5J4YA 1JKQC 2NVXJ 2LH9A 1VQOI 3PUBA 3H5NA 3ML6A 2DT5A 3FXRA 2K3PA 1NHAA 3W3CA 3C3WA 5C3EJ 1GVDA 2VKHA 1ETYA 3BJAA 5D6EA 4I7HA 1G4DA 1Z1DA 4KJZA 4HSTA 1MSEC 2KIQA 1TBXA 5D5UB 3M1EA 1T08B 2CUZA 5J47A 4BXXJ 1LQ1A 2X6XA 1IUFA 4BJ6C 4FISA 3KYDB 5LBQA 1X19A 1YFHA 2HQRA 2V3XA 2MLKA 3MATA 3F3XA 1O0XA 2LKXA 4XNFA 3OYHA 1AU7A 4KN7X 1Y0UA 1RRJA 2A3SA 2UXXA 3TAVA 3EYIA 2MYSA 4CYCB 3KP6A 2UWMA 1ITYA 1BI1A 4OIOF 3BIQA 5CE6A 1U2WA 3E1SA 4GYIA 1X2MA 4J00A 5HVQC 2CMPA 2A05A 2GG0A 1SVMA 4BH9A 1GT0C 4M3GA 1DGWY 3BTLA 4A3JJ 2MFZA 2Y0SA 2GOXB 2ZJQF 4LD5A 1Y8RB 5C4JJ 3JREA 1R58A 3PFIA 1FT9A 3X2QH 2K5CA 2HPMA 2H8WA 1D5YA 3L2VA 1YOVB 3FISA 4HX8A 3OMYA 4IHSA 1SAXA 1ACIA 3CLQA 1UMQA 2ZMEB 2R5YB 4G7OF 3I4NJ 3DV8A 1APLC 2XC7A 2NVQJ 2X6OA 3G1LA 4EATA 2BVLA 3OR2C 4OOIA 5CYVA 3VYUB 5F6FA 2KL4A 1FSHA 2XKPA 3FHZA 4UUTA 1W5SA 4D7MA 4BHCA 4IHWA 4OINF 2ZFWA 5B1AH 3WTYC 1VQMI 5L3DA 3FMRA 3N97A 1RI7A 3Q5FA 2CFOA 1B59A 1TT5B 3BTJA 1IRXA 1HOMA 5IYDJ 2LVSA 2X48A 1FWZA 3QWLA 2BHYA 2QM3A 3FIWA 5HLTA 1G3TA 2PJPA 1RNLA 2DA5A 2JT1A 1NK2P 2L5QA 3GZNB 1TNTA 2EZHA 2QBYA 2MABA 4KT5C 5HS9A 1X4PA 2DI3A 2W1OA 2F5CA 3ABUA 3WTVC 1D1AA 3M8JA 2DK8A 2QSGX 1BJZA 1FSEA 3EYYA 3WU2C 4CO8A 4CCMA 1OCZH 2K85A 4FCYA 1JUMA 3ZMZA 3CB6A 5IP6A 2IS4A 3CD6I 2QVOA 4RLQA 4IECA 3VODA 3KLOA 3D5SC 4GCVA 3IAS2 4PJ0C 4NB5A 4U73A 2DODA 3H3VK 3MCZA 2GXBA 2DQLA 1FYKA 2HU9A 2CV1A 2IS6A 1IZ1A 1VQKI 3KE2A 4HX7A 2ZSGA 1XSVA 2FE3A 2F4MB 2B63J 1OCRH 2V1NA 3E3VA 2M1BA 3JW4A 2VBZA 3DKWA 3IH3A 4CDGA 2MC4A 1AHDP 2DPUA 2HYGD 4L5IA 2BWTA 4FKCA 2QA4I 3RQIA 2GGBA 1XX5A 1U5TC 1ZTRA 3W6VA 2DPDA 2ISZA 2GG7A 4XKBA 1XMAA 5L3EA 2G7HA 4I0BA 4C9YA 1PUEE 1EJ9A 1BOAA 1MJ9A 1KA8A 2HR3A 1ENHA 2WBMA 5ERIA 2GG5A 3HHGA 1XC5A 1YHQI 2E2HJ 2L54A 1LVKA 2FBHA 2X1DA 1N77A 2P0WA 3OIQA 2M7AA 4EM1A 2XSDC 2GLOA 2CUFA 2LSOA 3CZ6A 3ZMVA 2CFXA 3R61A 2Q2EB 3AG1H 3QYEA 3CCJI 2IRFG 2M0CA 4RB3C 4MEYF 4XIDA 