1XGNA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 93
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgnA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgnA01
5D5VB 5CIKA 3JSOA 5HDNA 4U70A 2EA4A 4A5NA 3F8MA 5A2QZ 1BOAA 4PV4A 3V8LA 3WTWC 1O3TA 1XGNA 1MZBA 2DQLA 1LQ1A 2GXBA 4I09A 2KJCA 3HHHA 3CLOA 3E6CC 5TJJA 3HHGA 5J6XA 3Q5FA 1H9TA 5J8CA 5FFXA 1FYKA 3IU9A 1KP0A 4Q47A 1XCVA 2F5DA 4KNYA 1FX7A 3HOSA 4OIOF 1R7JA 5CNXA 2B0LA 2GA2A 1QZZA 3HRUA 2BN7A 2EK5A 1KU9A 2XROA 1ULYA 2UXNA 4KFCA 5KK1A 3DPLC 4JBAA 4HF1A 5F64A 1CF7B 1W5SA 2LDUA 2HOEA 3MQ0A 3DFGA 3L09A 1K7AA 2FRHA 1T6SA 2JT1A 3G73A 5FB2A 1XN7A 5H6RA 3BJOA 3K0LA 2HZTA 1U8RA 1IXCA 5LRSA 4HV6A 1OPCA 4B09A 2IPQX 5DCFA 2QLZA 1J5YA 4L5JA 1EH7A 5LEJA 2JRTA 1XSXA 3ZMZA 4ZYHA 1XDSA 4YIFA 3R0AA 4LFUA 5ICGA 3F72A 2XAJA 2FA5A 4HQMA 1W7PB 2CQKA 4BXUA 5D8KB 1HW1A 2COMA 4A0YA 4LLLA 3L00A 3NQOA 1E2XA 1HW2A 2PG4A 2G6PA 2DPDA 3CUQB 2JPCA 5E5BA 2CG4A 3WE3A 3MATA 4B28A 4P55A 4IKUA 2A07F 4U6WA 2YSRA 2BB7A 3BY6A 3RPUA 2HEOA 2ZFWA 3F8FA 2GZWA 4Y13A 2WC2A 3L2CA 1V3FA 3ML6A 1BBYA 5ED4A 2HKOA 4KUMA 2KIMA 2QBYA 3JTHA 3K2ZA 2H94A 3TDUC 4YIIA 4A5MA 3J80Z 3RYPA 1I5ZA 2A69F 5E1XA 3TO6A 2E1CA 4G7HF 2GG3A 3WTTC 1QXWA 1PDNC 2FF4A 1YG2A 2FSWA 3MZYA 4AIKA 4KIBA 3GW2A 1I27A 2Y0MA 3KETA 4FLKA 1FNNA 1Y1NA 4ZYEA 2OZUA 1FYLA 1W7PD 1XCBA 4TV7A 2VN2A 1LDKB 1SD7A 4ZYDA 3GWZA 2IT0A 3DPTA 1ZG3A 4LGWA 1T39A 3L9FA 1XB4A 2RC4A 2FBIA 1UB9A 1XNZA 4S05A 3LA7A 1WN1A 1YTYA 2MC3A 2PN6A 1TQIA 1O3SA 1IRFA 3VB2A 2KJBA 2XKOA 3U1DA 3F8BA 4OINF 2OKNA 3KP2A 1TTYA 3JW4A 2PBIA 4LLNA 2A68F 4U75A 3WTXC 3V7CA 3F8CA 2QYOA 2FXAA 2EB7A 4U6JA 4IDYA 1H9GA 1X3UA 4U1BA 2EFOA 2BHCA 4WK8F 4YG2F 2Q2EA 2FBKA 4OIRF 1QZYA 2XHKA 5J8FA 5ICCA 1WWXA 2OBPA 3E5QA 1C24A 3C1DA 2FBHA 3LAJA 3IC7A 5BPIA 2P4WA 1AOYA 4BNCA 1IF1A 2YX4A 3T1BA 2RVCA 1D8KA 3CUOA 1B9NA 3VEPA 4KM3A 5DYMA 3RKWA 2Q0OA 4U0YA 3REOA 1FP2A 5EEHA 1TQMA 3WU0A 3TO7A 2X0LA 4I0BA 2L54A 3T8RA 2NAZA 2PMUA 4AIHA 2KIUA 5DCMA 1K78B 5HLIA 3HTUA 2M45A 3RDIA 1F5TA 1TW3A 1J0RA 3IKTA 4IU6A 4ESFA 3FX3A 2XVCA 4A0XA 1IN8A 3CO7C 2GGCA 4DNCA 2FNAA 5E8IA 1R22A 4NQWA 3HRSA 3P9KA 2V3ZA 5HLGA 4GYIA 5LLQA 1KU2A 2M87A 3HSFA 2Q93A 2O0YA 4FKCA 4U69A 1R36A 3ZMUA 3L24A 1WY2A 1ODDA 3C3WA 5H6QA 4FHTA 1J2XA 1YO5C 3RKXA 1KQ8A 2Z3YA 2BWWA 4M74A 2B3KA 2A5YB 1SMYF 1H0MA 1C22A 2ADUA 3E6MA 1U5TA 1B59A 2PLYA 4RAYA 5LBQA 4L0ZB 1XDUA 2QQAA 3CDHA 3M8FA 1F4KA 1W7VA 3GFIA 1YQAA 1STZA 1XSDA 3W6JB 1IXRC 1KGSA 3W6KB 1S7AA 3LSTA 3FMSA 4IECA 5AONA 2QM3A 4B8XA 5CVUA 3WU1B 2WV0A 4IF7A 2Z99A 4NB5A 1OMIA 2IJLA 3FHZA 3CUQC 5DD4A 1G3WA 3K1PA 1R00A 1R1VA 2JZYA 1CGPA 1SFUA 3V4GA 1YW9A 4PZJA 1GVJA 4S01A 3M7GA 2EFQA 3ZP5A 1FPQA 1QGPA 4R60A 4GGGA 2EFNA 2P7VB 2F5CA 4A0ZA 2A6EF 1USSA 3SZPA 3FXRA 2VXZA 1MJ9A 1EH8A 5D6EA 3GUDA 3TKYA 2BYVE 2W25A 1R58A 1QPMA 4U71A 4EVIA 2DBBA 3ROUA 2IA2A 1SFXA 2VODA 4CGZA 5CDLA 4A6EA 3FM5A 4CXFA 1G4DA 1C27A 1WQ2A 5JHUA 4M6YA 2IRFG 3U9GA 3GF2A 3F23A 5FGMA 1UHWA 1BC8C 1GHCA 3RIRA 3K1NA 4EMSA 3I59B 2MBFA 2EVCA 3BPVA 1S3JA 4LLGF 1TW2A 1KYWA 3IKVA 3BOQA 3DEUA 4UV9A 2OAZA 5LHIA 5CJ9A 2D45A 5DDGA 4Y15A 1R23A 3F6VA 4G7OF 3WE2A 3D5LA 1LB2A 1HSTA 2DK8A 2QZ8A 1O7FA 2W85A 5LHGA 2G9WA 1PUEE 3IHUA 3HSRA 4LG0A 5AIPA 3BDDA 4I0AA 2NNYA 2FU4A 2HYGD 4QWQA 2A3SA 3I5UA 1E17A 2BWXA 5CLSA 1XGMA 4I7HA 4QLCU 2D1VA 3FM3A 2FMYA 3I54A 1JE8A 3IU7A 3ECHA 1YS6A 4XLPF 4HXXA 1IZ1A 1IXSB 3K9TA 3TO9A 3WGIA 3F6OA 4IPAA 4KICA 2DU9A 5HOOA 2AS5F 4Q5SF 3JAMZ 1O7LA 3H92A 4EJWA 2MLGA 5HS9A 4ZWUA 2OZ6A 1UCRA 4ZYGA 2GIVA 