2ICWG 4PGHA 1KP0A 3L24A 4PDKA 4ETSA 2FNAA 5F1RA 5E8IA 1W7VA 3WGGA 4XOPA 2KIUA 3KP4A 3QAHA 1MMSA 4UY8I 5FLVA 2WV1A 3MZ8A 1IN7A 3OYGA 2CW8A 2OU2A 4P1WA 1OCOH 2L01A 3BLYA 1X1AA 3WG7H 4A3FJ 1TC3C 1OR7C 2QYOA 4XL9A 2GQQA 4CYDA 2W82A 2XGEA 4Y4RA 1TWHJ 1O7FA 4QSHA 3CJNA 1N75A 1R22A 1FOKA 1JJ8C 2QSFX 3KYCB 5ILVA 2R7UA 1KQ9A 2FUG2 3TP0A 3TO7A 2E34A 5BNGA 2VJIA 3KEYA 4UHTA 2PMHA 3CMMA 4Z7MA 1JGGA 2E2JJ 5DUIA 5LLQA 3FBIB 2QKMB 2A6EF 3I59A 2HKXA 3RIRA 2F5FA 5KAIC 2JA7J 4ZDLA 2VIXA 4ZYGA 5KAFC 4EQQA 2AXLA 3DEUA 3PSFA 4LIVA 3MX6A 4PSXA 1U8RA 2F5VA 1MBKA 2DFFA 3NRVA 3C2BA 1J59A 4ESFA 3BCAA 3RZDJ 2DYRH 2BHDA 4FLIA 1DP3A 1SMTA 2WAFA 1BBYA 2LTPA 2V7FA 2MG4A 2XDVA 4UVBA 1VQ9I 2L9RA 4GO1A 5FRNA 1VQNI 1FTTA 2UV1A 2E1MC 2JVHA 4HA8A 4WXCA 1ZYRF 3K70D 3NEUA 4A12A 3CUQC 5E20A 4LG3A 4D7NA 4BACA 1F4KA 1V55H 1LDJA 3MKLA 2V1UA 1V4RA 3KP3A 2QBYB 2X51A 3VFZA 2VQCA 1GXQA 3ZCOA 5IYBJ 1OCTC 3ZMTA 1WJAA 3CDLA 1OYYA 4C3JJ 1U78A 1RUNA 4U7DA 2OZUA 4HLYA 3K1MA 5IPAA 1VNDA 4NC8A 1YJNI 4BQQA 5GPCA 5J3LA 4WXHA 3F0CA 3HXLA 3GLXA 1F1ZA 3HGGA 2DA4A 2O8KA 3V8LA 2Y30A 2X0LA 1ZGAA 2VQGA 3HKZA 5A2QK 2IA1A 1J75A 4RZZA 5LD2C 2HS5A 4M6YA 2RREA 2V9VA 1YI2I 1R6RA 2QLZA 3BOQA 1FOWA 3S2HJ 1QRYA 2VXDA 2GG2A 5CDVA 3R60A 4X0GA 1ETQA 1KU3A 2EVCA 2OKNA 2RVCA 1R5HA 2P6TA 1FIPA 2DA6A 3ZRGA 1R1UA 3QYFA 3RORA 2LYCA 1B9NA 4JBAA 3AG3H 3HBLA 2GG3A 1OLTA 1TWCJ 2NS8A 4UXNA 2EIMH 4LLNA 1XB4A 4MLOA 2HYFA 1XNZA 3OS1A 3J80Z 1RPWA 3TW6A 3D27A 3P9CA 1UG0A 4AVPA 4S2TP 4BAYA 2IGKA 5FLXK 1I3QJ 3O3KA 5EYRA 4N0BA 2CUJA 1UJ8A 1C23A 3Q0WA 3WE3A 2HTJA 5TRDA 4U0YA 1S7AA 2NAZA 1MH4A 3GX4X 4FX4A 3UKGA 3I3LA 2IW2A 1WL6A 1DPRA 3OYDA 4XN3A 5EEHA 1MMNA 2ETHA 2LF8A 3DBHB 1X3ZB 1T0FC 1OR7A 4MATA 2IJLA 2Y48A 2OTLI 3VDXA 2XF5A 3QQAA 5CVRA 2K9NA 2LY2A 2OC6A 1X3WB 4B1RA 3S16J 4U6ZA 3DU6A 1FP2A 4LITA 3WU1B 3PUFA 3BG6A 3FXLA 3LNQA 1BW6A 4I99C 1I39A 1A04A 3H35A 1TQIA 3HPGA 3COAC 2IGMA 1CHMA 4HPQA 1D0ZA 4A2UA 4HNTA 2V6EA 1RKWA 1SFOJ 1OISA 1H0MA 1WI9A 1R4NB 3FKJA 4EMSA 1PVEA 3HOTA 3B6AA 4II3A 2DFEA 3K0LA 4L5JA 3PFYA 3IP4B 5CQEA 3RKXA 3TMOA 5E8GA 2L7FP 3O8HA 2LG4A 3HM5A 1XTAA 3JRCA 3FBNB 5FB2A 2LP0A 1QHGA 5C44J 3UNGC 1XCVA 3BG7A 3P7NA 1IN6A 3PO3J 4A6VA 4UV8A 3WGHA 1LJ9A 4MFDA 2J5OA 3RTRA 3MKZA 3HL2A 4IF7A 2Y2ZA 4ZTFA 5JI6A 5LGTA 3PKBA 2YX7A 3CUQA 4AU7A 1ORKA 1XGMA 1R49A 4RGXA 4IQ4A 4LOCA 5E3MA 4YEJA 2RV8A 3E5QA 2STWA 1BL0A 4B3XA 2WY8Q 3BR6A 1YRNB 3FM5A 2LFBA 5EG0B 4UNOA 3SYTA 3KZIC 2O7OA 3U21A 3ELKA 1TP4A 4Z6YA 4RM2A 2Z5UA 2BY2A 3OYKA 5L3BA 1DU6A 1QQIA 5JLWA 5KHDA 5DM6F 1B8IA 5FJ8J 1Z91A 2CQQA 3PO2J 3DCFA 5CNXA 3GF2A 2FJ1A 4F3QA 1HKSA 2VLAA 1REPC 4FUKA 3DKYA 1XGSA 2GIZA 4DBRA 4M72A 2ZMEC 1J5YA 1Z6TA 1K6YA 1LFPA 2XGXA 4HRIA 3RZOJ 2JVGA 4WCGA 1XGOA 4WF2A 1XDSA 3LFUA 4G6TB 4BEHB 1IXCA 4ZWPA 1DQUA 1K6OA 4QWQA 1U3EM 3F9KA 1XG1A 3MD2A 2DQRA 2HDDA 2DYSH 2OJED 2X85A 2UXNA 2QEXI 2GAUA 4HNVA 1ZLKA 2VBWA 5E1ZB 4NQWA 1STZA 4DYRA 4E7ZA 5BOXA 4DIQA 4Y7NJ 3HOSA 5JR3A 4OIQF 5DYMA 3OS2A 4CCKA 1KYZA 2DTRA 4G8XA 3DTEA 1BA5A 5E3LA 1T0FA 2CUEA 2I8DA 1X1PA 1T95A 2ELKA 1LE8A 5D5XB 3H1CA 3H9GA 2BY1A 3OS0A 5A2QZ 2G6PA 3KZZA 3VWBA 3LMMA 5D8KB 3LA7A 1FYLA 1UB9A 1W1WE 2NXNB 4KISA 3LQRA 3OIOA 5ICGA 5M5WJ 1BI0A 2OZ6A 5LGNA 1S7OA 3VSKA 5H6QA 1Y1VJ 3GBGA 4NBQA 1WVRA 3B6CA 4ZYDA 2JZYA 1FBSA 3I56I 3ZQLA 3RKWA 4LFUA 4I09A 3IAM2 5K5RA 1IRGA 2KZVA 2NQ6A 5GP9A 3LOCA 1USSA 3RPUA 2XASA 2MH2A 3DLAA 2B0LA 2VN2A 5HODA 1D1CA 3BT9A 2MATA
chains in the Genus database with same CATH topology
1Y1NA 2EJRA 4G6DA 2MD5A 4AIJA 2DO7A 2O8XA 1R7JA 1FY7A 4LJZF 1QGPA 1FZPB 4RS8A 1BC7C 1WQ2A 5H20A 1FBUA 2E7XA 3LFKA 2YSRA 5BQTA 1ZG5A 4ASNA 4MTEA 3M7GA 1B6AA 5HS7A 1MZBA 1TTYA 5CIKA 2EV0A 3R6SA 2FA5A 4LB5A 3E97A 2VE8A 2P5KA 3R4KA 3GVAA 2XKOA 1D8JA 1DDNA 2B3LA 1W2MA 2VOPA 4ENNA 1IAWA 2CWEA 4HV6A 3TO9A 3TO6A 3H3UA 4KFCA 3V7RA 1J7KA 