2RV8A 4UVBA 4KMUX 1HKTA 2XIGA 2IA0A 1YS7A 2GQQA 3F22A 4RB3C 5ICFA 2BWUA 4OIQF 2ESHA 2VE9A 3BITA 3SQNA 4HF2A 1HXDA 3H3UA 5ILUA 3CJNA 3CTZA 1ZLKA 3WTZA 4G8XA 2GU5A 5ILVA 2HTJA 2VOPA 2K02A 3EDPA 1FOKA 5L3CA 2DTRA 2Q96A 3JTGA 1Z7UA 2K4BA 2Z9OA 5JFRA 4CZZA 3VOEA 1T98A 1BI2A 3RPQA 6PAXA 3FXQA 2DQRA 3IWZA 2DAOA 2QBYB 4MNUA 4N9IA 4LMYA 3GFJA 3M1EA 2HFHA 5KVRA 2ISYA 4EM0B 2IA1A 1AWCA 1XMAA 4IJAA 1A04A 4XLNF 1FBSA 2ZMEB 1T0FA 3GVAA 2GU4A 4ETSA 1OYYA 3P7NA 3QP5A 1B1BA 2HOWA 1FT9A 1LDDA 2MH2A 1ZLJA 2CFXA 4Z7MA 1TQPA 1FBUA 3TOAA 4KA4A 4HX7A 3RTRA 1WI9A 3JSPA 3HYIA 4UUVA 4XBFA 3QU3A 5E1WA 3QRFF 1GXPA 2FE3A 1KQ9A 4LK0F 2V1DA 3IRQA 1B4AA 2QWWA 2DI3A 4A12A 1KU7A 2XAHA 1ZRCA 4RGUA 1W5TA 1DP7P 1RUNA 4N0BA 2E1NA 3DKWA 2B3HA 2XV4S 3DF8A 1L0OC 3RJPA 1T38A 3MR1A 4FO7A 3U2RA 5JR3A 3TQNA 3N4MA 2OQRA 1Z05A 2JSCA 3IWFA 2KRFA 3KZYA 2V9VA 1YLFA 1J59A 2V6CA 5DUKA 5DV5A 4LB5A 3PKAA 4KYWA 1ZARA 1CF7A 1BIAA 4IKRA 4UHTA 2BWTA 5TRDA 2E7WA 5DEQA 3MZHA 4MQ9F 2P6SA 5HLHA 3HRTA 1O0XA 4CICA 1OYWA 2RGVA 3H3ZA 2R7DA 1L3LA 4LB6B 3EYIA 2MH9A 3R6SA 2FEZA 3FXUA 4S04A 5LRRA 1N51A 2O6GE 2BE5F 5F6FA 5DCMB 4XSZF 3BIPA 4HYEA 3M9AA 3PKDA 1W7PA 1TNSA 2GG9A 1S6LA 2P7CB 1MDMA 2CGPA 4LD5A 2DLLA 3I4PA 1JGSA 4HX8A 1J75A 2BHAA 1ZN2A 3NEUA 2L02A 1P92A 1MJBA 4XRFA 5K5RA 4GCVA 4GXOA 4P96A 2L01A 1TNTA 2VC0A 2XAFA 3KP6A 2YX7A 5L3FA 4YFXF 3R60A 2NYXA 2P9AA 1R5HA 1ONVA 5D4RA 1G3YA 3QAHA 1FY7A 5CYVA 5L3DA 3R4KA 1FP1D 2MD5A 5LEKA 1S7OA 1FYMA 2BWVA 1MKMA 1U5TB 3T0YA 5A2QK 1YJ3A 3R61A 5JVTA 4GO1A 2EA2A 2XGXA 3BROA 5CVVA 2BV6A 3O3KA 3NRVA 2OQGA 3BP8A 1D5VA 1VTNC 3PQJA 3OOPA 4AWXB 3CO6C 4U76A 3O6BB 2LNBA 1G3SA 1K79A 1IN5A 4RB0A 4HOBA 4ESBA 5FFZA 3V8JA 1Z1DA 5AIQA 2UXXA 4HA8A 2C6YA 2GG2A 3HSEA 1WL9A 4EJVA 1B6AA 3F3XA 4O3MA 3DQVC 1GXQA 2GA1A 2VBYA 3ZPLA 3HRMA 3TAVA 3E97A 1SMTA 2L4MA 5FD6A 2HKXA 1D3YA 4Y17A 2YR2A 4EGZA 4R8HA 3GFMA 4RGSA 5D8LB 2NNNA 1FBQA 1MD0A 2Q94A 2PEXA 2EV0A 5CDEA 2GU7A 3SHFA 4PGGA 3KE2A 4RGXA 4FO8A 3GLXA 3K1MA 1EV7A 2STWA 1DUXC 2KIFA 4Q48A 2RKHA 2EV5A 1G6NA 2BEOA 2H6CA 2H6BA 4UV8A 1LNWA 2H27A 3T8TA 1FWZA 4UNOA 1M35A 3N97A 3I64A 1O3QA 3KP5A 1U78A 2QQ9A 4PCQA 2DFIA 4HF0A 2ISZA 1KU3A 4HLXA 2E7XA 4BH9A 3LFKA 3WTVC 3Q9SA 2FQ3A 3E6DA 4MEXF 3LQRA 3QPHA 3FMRA 1ZGAA 2GG5A 2ETHA 4UXNA 3RI4A 3MX6A 3MEXA 4I01A 3CTAA 4KN4X 1MJAA 2ACJA 1LEAA 4O6JA 4G6DA 1WRJA 3EUHA 2G7HA 2MATA 4U73A 4ZH4F 2V1UA 1YW7A 1FZPB 1IRGA 1WSUA 4ZWOA 1XD7A 4IF4A 2M5WA 4AVPA 4IKSA 4OU0A 4FT8A 4JK1X 4CYDA 4BHBA 1OYIA 2DW4A 4L9VA 1Z9CA 5FO5A 3J80K 2XRNA 3O2PE 3QP6A 4M9XA 4KIGA 4U0VA 4BAYA 4RAZA 1P6RA 4EJTA 3S2WA 1P4WA 2HGCA 3TDZC 3WTUC 3GYHX 3FMQA 4H0EA 1U3EM 3I0TA 4MHGA 2PJPA 3C18A 1Z6RA 4HZFA 4M72A 2HQNA 4KIFA 4FLJA 2BBYA 1XGOA 4HDUA 1JXSA 2EFPA 3EYYA 1WLRA 2OU2A 3IRRA 1BI0A 3KCCA 3OV8A 2K4JA 4ESJA 2GWRA 2IP2A 3Q9VA 2PFBA 2CWEA 3I71A 4HAMA 4RGZ1 1DDNA 2QENA 1YFHA 2NQ7A 2D1HA 1V4RA 4WCGA 1J7KA 3MCZA 1ZYRF 5IT3A 4P5OA 3ZMTA 4U6EA 2CO5A 3LAPA 3LA3A 3ZN0A 1SD6A 3E6BA 2K7LA 3WTSC 2LF7A 2EJRA 1R1TA 5JI6A 4EQQA 2HWVA 4CDGA 2K86A 5BPDA 3ELKA 5ICEA 1UHMA 2QVOA 3LWFA 2HYFA 4RGRA 1KYZA 3WODF 2F5FA 4L18B 5F1RA 1HW5A 2F2EA 1LEBA 3KLNA 4ENKA 2VBXA 4XSXF 2KKOA 2W84A 5D4SA 4JQFA 3BIQA 2JPBA 4PDKA 3FF5A 3COAC 4S2RP 5CVRA 1U5TC 3RKYA 2O03A 4L0YB 2B3LA 4ENJA 2BHBA 4A6DA 2HR3A 3V8KA 5E20A 3KFWX 1FC3A 4MATA 5K1YA 2W24A 3ULQB 3GFLA 2W57A 3HTSB 2OD5A 4G94A 4U6CA 4UVCA 5FD5A 1YW8A 1XMKA 3L7GA 3GEZA 1ZG5A 5HS8A 4BYYA 4IRIA 1YYVA 1Z91A 5CE6A 3I59A 4I98B 2Q8KA 1G3TA 4CO8A 4WF2A 3F21A 2QUFA 2R3SA 3VODA 3ERED 