1DPUA 3OOPA 3LAPA 1JHHA 5K5OA 3EDPA 1OPCA 3FF5A 4D0PA 5BPIA 1AOYA 2JPBA 4L18B 3F6OA 2IW5A 4IVNA 4S00A 3P9KA 1P2FA 3MWMA 3B02A 2E1CA 2BH3A 1QO0D 2EK5A 2BV6A 2XHKA 3GWZA 3WGIA 1S3JA 3EQLF 1SFUA 3ISPA 4MEXF 2RNJA 1YS6A 4ESJA 4HOBA 2YPRA 2EVOA 5J8CA 3DQVC 2QQ9A 4MQVA 2GZ5A 2VT2A 3KETA 3L7WA 4I0AA 4KIGA 4OOKA 2IVMA 4L9VA 4UUVA 1RIOH 5K1YA 4A0ZA 3QPHA 4KICA 3WG9A 2YU3A 2BWXA 1ZGJA 2PEXA 4HW0A 3KP2A 1MJBA 4P9UA 5HLGA 4PZJA 3GZ6A 4KM3A 2BWUA 4U6WA 2FRHA 1PV9A 2OA4A 2K86A 5D4SA 2CSOA 2KIMA 2L02A 1TW2A 4GXOA 2JTVA 1LB2A 1C0WA 3BY6A 2Q2EA 3FM3A 4CICA 4ZWOA 3F8FA 4G9YA 1B9MA 3SFZA 3BIPA 2ACJA 5D8LB 1TQPA 1FBQA 5LHIA 2NQ7A 1O3RA 4AIKA 3ZMSA 4BXUA 5FLXZ 4M9ZA 3REOA 2BE5F 3F6VA 3GYHX 2BWVA 1EV7A 4HQMA 3IC7A 3TDUC 4U71A 3CTAA 1IN5A 2BHAA 1YVMA 2M87A 1F9NA 4FLJA 3HIFA 4HQEA 2JPCA 3GZ5A 3OV8A 1QNTA 2GWRA 1XGNA 3ZQ7A 4N9IA 3DPLC 1SFEA 4CZZA 2A61A 1T6SA 1MATA 4S01A 4ZWUA 3WU0A 3HSRA 3PQKA 4RB1A 2RDPA 5D5WB 4ON0A 1IXSB 4JK1X 3GFMA 4G6QA 4AIHA 1G6NA 4RAZA 2B3KA 2CW0F 3T1BA 1SD7A 3J80K 2R3SA 4A0XA 3J7AO 5LRRA 4ZYEA 5LGUA 5ICCA 1WSUA 2AS5F 4L9JA 1ON1A 3IU7A 2ADUA 3QOPA 3RDIA 3GXOA 2O6GE 2WC2A 3PKDA 2A68F 1R1TA 3KEQA 1P6RA 2DW4A 4ZZLA 3U2RA 5EEGA 1TW3A 2EVMA 2HQNA 1ZRCA 4YIIA 4F7ZA 4RGUA 2Y0MA 2P98A 3LA2A 1S6LA 2NNYA 1UFMA 3C7JA 1M35A 3FXUA 1C22A 3IHUA 4N9HA 2G7UA 2RKHA 1OKRA 1ZAOA 3W6KB 5E1XA 2MBFA 2PMUA 2KKOA 2XVCA 3IWFA 2ZXJA 4M6XA 3GW2A 4LB6B 1WBQA 3SHFA 5F64A 2FOKA 3RYRA 1G3YA 4IRGA 2GG9A 3LWFA 4MGRA 1O7LA 1WKMA 2RN7A 3M8EA 2P8TA 3TKYA 1KU9A 4ZH4F 4EJOA 2FNPA 2EA4A 4PCQA 3T0YA 3CO6C 4HXXA 1W7PD 2FMYA 4ZYHA 1BN5A 2DLLA 2QZ8A 5IT9K 2OD5A 3MQ0A 2YR2A 4OIRF 1L3LA 2D2WA 2W57A 4EGZA 3F21A 1DUXC 5DEQA 5CVVA 3RPQA 4IPAA 4HV5A 5DV5A 3ROUA 2PLYA 3HYIA 2BN7A 2STTA 5KVRA 3ECHA 1F5TA 2YX4A 3QP5A 4Q47A 1O3QA 3MAJA 4EGYA 4LLGF 2P4WA 2CO5A 1BIAA 1FNNA 4ZZDA 2E7WA 1FP1D 2LDUA 3BROA 1P92A 5TJJA 4IXAA 1DP7P 1HW1A 5HDNA 