2V79A 2H09A 1P2FA 4MTEA 2EFWA 3FWEA 4BQAA 4OIPF 3Q6DA 5CDVA 5K5QA 4K2EA 4MGRA 4HX4A 1RIOH 2LSOA 4U0WA 5HDKA 3RORA 5H20A 2DT5A 2GG0A 4OMYA 1A16A 1IN6A 2L3DA 2CYYA 2ZCWA 4HBLA 1PP8F 1QQIA 4E70A 4LK1F 4G9YA 1P4XA 3BJ6A 1F9NA 2Z5UA 4KDPA 2GG7A 4YFKF 2ZNYA 3DXJF 3MAJA 4U6ZA 4YFNF 2HQRA 2XKPA 1K6OA 1JAWA 3KZZA 3LA2A 1XSVA 3KEOA 2XAGA 5HS7A 3ECOA 3PQKA 2M30A 4RB2C 1ZREA 1REPC 4HQEA 5FLXK 5D5WB 2P98A 3PKCA 3KP3A 2CSOA 4D0PA 1LJ9A 2PMHA 4MTDA 4WXHA 1HBXG 1CHMA 3P9IA 1MDMB 1OR7A 1FSEA 2BGCA 2OA4A 3E3VA 5BOXA 1O3RA 4KN7X 2RDPA 3BJAA 5LGNA 5K5OA 4NHJA 4RZZA 5L3BA 2JTVA 3HOTA 1Q1HA 3QU6A 2RQPA 3TOBA 2P6TA 5DUIA 4U7BA 1QXZA 2V3YA 4PNCA 1U2WA 4ON0A 5BS6A 2ZO4A 1ZRDA 2P5VA 3LQQA 2HTSA 2AXLA 2RNJA 4ZNGA 2LKPA 1QXYA 1JHFA 1SD5A 2UWMA 5LHHA 4LJZF 5LGTA 2V1XA 4MEYF 1ZRFA 4EM2A 4U7DA 3ABTA 3DP7A 4MQVA 3IU8A 3J81K 2A6HF 2DO7A 5FCFA 2NRAC 4L5IA 2EVMA 4FX4A 1ZAOA 2P8TA 2ZMEA 4IKTA 3KP7A 3E5UA 1QO0D 3WGGA 1S8NA 3MFKA 2CW0F 1RZ4A 4M9ZA 3R0JA 3V7SA 3RVAA 4IHTA 4ZZLA 3GZ6A 2G7UA 1DPUA 4FLIA 5EEGA 2NS0A 1DPRA 4JUQA 1ZGJA 3K69A 3ZN1A 2V3XA 3D27A 2BWYA 4FLLA 4N9HA 1IUYA 3F8NA 3ISPA 4WXDA 4FX0A 3BPXA 1UFMA 4RB1A 1RNLA 5IT9K 2FOKA 3CUQA 1NHAA 2Q95A 3WGHA 2VOOA 3EETA 5FCHA 2Y75A 2XASA 4IRGA 4EJUA 3FZVA 4A2UA 4A6WA 1BJAA 2P5KA 3KLOA 3TB5A 3D0SA 2J5PA 3BWGA 4G6QA 1BC7C 3SZTA 1U6GA 2YPRA 4PGHA 1TBXA 3I53A 3CB5A 5E8GA 1HQCA 4I02A 2YU3A 3QPTA 3VFZA 5BMZA 4IXAA 1FSHA 4GYGA 3JAMK 4Z2YA 2IVMA 4M6XA 3PFIA 2IW5A 3PKEA 1S29A 4A6VA 3CB6A 5BQTA 3TGNA 5E18F 1PP7U 5D6FA 1BN5A 1ZG1A 5HVQC 1Z6TA 2ZJ2A 4WX9A 2A61A 1YIOA 3S6BA 2EV6A 1PV9A 4IHSA 2VT2A 1W4MA 1QBJA 3J7AO 3GXOA 4ZWPA 1QNTA 4S00A 3B73A 2FNPA 1R5GA 4ZZDA 1XGSA 2UZKA 3IG4A 3C7JA 3PKBA 2NQ6A 2VBZA 1KA8A 5L3GA 4AIJA 2GU6A 2EWNA 5DD8A 3HUGA 5ILSA 1SAXA 4F7ZA 1I1GA 3DV8A 1BIBA 1I1SA 2STTA 4IVNA 3ZQ7A 2ESNA 4ASNA 2DK5A 3ZMDA 4EGYA 3ZMSA 2GXGA 1LVAA 4ENNA 1HSJA 4QR8A 3KP4A 3WG9A 1ZHFA 3G3ZA 4OOKA 2XUBA 2ZKZA 4IRHA 2VBWA 2IW2A 1FLIA 3QOPA 1ON2A 3IL2A 1IW7F 4DQ2A 3AAFA 4KT5C 4HV5A 2M1BA 5E17F 2O61A 4CHUA 1BI1A 2VONA 1MGTA 5LGUA 2P99A 2GGBA 1IN4A 5FLXZ 4L9TA 4EV0A 2PQ8A 4M73A 4BHCA 2ZSGA 4S2TP 1P4AA 2ZBKA 2R7FA 4O5VA 1W2MA 4M71A 2ZXJA 1OKRA 2GAUA 5ERIA 1IN7A 1K78A 1HKQA 5HDGA 2GG8A 4EM1A 1IAWA 1J9IA 1R1UA 2VE8A 3SXYA 5L3EA 1C23A 2BHDA 2GZ5A 4G7ZF 5D5UB 4LG0B 2MLKA 4OOIA 5D5XB 1C21A 2M8EA 2QQBA 4HDVA 2WTEA 1MATA 1RUOA 2LF8A 4OMZA 5CVIA 1LDJA 4WXCA 2GTXA 2Q92A 4KMFA 4ENMA 2F5EA 4L9JA 2J5OA 3ABUA 4EJOA 2XAQA 1T2KA 1WBQA 4L9NA 3L7WA 1WL6A 1B9MA 2ELHA 3E5XA 3MWMA 3J81Z 3HIFA 2D2WA 2HS5A 2O8XA 4BHPA 2HDCA 2Y48A 2PI0A 3WTYC 4EGEA 3I58A 4I2OA 1O57A 1RI7A 1YVMA 2Z33A 4R1HA 3B02A 4R79A 2ZNZA 3BZ6A 2VT3A 1ZH5A 4UVAA 1SD4A 2P5LC 2BWSA 4FUKA 4P9FA 3SFZA 1C0WA 1HKSA 1I6XA 4WWCA 1BI3A 3ZMVA 1JHHA 1F1ZA 1TLHB 5E1ZB 4AD9A 4RS8A 1D8JA 3P9CA 1KQ0A 1ON1A 2X4HA 2BH3A 4P9UA 2DPUA 3M8EA 2O3FA 4HLYA 2EVOA 5IT9Z 3GO5A 2MA3A 2K27A 2L4AA 1SFEA 4RZYA 4U88A 2FMLA 1Y0UA 2TDXA 2RN7A 4M9SA 1USTA 2VC1A 3T5XA 3KEQA 2WWYA 4Q4ZF 1EH6A 4HW0A 3RYRA 1WKMA 3GX4X 3GZ5A 1BM9A 3V7RA 5CVJA 3EQLF
chains in the Genus database with same CATH superfamily