3CO7C 4FO8A 1P4WA 2FBIA 1C24A 4A6WA 4QLCU 3E6BA 2NYXA 4O6JA 3F23A 4U6EA 4FLLA 5DCMA 2R7FA 2IA2A 1KYWA 2E1NA 2VC0A 3R0AA 3MZHA 5ICFA 5JHUA 3WTUC 3WTWC 2BWWA 4EM2A 5LEKA 2GU6A 2V79A 1KU2A 1XMKA 1GVJA 1O57A 3EETA 4G7ZF 2RQPA 5LHGA 2EWNA 4CGZA 1YQAA 3QRFF 3PQJA 4KMUX 2XAGA 2CGPA 2GU7A 2BYVE 4RGZ1 5JVTA 4RGSA 1IRFA 2QQBA 2IT0A 4HAMA 4HX4A 2GZWA 1ZG1A 2CYYA 2D1HA 2NRAC 2MA3A 4XSXF 1GHCA 3V7SA 3GUDA 4M71A 2OQRA 2EFPA 2K4BA 1H9TA 3S6BA 4Q5SF 4P96A 1IF1A 1QZZA 4DQ2A 4MQ9F 2HTSA 1LDDA 2Y75A 3ZMDA 2P5VA 4R60A 2VXZA 1KGSA 2FMLA 4MHGA 1YJ3A 3SXYA 4LK0F 1JE8A 4YG2F 1LEAA 3M8FA 3RYPA 1FYMA 3S2WA 4U88A 1I6XA 4A5MA 3IKVA 1J2XA 3HTUA 2EFQA 4FHTA 1MDMA 3N4MA 3MFKA 1K78A 3BP8A 1IN4A 4B09A 2CQKA 2EV5A 1QZYA 4YFNF 3GFJA 2KJBA 2P7VB 4WXDA 2P7CB 2HDCA 2XRNA 1OYIA 1KQ8A 2L3DA 1IN8A 3B73A 3ZPLA 1WN1A 2FQ3A 4Y15A 4OIPF 2VONA 5IT9Z 3BJOA 3BZ6A 1BJAA 2COMA 3HRUA 3U9GA 4WK8F 4EJVA 3TB5A 2WWYA 1ZRDA 3F8CA 3V8KA 2L4MA 4A6DA 4IKTA 3Q9SA 2RC4A 1B4AA 2VBXA 1HQCA 4PV4A 5DCMB 1I1SA 4R8HA 4XBFA 2EFOA 1XD7A 3L09A 1K7AA 3IWZA 4A5NA 5FD5A 1EH6A 2M45A 1O3SA 3ZN1A 4IRIA 5LHHA 2H94A 4M9XA 2F5DA 1HSJA 2UZKA 1W5TA 1UHMA 1I5ZA 1WY2A 4KIBA 3RKYA 3CB5A 4M73A 3KCCA 2O3FA 3W6JB 3D5LA 4YFXF 4BHBA 3F72A 2VOOA 3HUGA 2HGCA 4WWCA 1I27A 2OQGA 2B3HA 3T5XA 3JSOA 2C6YA 1FX7A 4U0WA 3K2ZA 3L9FA 3IRRA 3LSTA 4A0YA 3K1PA 5CLSA 3E5UA 2PFBA 4KDPA 4IF4A 3IKTA 1LEBA 2A07F 1T2KA 4CXFA 4I01A 3KP7A 1S29A 3IU9A 4MNUA 5FGMA 1SFXA 3HTSB 3H92A 1TLHB 3KZYA 1MDMB 3JAMK 4Q4ZF 3WE2A 1K78B 2GA1A 1PP8F 2EB7A 1XCBA 2BHBA 3I71A 2A5YB 1PP7U 3PKEA 3FMSA 1RZ4A 3LAJA 1FC3A 2W25A 4TV7A 3WTZA 2Z3YA 1LVAA 2LF7A 3HRSA 4I98B 1Z05A 4EV0A 3T8RA 3MEXA 1OYWA 1RUOA 1LDKB 3WTTC 2DAOA 2IP2A 2DK5A 5CJ9A 3WODF 4PGGA 4U1BA 4FT8A 2HEOA 1J9IA 2KIFA 3I58A 4HF2A 4KMFA 1IW7F 4MTDA 3QP6A 1ZRFA 3BITA 5FCHA 2M30A 1ZHFA 2V1XA 2LNBA 2ZBKA 3P9IA 5FD6A 2Z99A 1Q1HA 3FMQA 1YG2A 4B8XA 3NQOA 4CHUA 