5D5VB 3CDIA 3JSOA 1X1PA 5HDNA 4V19K 5CIKA 4U70A 5FKLA 2EA4A 4A5NA 1MBGA 3F8MA 1KONA 5A2QZ 1BOAA 2IGNA 1TL8A 4PV4A 1WCMJ 3V8LA 3AG3H 1DGWY 4DW6A 4EATA 4DGWB 2HOTA 2DTZA 3ABLH 4RDUA 1IDZA 3ASNH 3WTWC 1O3TA 3KYLA 1I3QJ 3OSGA 1XGNA 1MZBA 2DQLA 1LQ1A 2GXBA 4I09A 2KJCA 3HHHA 3CLOA 3E6CC 2DA1A 5TJJA 3HHGA 5J6XA 4YIRX 3Q5FA 1H9TA 1RC9A 5J8CA 4ZTFA 5FFXA 3LSRA 2R7RA 1FYKA 4Q47A 1KP0A 3IU9A 1XCVA 2F5DA 4KNYA 1FX7A 2VQCA 2DT6A 3N05A 3HOSA 4OIOF 3SYTA 1R7JA 3TP0A 3LOCA 5CNXA 1MMDA 2B0LA 3O8HA 4W97A 1MBFA 5F0CA 2GA2A 3PM1A 1QZZA 3HRUA 2X9DA 3BZCA 3UKGA 2BN7A 2EK5A 5EZGA 5CPRB 1KU9A 5EF6A 1MMSA 4XONA 2XROA 1ULYA 2UXNA 4KFCA 1WH7A 5KK1A 3DPLC 4JBAA 1FMVA 3UR3C 4HF1A 5F04A 2E19A 1TWCJ 3K4MA 5F64A 1CF7B 1D0XA 3EUHC 1W5SA 2ZXHA 1TC3C 2LDUA 2HOEA 3FIWA 1RKTA 3MQ0A 3QQAA 3DFGA 3L09A 1K7AA 2FRHA 1T6SA 3RZDJ 4PJMA 2JT1A 3IAM2 4IEJA 3G73A 5FB2A 1XN7A 5H6RA 2KP6A 2WAFA 3BJOA 3BR1A 3K0LA 3DLLF 3V42A 3OYFA 2HZTA 3MKYB 2HVQA 1U8RA 1DU6A 2VQGA 3PIPF 1IXCA 5LRSA 4HV6A 2XF7A 1OPCA 4B09A 2IPQX 2CMPA 5DCFA 3GTLJ 4ZYAA 4A3LJ 3A01A 1JKOC 4FQGA 4F93B 1QVTA 4C3JJ 2XPWA 2QLZA 4CA0A 2NVXJ 3CDLA 1J5YA 4L5JA 2ZJQF 1EH7A 3QOEA 1FJLA 4M6VA 5LEJA 1AKHA 2ZXWH 2JRTA 1XSXA 2KISA 3ZMZA 4ZYHA 1XDSA 1XG1A 4YIFA 4C3HJ 3R0AA 4LFUA 5ICGA 5IY5H 3F72A 2EZKA 2FA5A 2XAJA 1W7PB 2CQKA 4HQMA 4BXUA 5D8KB 1HW1A 1GDTA 4PJJA 2COMA 3L2VA 4C3IJ 5KCMA 4A0YA 2EQRA 2JVGA 2LY1A 4A3IJ 4LLLA 2IAIA 3HG9A 3L00A 1QVUA 3NQOA 2Q1ZB 1X4PA 1E2XA 1B72A 2F4MB 1WI3A 2DN0A 1HW2A 2PG4A 4ABZA 1I3AA 2E1MC 3H36A 3HOZJ 5FKOA 2G6PA 2DPDA 3CUQB 3OR2C 2JPCA 3S16J 3CMEI 2JVHA 4HSRA 5E5BA 2CG4A 3WE3A 3MATA 1DP3A 1WJ5A 5F0HA 3H35A 4B28A 4P55A 2X6XA 4LG3A 4GRIA 3FKJA 3K6GA 4IKUA 2A07F 4QPQA 4U6WA 2YSRA 1IRZA 2BB7A 3BY6A 3RPUA 2AQEA 2A05A 3MZ8A 4NUBA 5GTIC 2HEOA 2ZFWA 1P9QC 3F8FA 1OISA 2GZWA 1FOXA 4Y13A 2WC2A 3M8JA 3L2CA 1V3FA 3ML6A 1Y56A 4XORA 1BBYA 4B43A 2HKOA 5M5XJ 5ED4A 4KUMA 2OC6A 2KIMA 2LYCA 2QBYA 3AL0C 4BJ6C 3JTHA 3K2ZA 2OCCH 2H94A 3TDUC 4YIIA 3H5RA 4A5MA 2GIZA 4RLFA 4BEHB 3J80Z 3RYPA 1I5ZA 2A69F 4MFEA 5E1XA 3TO6A 2E1CA 4G7HF 1G2HA 2GG3A 3JRIA 3WTTC 1QXWA 1PDNC 2FF4A 3PIOF 1YG2A 4IL6C 3AFHA 2FSWA 3MZYA 4AIKA 4KIBA 3GW2A 1I27A 2Y0MA 3M3YJ 1OLTA 3KETA 4FLKA 3CCJI 1FNNA 1Y1NA 4ZYEA 2OZUA 3DWLE 4C30A 1FYLA 1W7PD 1XCBA 1OJLA 4TV7A 3G1MA 4NC7A 1R5ID 2VN2A 1LDKB 3HJEA 2WY7Q 1SD7A 4ZYDA 3GWZA 4C2UA 1JJ8C 4BXXJ 4BE1A 2IT0A 3DPTA 2R7TA 1ZG3A 1BR4A 3S3MA 2KL4A 4LGWA 5J1UA 1T39A 3L9FA 3BCAA 3S1QJ 3HOVJ 1XB4A 2RC4A 1TZLA 4AYBA 2FBIA 3OYDA 3IV5A 9ANTA 2FD5A 3S2HJ 2LKSA 1UB9A 1XNZA 4S05A 3LA7A 1WN1A 2Y9ZA 1YTYA 5CQGA 2MC3A 2KMUA 2PN6A 4UUSA 2DOAA 1PJRA 1TQIA 3CCUI 1O3SA 4GDFA 4XRSA 1W5CC 1IRFA 1WVRA 3FK6A 3JRBA 3VB2A 3CP2A 2KJBA 2XKOA 2X6YA 3OYLA 2DJIA 3U1DA 2ID6A 3F8BA 2K5CA 4OINF 2OKNA 4HSTA 1ZELA 2CQQA 3KP2A 2ZC2A 2HDWA 2JSPA 1TTYA 1OCOH 2COBA 3BTCA 3JW4A 3ZGKA 3S3OA 1LE8A 2PBIA 1E3OC 4LLNA 2DJNA 2A68F 5HODA 4U75A 3WTXC 1X1BA 3V7CA 3F8CA 2QYOA 3DBRB 3SDBA 2FXAA 2EB7A 2VQLA 4QIWN 4IDYA 4U6JA 4JP0A 1Z0XA 1VQ7I 3H5NA 4OAYA 3WHCA 1H9GA 1X3UA 4U1BA 2EFOA 2BHCA 4WK8F 5IP9J 1ZR2A 2KT0A 3DTIA 1UELB 3CCVI 5J1RA 4YG2F 2Q2EA 1ETYA 2FBKA 4OIRF 3OYHA 1QZYA 5M3MJ 2GM4A 2XHKA 5M5YJ 5J8FA 1VQOI 5ICCA 1WWXA 2OBPA 3E5QA 3KEYA 1RR8C 1C24A 3NWSA 1FIPA 1VFCA 3C1DA 2FBHA 1IRXA 3LAJA 1SVMA 2E60A 1UHSA 1VZ0A 3IC7A 5BPIA 2P4WA 5KAIC 4B3AA 2E34A 4BNCA 1AOYA 1DQUA 1IF1A 2YX4A 3T1BA 2RVCA 1D8KA 3CUOA 1B9NA 3ZQFA 2L7MP 1PVEA 3VEPA 4KM3A 4LITA 4MLOA 1IO2A 2R93J 3B6AA 5DYMA 3RKWA 4ZDLA 2IS6A 2Q0OA 5EG0B 1AHDP 3IH2A 4U0YA 3REOA 5M5WJ 2LC2A 1FP2A 5EEHA 1B8IB 1TQMA 3TEDA 3WU0A 3TO7A 1YX5A 5J47A 3PJRA 2X0LA 4I0BA 3SFIA 1JUMA 2L54A 3T8RA 4E7HA 1K4SA 2XB5A 1BW6A 2DA3A 2NAZA 1D0ZA 2K9LA 2PMUA 1ENHA 2WAEA 4AIHA 2KIUA 4S0HB 5DCMA 1K78B 4XKVA 2L7KA 1OR7C 4DYRA 3BQZA 5DS9A 5HLIA 3HTUA 2M45A 3RDIA 1F5TA 1TW3A 2Y9YA 1U8BA 5EEAA 1J0RA 3IKTA 1MH4A 1X1CA 3HOYJ 4BY7J 4IU6A 3OIOA 4ESFA 3W3CA 5DM7F 3OS1A 1QRYA 3FX3A 1JT6A 2XVCA 2V9KA 1UZCA 4F3QA 1WJEA 4A0XA 1JGGA 3CF5F 1IN8A 1BR2A 4AYBN 3CO7C 2GGCA 4HG2A 4DNCA 3QWLA 3LSPA 1WJBA 2FNAA 2ZFUA 3MMYB 2DA5A 5E8IA 5IP7J 2BZTA 3U1KA 1R22A 3CJTB 1YRNB 4NQWA 1V54H 3NWTA 3HRSA 3P9KA 5FROA 3JR9A 1GUUA 1JKQC 2V3ZA 5HLGA 4GYIA 5LLQA 1KU2A 3GTKJ 3BG7A 5EZHA 2M87A 4BDYA 3HSFA 1MNDA 1Z3YA 5GPAA 3M07A 4BY1J 2Q93A 3CMYA 2O0YA 4FKCA 3CC7I 5LFAA 2MYSA 4U69A 1IJWC 1R36A 1NG7A 3JCUC 3ZMUA 3L24A 1WY2A 1ODDA 3C3WA 5H6QA 4FHTA 1J2XA 4DYQA 1YO5C 1FEXA 2R5YB 2JUCA 4X0GA 2E2HJ 2BVLA 3RKXA 2E36A 3W2WA 3FBIB 2Z3YA 3G2BA 3ZXSA 4AIDA 1KQ8A 1O4XA 2BWWA 2CQNA 2ZMEC 3GLLA 1R4MB 4M74A 2B3KA 2A5YB 1SMYF 2PMZA 2VIXA 1H0MA 5E3MA 1C22A 2ADUA 3E6MA 1U5TA 3ZQQA 2Z2SB 1B59A 2PLYA 2O5RA 4RAYA 3W6VA 3AG4H 4XN0A 5LBQA 4L0ZB 1XDUA 2QQAA 3CDHA 3M8FA 3GCMA 2CV2A 2LMDA 3CCRI 4F91B 3CC2I 1F4KA 1W7VA 2R5ZA 3GFIA 1JI8A 1YQAA 1OQYA 1STZA 1XSDA 2M34A 1S9HA 2VJIA 1YOVB 1IXRC 3W6JB 1YX3A 1KGSA 1S7AA 3LSTA 3FMSA 3W6KB 3BC8A 3BR5A 1QHHD 3HOWJ 4IECA 4QSHA 5FRNA 4UY8I 2LP0A 5AONA 2QM3A 4B8XA 4B44A 5CVUA 3WU1B 4RA2A 2WV0A 2CRGA 4C2MJ 4IF7A 4FTHA 2Z99A 1VNDA 4NB5A 1OMIA 3CJQB 2IJLA 3HKZA 3FHZA 4XOPA 3CUQC 5DD4A 4XM3A 5F08A 1G3WA 3K1PA 2FJ1A 1AU7A 2ZSIB 1TT5B 1R00A 1R1VA 2JZYA 3ABKH 1CGPA 1MNEA 5KAFC 1BJZA 3V4GA 5JLWA 1SFUA 2CV1A 1YW9A 4PZJA 1GVJA 1XMXA 2IEKA 2X1EA 1A36A 4BBSJ 3BQYA 4S01A 1YHQI 3M7GA 4ZC3A 2EFQA 3ZP5A 1SFOJ 3F9KA 3FISA 1Z7LA 4I99C 1JTXA 3IP4B 2DMQA 1HC8A 1FPQA 1QGPA 4A69C 3OS0A 4R60A 2DXIA 4GGGA 1I39A 1OCRH 3BR6A 2EFNA 2HVRA 2P7VB 3LSMA 3MVPA 3G4SI 3TL4X 2X6OA 2F5CA 3OYMA 4A0ZA 2A6EF 1USSA 3SZPA 3FXRA 2VXZA 4W1UA 1MJ9A 1SANA 1EH8A 5D6EA 2OV7A 3GUDA 3TKYA 5J1YA 1RPWA 2JA5J 5KHDA 2BYVE 1WJCA 2KZVA 1DGRM 2W25A 2W00A 1R58A 5IYBJ 1QPMA 4U71A 3KYDB 4EVIA 1YITI 2CUZA 2DBBA 2LR8A 2YUSA 1W36C 3LNQA 3ROUA 2M4KA 2IA2A 1SFXA 2VODA 4CGZA 5CDLA 4QPOA 4A6EA 3FM5A 1WH5A 4CXFA 1G4DA 3LSHA 2R7WA 1C27A 1WQ2A 2DA6A 1MNMC 5JHUA 4M6YA 5BNGA 2IRFG 4M3GA 3U9GA 3GF2A 3WG7H 1ETWA 2BY1A 3FKIJ 5FGMA 3F23A 2JA6J 1UHWA 1BC8C 1GHCA 3A0BC 3RIRA 3K1NA 4EMSA 3I59B 2MBFA 2EVCA 2GLOA 3BPVA 1S3JA 4LLGF 1TW2A 3W2AA 2ZXIA 3CLQA 1KYWA 3CZ6A 1V5EA 3BOQA 3IKVA 1A31A 3DEUA 2FOWA 3CCYA 2OAZA 4UV9A 5LHIA 5CJ9A 4IOCF 2D45A 3PNYA 3TBIA 5DDGA 4Y15A 1R23A 3F6VA 4DBRA 3HB9A 3WE2A 4G7OF 4AU7A 3D5LA 2VB6A 1Y1VJ 2K3PA 1LB2A 1HSTA 1ZK8A 2M7BA 1BL0A 2DK8A 4IHXA 2QZ8A 1O7FA 2W85A 3BG3A 2G9WA 5LHGA 1GV2A 1PUEE 3IHUA 4IQ4A 2CS3A 3HSRA 1LFPA 2JA8J 4LG0A 5AIPA 3BDDA 4I0AA 2NNYA 2FU4A 2HYGD 4QWQA 1P7IA 2A3SA 3I5UA 1E17A 3OYCA 2BWXA 1OCPA 3QODA 5CLSA 4I6ZA 1XGMA 4I7HA 5EDNA 4NDLA 4QLCU 2D1VA 1F36A 3FM3A 2FMYA 3I54A 1JE8A 3J7AY 3IU7A 3ASOH 2M9HA 3ECHA 1YS6A 4XLPF 4HXXA 1D1CA 1IZ1A 1IXSB 1ETQA 2VKEA 2NXNB 3K9TA 3TO9A 3WGIA 2V9PA 4KJZA 3JREA 3PSIA 3F6OA 4IPAA 4KICA 2DDBA 2DU9A 5HOOA 3L2QA 2LLKA 2AS5F 4Q5SF 5B5EC 1V5GA 3JAMZ 3CCLI 2XGCA 1O7LA 3S93A 2FUG2 1MMGA 4FE4A 3H92A 4EJWA 2MLGA 5HS9A 2UUZA 4ZWUA 2OZ6A 1UCRA 4ZYGA 2GIVA 5C4JJ 1QA6A 2RV8A 4UVBA 1G59A 1MH3A 1X2NA 4KMUX 3DTKA 1HKTA 2XIGA 2IA0A 2AO9A 1YS7A 1B72B 4CCKA 2OJED 1PUFA 4B3XA 2GQQA 3F22A 4RB3C 2ELKA 5ICFA 2BWUA 3SJMA 4OIQF 4DZPA 2ESHA 2VE9A 3BITA 3PL8A 3SQNA 4HF2A 1BR1A 1HXDA 4YRVA 3H3UA 4BL0B 5ILUA 3CJNA 1Z77A 3CTZA 1ZLKA 2OUMA 3WTZA 4G8XA 1T08B 4CYCA 3C2BA 1X3WB 2GU5A 5ILVA 1WJDA 2HTJA 2VOPA 2Z1DA 3BCBA 2K02A 4M3FA 3PFYA 3EDPA 1FOKA 5L3CA 2DTRA 2Q96A 3JTGA 1Z7UA 2XF5A 4XQFA 2K4BA 2Z9OA 1R4NB 5JFRA 4CZZA 3VOEA 1T98A 1BI2A 3RPQA 2IS4A 1UG0A 6PAXA 3FXQA 2DFFA 2DQRA 3IWZA 2DAOA 3OWTA 2QBYB 4MNUA 5F27A 