2V3YA 1CF7A 1P4XA 2DFIA 2BHCA 5AIPA 1LNWA 3TDZC 2FBKA 4JUQA 2O0YA 1O3TA 1HXDA 3G3ZA 1ZH5A 2F5EA 1R1VA 2KRFA 2MH9A 2VE9A 3ABTA 2W85A 5BPDA 2WV0A 2WTEA 2NS0A 4RZYA 4L9NA 2VBYA 3E5XA 2BEOA 4LLLA 1ULYA 2W24A 4HF0A 2FEZA 2P9AA 2A69F 3HSEA 2OAZA 2BWYA 2BGCA 3KEOA 5E17F 2A6HF 3H3ZA 5AIQA 5BS6A 3J81K 4EJWA 2V3ZA 1AWCA 2FU4A 1BC8C 4P55A 2O03A 4P9FA 3GO5A 2PQ8A 3F8MA 1QBJA 5J8FA 4ENMA 3IL2A 4Y17A 1USTA 4UVAA 2XAQA 3O6BB 2EFWA 4IDYA 4U6JA 4Y13A 4LG0A 4RB2C 4OMZA 3WTXC 2OBPA 3JAMZ 4UVCA 3RI4A 3O2PE 3CDHA 4FO7A 1UHWA 1WRJA 2K27A 5D5VB 3ERED 3DP7A 1XN7A 2QUFA 3FWEA 1L0OC 3HRTA 1W7PA 2EA2A 2M5WA 4L0YB 3FXQA 3BWGA 3I64A 3RVAA 4G94A 2PBIA 4EGEA 3QU6A 4U69A 1TQMA 5AONA 2Q94A 4RAYA 1CF7B 4S2RP 5ICEA 4KNYA 1D5VA 5E1WA 4I2OA 1JHFA 1YW8A 5L3GA 1CGPA 1BI3A 3KP5A 2ESNA 1MKMA 1WWXA 5FFXA 2F2EA 3GFIA 2J5PA 5CVIA 3EUHA 3C18A 1ODDA 2D45A 3PKCA 2DBBA 1WL9A 3E6DA 5LEJA 4KA4A 1KU7A 4ENJA 4LK1F 5ILUA 1ONVA 3BDDA 4GGGA 5D6FA 2L4AA 4XSZF 1G3WA 4A6EA 1HKTA 4KN4X 2M8EA 3MZYA 5CVUA 4KUMA 2XV4S 4EJUA 1HBXG 2IPQX 1HW2A 5JFRA 3PKAA 4U76A 1JXSA 2BBYA 5ILSA 4O3MA 4IHTA 1E17A 1U6GA 2XIGA 4O5VA 1N51A 3I0TA 3V8JA 5DD4A 3IU8A 2BWSA 4E70A 3DPTA 1SD4A 4ZNGA 2GXGA 1HKQA 1YO5C 4LG0B 4M74A 3J81Z 2PI0A 2P6SA 1A16A 3GEZA 2VT3A 2Z9OA 4OU0A 3E6MA 1YW9A 3FZVA 3KLNA 5CVJA 5HLIA 3I54A 1W7PB 4KIFA 2HOWA 2R7DA 2ZCWA 1V3FA 3RJPA 3JSPA 5J6XA 2JSCA 4BYYA 2EV6A 1BIBA 3F22A 4P5OA 2EFNA 4HLXA 5DDGA 3LA3A 3DF8A 3HSFA 3ZP5A 1MD0A 2BB7A 4KYWA 1BM9A 5ED4A 1R23A 4U75A 2LKPA 2NNNA 3I5UA 3VOEA 3E6CC 2W84A 2Z33A 3LQQA 1U5TA 4OMYA 1WLRA 3R0JA 5IT3A 4HDUA 1ON2A 4GYGA 3C1DA 1FPQA 2ZNZA 1JGSA 4YFKF 5H6RA 1IXRC 2K7LA 3IRQA 3K9TA 1S8NA 1KQ0A 3VEPA 2Q95A 2X4HA 4L0ZB 2KJCA 3D0SA 2XAJA 3M9AA 2MC3A 2GIVA 2ZKZA 1R36A 3QU3A 5KK1A 3G73A 2Q92A 4S04A 2VODA 2H6BA 1C27A 2QWWA 1QXZA 2DU9A 1YLFA 1ZARA 1T39A 5HLHA 2TDXA 4DNCA 3QPTA 2GGCA 5DCFA 3L00A 3SZTA 1I1GA 2H09A 5FO5A 3TQNA 