4D5FA 3VDXA 4N9IA 4LMYA 3GFJA 3M1EA 2HFHA 5KVRA 3M4OJ 4IHWA 2I8DA 2ISYA 4EM0B 4PJLA 4D5CA 2IA1A 1AWCA 1XMAA 4IJAA 3BG6A 4IKFA 1A04A 2VLAA 3Q3SA 4MFDA 4XLNF 5C3EJ 1FBSA 1FMWA 2JWTA 2ZMEB 1T0FA 3GVAA 5FKNA 2GU4A 3D5RC 2EZLA 2OPTA 1MBEA 4ETSA 3LMMA 3JRCA 1MMAA 1OYYA 3P7NA 3AG1H 3QP5A 1T95A 3G1OA 1B1BA 2HOWA 1FT9A 1LDDA 2MH2A 2L2OA 1ZLJA 2CFXA 4Z7MA 1TQPA 4G6TB 1FBUA 3TOAA 4KA4A 4HX7A 3RTRA 2D5VA 2PX9A 1WI9A 3JSPA 3HYIA 4UUVA 4D7MA 2DMTA 2EIKH 3DPUA 2MG4A 4XBFA 3QU3A 4H4KC 1IC8A 5E1WA 2QSHX 1HLVA 3QRFF 1GXPA 2JMWA 4HNVA 3IUOA 2DT7B 3DBHB 3DU6A 1JKRC 3OYJA 2FE3A 1FIAA 3BR0A 1KQ9A 4JX4A 4PUSA 3G71I 4LK0F 2V1DA 3IRQA 2AHQA 1UAAA 1TWAJ 1B4AA 2QWWA 2DI3A 4A12A 1KU7A 1IGNA 2XAHA 2CV0A 3RQIA 1ZRCA 4RGUA 1W5TA 1DP7P 1RUNA 4N0BA 2E1NA 2YS9A 1UG2A 3DKWA 2VPLA 2B3HA 2XV4S 3DF8A 4IHVA 2QEXI 2QQ8A 1L0OC 3RJPA 1T38A 3MR1A 4FO7A 3U2RA 3HPGA 2GOMA 3PO3J 1LE8B 4DJAA 2XDVA 5JR3A 3TQNA 5GAGJ 3N4MA 2NVUB 2OQRA 2NS7A 1Z05A 3S1NJ 2JSCA 3IWFA 2KRFA 3GTGJ 3KZYA 2X6WA 2V9VA 1YLFA 1JTYA 4XL9A 4XMYA 1J59A 2LOOA 2V6CA 4BJ5C 5DUKA 1FOYA 4CCOA 5DV5A 4LB5A 1E3PA 2L9NA 1VQ6I 4MIMA 1Z21A 2L7ZA 4Y4RA 4ZTJA 3PKAA 4KYWA 3OYAA 1ZARA 2Q2EB 4I76A 4NNJA 4V2GA 1CF7A 2HYJA 1TWHJ 2EZIA 3OIPA 1BIAA 4IKRA 3IAS2 4E6KG 2I5UA 4L5EA 4UHTA 2BWTA 5TRDA 2E7WA 2Z16A 5DEQA 3MZHA 4MQ9F 2P6SA 2DA2A 1LVKA 1WFXA 3HRTA 5HLHA 1O0XA 2CH0A 2WY8Q 4CICA 1OYWA 2RGVA 3H3ZA 2R7DA 1L3LA 3IH3A 4LB6B 3EYIA 2K9NA 2DA4A 2MH9A 3R6SA 2EIJH 2FEZA 3TW6A 3FXUA 2WV1A 4S04A 3A02A 2E5ZA 5LRRA 4HPQA 1N51A 2O6GE 3JRAA 3OS2A 2XPUA 2VASA 1A5JA 1ORKA 2BE5F 5GP9A 2CUJA 1Y8RB 5F6FA 5DCMB 1Y1WJ 1W1WE 2LK2A 2VKVA 3DBLB 4HYEA 4XSZF 3BIPA 4BS9A 2W4SA 3M9AA 3PKDA 3MKWB 1W7PA 1TNSA 4B48A 2GG9A 2H8WA 1HDDC 2G0EA 1S6LA 2P7CB 3H9JA 3DKYA 3A1YA 1MDMA 5J4YA 2CGPA 4LD5A 2DLLA 3LSGA 2OTLI 3I4PA 1JGSA 3RCOA 2HNHA 4JOMA 2R7UA 2X1CA 4HX8A 4N4OB 1J75A 3PNVA 2CFOA 2BHAA 1ZN2A 4Y7NJ 3NEUA 2WB1A 2L02A 2ME0A 1P92A 3EUAA 1E3HA 1X4OA 4BGDA 3D5SC 1MJBA 1U9OA 2JA2A 2LD5A 3HUGB 4XRFA 4JYKA 1ITYA 2ID3A 5K5RA 2LFBA 1VQKI 4GCVA 4GXOA 1U0JA 4P96A 2L01A 1TNTA 2VC0A 4BE2A 2XAFA 3CD6I 3KP6A 4N4NB 2YX7A 3S8PA 2ZJPF 2DYSH 5L3FA 4F55A 4JX6A 4YFXF 3R60A 5IOYA 2NYXA 1W36D 2P9AA 3I4MJ 1R5HA 2CUFA 4M3EA 4AC0A 1ONVA 2DFHA 5D4RA 1G3YA 3QAHA 2CJJA 3CESA 1FY7A 2VL8A 1MBHA 5CYVA 3ZRGA 3BZKA 4PFOA 5L3DA 3R4KA 2DDAA 2KDZA 1S5LC 4BEHA 4BUPA 1FP1D 2MD5A 5LEKA 1S7OA 4ZDPA 2CUEA 3CCSI 2R7ZJ 3G6EI 2XC7A 3OR1C 1FYMA 1X1AA 2BWVA 1UJ8A 1MKMA 1U5TB 3QYFA 3T0YA 5JLXA 2QCOA 5A2QK 1YJ3A 5F1JA 5C44J 4A3BJ 4IHYA 2F4IA 3FXJA 3R61A 5JVTA 4GO1A 4CH7A 5FLVA 2EA2A 2XGXA 2R5ZB 3BROA 5CVVA 2BV6A 3O3KA 3NRVA 3J7YJ 1R49A 4QTRA 3X2QH 2OQGA 3BP8A 2PJRB 1D5VA 1VTNC 3H9QA 3PQJA 2LBFB 3OOPA 3KYCB 4AWXB 1VQMI 3CO6C 4U76A 3PO2J 2JRMA 3O6BB 2WAQA 2LNBA 2RREA 1G3SA 2DODA 3VYRB 1K79A 1IN5A 2KIQA 1Z3XA 4BJTA 1SC7A 4RB0A 1NK3P 4HOBA 4ESBA 5B1AH 1LUJB 5FFZA 3V8JA 1Z1DA 5AIQA 2UXXA 4HA8A 2C6YA 1GV5A 5FRMA 2GG2A 3HSEA 4CCLA 1WL9A 4A3GJ 2CW8A 4EJVA 1B6AA 3F3XA 3ZQLA 2X48A 3L2WA 4O3MA 3DQVC 1GXQA 1LPQA 2GOXB 2GA1A 2VBYA 2A6TA 3ZPLA 4XLHA 2XGEA 5GAEJ 3HRMA 3TAVA 3E97A 1WPKA 1SMTA 3HXLA 1Z67A 2L4MA 5FD6A 4A3KJ 2HKXA 1D3YA 4Y17A 1ACIA 2ELJA 2YR2A 3ZQGA 4EGZA 4R8HA 3NARA 3GFMA 4RGSA 5D8LB 2NNNA 4J19A 1FBQA 1MD0A 1EA3A 3VYTB 2Q94A 2PEXA 2EV0A 3S3NA 5CDEA 2O8KA 2W82A 2GU7A 2DOEA 5IP6A 4V2FA 3G1LA 1TWFJ 4PGGA 3SHFA 3KE2A 2WB1N 4RGXA 5EGOB 1QU3A 3GLXA 4FO8A 3ONQA 3CMAI 4J00A 4ANJA 3K1MA 1JUPA 1EV7A 2CW7A 4MO7A 2BY2A 2CQ7A 2STWA 1DUXC 3ZCOA 2KIFA 1A35A 1JT0A 4Q48A 5E3OA 3ZOBA 3HDDA 5CQEA 2B63J 2RKHA 2EV5A 2F48A 3RSNA 1G6NA 2BEOA 2H6CA 3ESWB 1W0TA 3PUBA 2DA7A 2H6BA 4UV8A 1LNWA 2H27A 3S17J 3TMOA 3T8TA 1FWZA 4A3MJ 4UNOA 1N75A 1M35A 3N97A 3I64A 1NG6A 3SDGA 1O3QA 3CMMA 3KP5A 3LFUA 1U78A 2QQ9A 3K4JA 4PCQA 4B47A 3K4BA 2DFIA 1AA7A 5GTHC 1KZHA 4HF0A 2ISZA 4ITVA 4PJNA 4RLQA 1KU3A 4HLXA 4BU2A 1X3ZB 2E7XA 4Z6YA 1M1EB 2IBDA 3LFKA 4BH9A 3WTVC 3HGYA 3Q9SA 2FQ3A 3E6DA 4MEXF 1B8IA 1VQ9I 3LQRA 3TW7A 3QPHA 1OFCX 2HXOA 2H1KA 2HVSA 4ZJZA 3FMRA 3KIOA 4PJ0C 1ZGAA 2V26A 2ETHA 2GG5A 1D0YA 1XTAA 2FX0A 4UXNA 4E7ZA 3RI4A 3MX6A 2Y31A 3SEQA 3MEXA 3DCFA 3K4NA 3Q0UA 3B6CA 4I01A 3CTAA 4KN4X 1MJAA 4XICA 2P81A 2ACJA 1GT0C 1LEAA 3QPSA 4DBQA 4O6JA 1OCZH 4G6DA 1WRJA 2VUMJ 2WAQN 3P5JA 4RM2A 2Y2ZA 3EUHA 3I3LA 2B9SA 2G7HA 2MATA 4U73A 4XK4A 4ZH4F 2MC4A 4IX7A 1RR7A 2OF7A 4AM3A 1SVOA 4A93J 1X1DA 2V1UA 2EH3A 1YW7A 1FZPB 1IRGA 1WSUA 4ZWOA 4BE0A 1XD7A 4IF4A 4HEA2 2M5WA 4AVPA 4IKSA 4OU0A 5IYDJ 4A3JJ 4FT8A 3FDYA 3IH4A 4JK1X 4CYDA 1K4TA 4BHBA 3K7AJ 2K85A 1YRNA 1OYIA 2DW4A 2V7FA 4L9VA 2DCEA 3S32A 1Z9CA 2RAEA 3HPHA 5FO5A 3BG5A 3J80K 3OYKA 2KHMA 2XRNA 3O2PE 2L9RA 3QP6A 3FXLA 1N77A 4BQQA 4M9XA 4KIGA 3ZQIA 5FJ8J 4PK4A 4U0VA 4BAYA 4NC6A 4RAZA 1P6RA 2NVYJ 3S2WA 1P4WA 4EJTA 2HGCA 2BHYA 2Y30A 2KLOA 3TDZC 5DM6F 3WTUC 2R5YA 2LH9A 3GYHX 3FMQA 5IOZA 4X6AJ 4PSXA 3LSIA 4H0EA 1ZR4A 3I0TA 4MHGA 1U3EM 2PJPA 3C18A 2M8GX 1Z6RA 3F0CA 4HZFA 4M72A 2HQNA 4KIFA 4FLJA 2BBYA 2HXIA 1XGOA 4HDUA 1JXSA 2EFPA 2DOFA 3MD2A 3DEEA 3EYYA 1VQLI 1WLRA 2OU2A 3IRRA 3JRDA 3H0GJ 1BI0A 3KCCA 3OV8A 2AXTC 4IQJA 2W48A 4KT6A 2K4JA 4ESJA 5H2FC 1MBJA 2GWRA 2IP2A 3Q9VA 2PFBA 2CWEA 3I71A 1XS9A 4HAMA 4RGZ1 4BXFA 3VPRA 1DDNA 2QENA 3HC7A 2Y0SN 3CCQI 3NAUA 1YFHA 2NQ7A 2D1HA 1V4RA 4D1QA 3S2DJ 4WCGA 1J7KA 3MCZA 1ZYRF 2NVTJ 3GBGA 4P5OA 3ZMTA 5IT3A 4U6EA 3W2VA 2CO5A 3LAPA 3LA3A 3JRHA 1Y6IA 2NVQJ 3ZN0A 1SD6A 3E6BA 1XX5A 4A3CJ 3KPHA 2K7LA 3WTSC 1V55H 2LF7A 2QSFX 2EJRA 1R1TA 4XRMA 5JI6A 1OCTC 1WZ2A 1IG7A 4EQQA 4E4HA 2HWVA 4CDGA 2K86A 5BPDA 4KITB 3O8GA 3ELKA 5ICEA 1VQPI 1UHMA 2XSJC 2QVOA 3CP8A 5GADJ 3LWFA 2OTJI 1RKWA 2HYFA 1VF9A 3J7ZI 3A01B 4RGRA 2TRTA 2K9MA 1KYZA 3WODF 2F5FA 4L18B 5F1RA 1HW5A 4J01A 4JX5A 1Q1VA 2F2EA 2XGDA 1AKHB 2EINH 1LEBA 3KLNA 3FXKA 4ENKA 2VBXA 4XSXF 2XRLA 3C2HA 2KKOA 3PSFA 2W84A 4LIUA 4JQFA 5D4SA 3BIQA 1LFBA 2JPBA 4D7NA 4PSWA 4PDKA 4XR6A 3MN2A 3FF5A 3COAC 4S2RP 2R7XA 4DZJA 5CVRA 1U5TC 3RKYA 1D1BA 2O03A 4L0YB 2B3LA 3RZOJ 5K7FA 1K6YA 4CSWA 4ENJA 2BHBA 4A6DA 2HR3A 3V8KA 3OY9A 5E20A 3KFWX 2TCTA 4A3FJ 3HEFA 1FC3A 3A2KA 4MATA 1XC5A 5K1YA 1MSFC 2W24A 3ULQB 3GFLA 2XF6A 2W57A 3HTSB 2R4GA 2OD5A 2VPRA 4G94A 4U6CA 4UVCA 5FD5A 1LKXA 3LSJA 2GBYA 1YW8A 5IYCJ 2VQHA 1ERDA 1XMKA 1EJ9A 3L7GA 3GEZA 1ZG5A 5HS8A 2E2JJ 3A03A 4C9YA 4BYYA 3JRGA 3OSFA 4IRIA 5E79C 1YYVA 1POGA 1Z91A 3CF2A 3CC4I 5CE6A 3I59A 4I98B 2Q8KA 1G3TA 3BR2A 4WF2A 4CO8A 3F21A 4FCYA 2QUFA 2M0MA 3K4KA 1A6IA 5F0FA 2R3SA 2K3FA 3VODA 2V79A 2K9QA 3ERED 2H09A 1P2FA 4MTEA 1T8IA 1D5YA 3GTMJ 3I56I 3I55I 2EFWA 3Q0VA 2X51A 3FWEA 1IV6A 3VSLA 1E0EA 1Y8QB 4BQAA 4OIPF 3Q6DA 5CDVA 4XLFA 5K5QA 4K2EA 3HOXJ 4MGRA 4HX4A 1RIOH 2LSOA 2XPVA 2R92J 4U0WA 5HDKA 3RORA 2ZB9A 2BXYA 5H20A 2OCEA 4E7LA 1YE9A 3M1CA 2BW3A 2DT5A 2GG0A 2KQRA 4OMYA 3L2UA 1A16A 1A6QA 1IN6A 2L3DA 2LKXA 2H8RA 2O9LA 2QKMB 2CYYA 1SVLA 1JJ6C 5C4XJ 2M3AA 2ZCWA 4HBLA 1PP8F 1QQIA 3AG2H 1P7JA 1TWGJ 4E70A 2X85A 3QYBA 4LK1F 1YIJI 2YU9J 2DYRH 4G9YA 1P4XA 3BJ6A 1K83J 1F9NA 2Z5UA 3DLAA 1YI2I 4KDPA 1NTCA 2GG7A 3BG9A 4RM3A 4YFKF 2ZNYA 3DXJF 3MAJA 4U6ZA 4YFNF 2HQRA 2XKPA 1K6OA 