2GU4A 1X3UA 1T38A 4WX9A 3V7CA 1K79A 4IKRA 4UV9A 4FX0A 3I59B 4BHPA 2HWVA 1C21A 1R5GA 4IKUA 2IA0A 5HS8A 2Q0OA 2CG4A 2G9WA 3Q9VA 3AAFA 3MR1A 3K1NA 5HDKA 1JAWA 1BI2A 1SMYF 3HRMA 1R00A 3ECOA 4HDVA 1PDNC 1QXWA 4QR8A 2QQAA 4EM0B 4L9TA 2GU5A 1ZLJA 1B1BA 3F8NA 1Z9CA 3Q6DA 5DD8A 3JTGA 4PNCA 2ZO4A 2H6CA 4G7HF 4BNCA 2HFHA 2XAFA 3VB2A 4R79A 3U1DA 3DFGA 1YW7A 2ISYA 2K02A 1ZREA 1Z6RA 5HDGA 3K69A 1YS7A 1XSXA 1E2XA 1U5TB 1FLIA 5FFZA 2HOEA 4U70A 4ESBA 1XDUA 2H27A 5FCFA 4RGRA 1HSTA 1MJAA 3ZN0A 3SQNA 3V4GA 1H9GA 1EH8A 1HW5A 1YTYA 5BMZA 1IUYA 4ENKA 4RB0A 6PAXA 2P5LC 4IU6A 2ZJ2A 4YIFA 4AWXB 3BPXA 3I53A 1SD6A 4BQAA 2GA2A 3ZMUA 4NHJA 4U0VA 4LMYA 4M9SA 2GG8A 3F8BA 4JQFA 4H0EA 3BJ6A 2MLGA 3I4PA 2XAHA 1OMIA 3FX3A 5E18F 1ZN2A 4AD9A 1MGTA 2ELHA 4S05A 4K2EA 3TGNA 5L3FA 3KFWX 4U7BA 2GTXA 2D1VA 5LRSA 4FLKA 1T98A 1W4MA 2ZNYA 5K5QA 2JRTA 4XLPF 3CUQB 3DXJF 3T8TA 2VC1A 1VTNC 3SZPA 1GXPA 2QENA 2O61A 1SD5A 4R1HA 5L3CA 2FXAA 2XROA 3L7GA 4XRFA 1J0RA 3CUOA 2V1DA 3WTSC 2ZMEA 2Q96A 4LGWA 2HKOA 2RGVA 5CDEA 3BPVA 1UCRA 4HF1A 5E5BA 1QPMA 1QXYA 1XSDA 1G3SA 1Z7UA 4Z2YA 3HHHA 1YIOA 1D3YA 2ESHA 4HZFA 4HYEA 5D4RA 2Q8KA 2PG4A 3L2CA 2K4JA 2HZTA 2V6CA 3ULQB 3GFLA 1TNSA 4B28A 3TOAA 4IJAA 4IRHA 2PN6A 1YYVA 2XUBA 3CTZA 5HOOA 1P4AA 2Q93A 4EVIA 2FSWA 1D8KA 5DUKA 3JTHA 1EH7A 4U6CA 3IG4A 4I02A 2P99A 3TOBA 4IKSA 3CLOA 4EJTA 4HBLA 5CDLA 4XLNF 2FF4A 1ZG3A 4Q48A 3ML6A 2DT5A 3FXRA 1NHAA 3C3WA 3BJAA 5D6EA 4I7HA 1G4DA 1Z1DA 5D5UB 1TBXA 3M1EA 1LQ1A 5LBQA 1YFHA 2HQRA 2V3XA 2MLKA 3MATA 3F3XA 1O0XA 4KN7X 1Y0UA 2A3SA 2UXXA 3TAVA 3EYIA 2UWMA 3KP6A 1BI1A 4OIOF 3BIQA 5CE6A 1U2WA 4GYIA 5HVQC 2GG0A 4BH9A 4LD5A 1R58A 3PFIA 1FT9A 4HX8A 4IHSA 1SAXA 2ZMEB 4G7OF 3DV8A 4OOIA 5CYVA 5F6FA 1FSHA 2XKPA 3FHZA 1W5SA 4BHCA 4OINF 2ZFWA 3WTYC 5L3DA 3FMRA 3Q5FA 1RI7A 3N97A 1B59A 1FWZA 2QM3A 2PJPA 1G3TA 1RNLA 2JT1A 1TNTA 2QBYA 4KT5C 5HS9A 3ABUA 2DI3A 2F5CA 3WTVC 2DK8A 1FSEA 3EYYA 4CO8A 3ZMZA 3CB6A 2QVOA 4IECA 3VODA 3KLOA 4GCVA 4NB5A 4U73A 3MCZA 2GXBA 2DQLA 1FYKA 1IZ1A 3KE2A 4HX7A 2ZSGA 1XSVA 2FE3A 3E3VA 2M1BA 3JW4A 2VBZA 3DKWA 4CDGA 2DPUA 2HYGD 4L5IA 2BWTA 4FKCA 2GGBA 1U5TC 2GG7A 2DPDA 2ISZA 1PUEE 1XMAA 5L3EA 2G7HA 4I0BA 1BOAA 1MJ9A 1KA8A 2HR3A 5ERIA 2GG5A 3HHGA 2L54A 2FBHA 4EM1A 2LSOA 3ZMVA 2CFXA 3R61A 2IRFG 4RB3C 4MEYF 1KP0A 4PGHA 3L24A 4PDKA 4ETSA 2FNAA 5F1RA 5E8IA 1W7VA 3WGGA 2KIUA 3KP4A 3QAHA 1IN7A 2OU2A 2L01A 2QYOA 2GQQA 4CYDA 1O7FA 3CJNA 1R22A 1FOKA 5ILVA 1KQ9A 3TO7A 4UHTA 2PMHA 4Z7MA 5DUIA 5LLQA 2A6EF 3I59A 2HKXA 3RIRA 2F5FA 4ZYGA 4EQQA 2AXLA 3DEUA 3MX6A 1U8RA 3NRVA 1J59A 4ESFA 2BHDA 4FLIA 1SMTA 1BBYA 4UVBA 4GO1A 4HA8A 4WXCA 1ZYRF 3NEUA 4A12A 3CUQC 5E20A 1F4KA 1LDJA 2V1UA 1V4RA 3KP3A 2QBYB 3VFZA 1GXQA 3ZMTA 1OYYA 1U78A 1RUNA 4U7DA 2OZUA 4HLYA 3K1MA 4WXHA 3GLXA 1F1ZA 3V8LA 2X0LA 1ZGAA 5A2QK 4RZZA 2IA1A 1J75A 2HS5A 4M6YA 2V9VA 2QLZA 3BOQA 2GG2A 5CDVA 3R60A 2EVCA 1KU3A 2OKNA 2RVCA 1R5HA 2P6TA 3RORA 1R1UA 1B9NA 4JBAA 2GG3A 4UXNA 4LLNA 1XB4A 2HYFA 1XNZA 3J80Z 3D27A 3P9CA 4AVPA 4S2TP 4BAYA 3O3KA 4N0BA 1C23A 3WE3A 2HTJA 5TRDA 4U0YA 1S7AA 2NAZA 4FX4A 3GX4X 2IW2A 1WL6A 1DPRA 5EEHA 2ETHA 2LF8A 1OR7A 4MATA 2IJLA 2Y48A 5CVRA 4U6ZA 1FP2A 3WU1B 1A04A 3COAC 1TQIA 1CHMA 4A2UA 1H0MA 1WI9A 4EMSA 3HOTA 3K0LA 4L5JA 3RKXA 5E8GA 5FB2A 1XCVA 3P7NA 1IN6A 4A6VA 4UV8A 3WGHA 1LJ9A 2J5OA 3RTRA 4IF7A 5JI6A 5LGTA 3PKBA 2YX7A 3CUQA 1XGMA 4RGXA 2RV8A 3E5QA 2STWA 3FM5A 4UNOA 3ELKA 2Z5UA 5L3BA 1QQIA 1Z91A 5CNXA 3GF2A 1HKSA 1REPC 4FUKA 1XGSA 4M72A 1J5YA 1Z6TA 2XGXA 4WCGA 1XGOA 4WF2A 1XDSA 1IXCA 4ZWPA 1K6OA 4QWQA 1U3EM 2DQRA 2UXNA 2GAUA 1ZLKA 2VBWA 5E1ZB 4NQWA 1STZA 5BOXA 3HOSA 5JR3A 4OIQF 5DYMA 1KYZA 2DTRA 4G8XA 1T0FA 5D5XB 5A2QZ 2G6PA 3KZZA 5D8KB 3LA7A 1FYLA 1UB9A 3LQRA 5ICGA 1BI0A 2OZ6A 5LGNA 1S7OA 5H6QA 4ZYDA 2JZYA 1FBSA 3RKWA 4LFUA 4I09A 1IRGA 5K5RA 2NQ6A 1USSA 3RPUA 2XASA 2MH2A