1JAWA 5JHFA 3KZZA 3LA2A 1XSVA 1MMNA 2QGUA 3KEOA 5CKTA 1QPIA 2VJJA 2E71A 3HBLA 2XAGA 5J40A 5FKKA 5HS7A 2WBMA 3ECOA 3PQKA 1JUSA 4YEJA 2M30A 5JVGF 1S72I 1VQ5I 4RB2C 2LY9A 4CCNA 2EBIA 1ZREA 1REPC 4XLAA 3HZJA 5J3LA 3BTLA 4HQEA 2L9VA 5FLXK 5D5WB 4UUSB 2P98A 2IS1A 4C2TA 3KP3A 2LG4A 3PKCA 2CSOA 4D0PA 3DU5A 1LJ9A 2PMHA 1S7EA 4MTDA 1ZQ3P 4WXHA 4OAZA 1HBXG 4CCJA 4BBRJ 1CHMA 3P9IA 1MDMB 2HOSA 1OR7A 2X1DA 2JUGA 1FSEA 2BGCA 2OA4A 3SEZA 1T56A 3E3VA 5BOXA 3RPUD 1O3RA 4KN7X 2RDPA 2VKHA 2HQAA 3BJAA 5LGNA 5K5OA 2ECCA 3OL3A 1WHUA 4NHJA 4RZZA 2NS8A 5L3BA 2JA7J 4CCMA 2JTVA 4CZCA 4RAGA 3HOTA 3OYBA 2H1LA 1RRJA 1Q1HA 3S15J 3QU6A 2RQPA 1RETA 2DMPA 1I6HJ 3TOBA 3DTEA 5KNLA 2P6TA 1YJWI 2MW8A 5DUIA 4UUTA 4U7BA 5M3FJ 1QXZA 2V3YA 1V5FA 4PNCA 1U2WA 2M7AA 3ABMH 4ON0A 1WGXA 5BS6A 2ZO4A 1ZRDA 2P5VA 3LQQA 2R7VA 2QSGX 2HTSA 1Y0NA 2AXLA 2RNJA 1MW7A 3GTJJ 3D1NI 4ZNGA 2LKPA 4HRIA 1JHFA 3I4NJ 1QXYA 2A5WA 1SD5A 2UWMA 5LHHA 4LJZF 2LVSA 2V1XA 5LGTA 4MEYF 3HOUJ 4UB6C 1ZRFA 4EM2A 5HNFA 2BXZA 4U7DA 1IV8A 3ABTA 3DP7A 1HCRA 3I9V2 4MQVA 3J81K 2A6HF 2DO7A 3IU8A 5FCFA 2UV1A 2NRAC 4L5IA 4E7JA 2EVMA 3FXMA 4M3DA 1NH3A 4FX4A 1ZAOA 2P8TA 3H9GA 1N78A 2BY0A 2ZMEA 4IKTA 3KP7A 2EZHA 2HOAA 3E5UA 1QO0D 2VXDA 3WGGA 5E3NA 1S8NA 3MFKA 2CW0F 1RZ4A 4M9ZA 1R9TJ 1ZTRA 3R0JA 2ZJRF 1JKPC 2HU9A 4NC8A 2ICWG 3V7SA 1HOMA 3RVAA 1FOWA 2HI3A 2KDOA 2QKLB 4BQNA 4IHTA 4ZZLA 3EPZA 2N8GA 3GZ6A 2G7UA 1DPUA 3LSKA 4FLIA 4XNFA 5EEGA 3OYNA 2IGKA 2NS0A 3HGGA 1DPRA 3OYGA 4JUQA 1ZGJA 3BTJA 3HM5A 3K69A 2O7OA 3ZN1A 2R7QA 2BH3A 2XAUA 2V3XA 3D27A 2BWYA 4FLLA 4N9HA 2V6EA 1IUYA 3VWBA 3F8NA 3ISPA 4WXDA 4FX0A 3BPXA 1UFMA 4RB1A 5HNHA 1RNLA 2AQFA 5IT9K 1FTZA 2FOKA 3EQLF 3CCMI 3CUQA 2NOGA 2L7FP 3OOUA 4NQWB 5B66C 1NHAA 2Q95A 4LIVA 2ME6A 3L2RA 4II3A 4UB8C 3WGHA 2VOOA 3EETA 5FCHA 2Y75A 4E7IA 2CU7A 2JK3A 2XASA 1ETVA 1SFKA 2L5QA 4LOCA 4IRGA 5DTDA 4EJUA 1N25A 3FZVA 4A2UA 4M3BA 3C2GA 2KFDA 3S1RJ 4A6WA 1BJAA 2V1NA 2P5KA 3OYEA 3K10A 3KLOA 3TB5A 3D0SA 2J5PA 3BWGA 4G6QA 1BC7C 3SZTA 1U6GA 2YPRA 4PGHA 3SZGA 4FASD 4G12A 1T0FC 1TBXA 3S1MJ 1SAUA 4PFPA 4DYCA 2JJ7A 3I53A 2WA0A 3CB5A 2EIMH 1HQCA 4I02A 5E8GA 2YU3A 3MKZA 1T33A 3JRFA 2BOLA 1BA5A 3QPTA 3VFZA 5BMZA 2KRHA 4IXAA 4CUGA 1FSHA 4GYGA 3JAMK 4Z2YA 4AVZA 1HDPA 2CQXA 2IVMA 4M6XA 4HNTA 4XN3A 4U87A 1MIJA 5LD2C 1R6RA 3PFIA 2IW5A 2MSYA 4XOTA 1HF0A 3PKEA 3FXOA 1S29A 4A6VA 3CB6A 5BQTA 3TGNA 2DMUA 5FKMA 1PYVA 5E18F 1PP7U 2VI6A 2IW2A 4FE7A 2BY3A 3K4CA 3E7LA 5D6FA 4GFBA 1BN5A 1ZG1A 4XKWA 2RNGA 5HVQC 2K40A 4RMNA 4BKXA 5K7HA 1Z6TA 2ZJ2A 4II2A 4WX9A 2A61A 1YIOA 2IS2A 2EV6A 3S6BA 2KZGA 3ZQHA 3FHNA 1PV9A 4IHSA 2VT2A 3RKQA 1W4MA 1FTTA 3K70D 1QBJA 3J7AO 1D1AA 3GXOA 4ZWPA 2F4OB 4P1WA 1QNTA 4ZDOA 3S14J 5TISC 4S00A 3DEWA 3B73A 2R7SA 3AKZA 1J09A 3H0DA 2FNPA 2BVMA 1R5GA 1IUFA 2RQQA 4ZZDA 4XRSG 2F6CA 2KPMA 2MD0A 4E7SA 3WU2C 1XGSA 2UZKA 3IG4A 1VI0A 4X1EA 3C7JA 1CQTA 3PKBA 2M2EA 2NQ6A 4NBQA 2VBZA 3H3VK 1KA8A 2L9SA 5L3GA 4AIJA 2GU6A 2EWNA 2I10A 5EYRA 1QHGA 5DD8A 4BQOA 3HUGA 5ILSA 1SAXA 4F7ZA 1TP4A 1I1GA 3GTQJ 1ETOA 3DV8A 2P0WA 5B3SH 2HQ5A 3OYIA 4XKBA 4XIDA 1BIBA 1I1SA 2HDDA 2STTA 4IVNA 1I50J 2ESNA 3ZQ7A 4ASNA 2DK5A 4EEFG 3ZMDA 4Y33A 4EGYA 1NK2P 4F92B 3ZMSA 1APLC 2GXGA 1LVAA 1XPXA 3HL2A 4ENNA 1X58A 2VJ4A 1HSJA 4QR8A 3H1CA 3KP4A 3WG9A 1ZHFA 3G3ZA 2ECBA 2XUBA 4OOKA 2V4JC 2ZKZA 2HZDA 2VBWA 3K4LA 4IRHA 2IGMA 4IO9F 3QOPA 2L0KA 1ON2A 3CQZJ 2E2IJ 1FLIA 3IL2A 2E1OA 1IW7F 2Y0SA 4DQ2A 3AAFA 1DU0A 4KISA 4IZZA 3GMEA 4KT5C 4Y52J 2NOJB 2W1OA 1H88C 1BW5A 4HV5A 4DIQA 1UMQA 2M1BA 5E17F 2O61A 4CHUA 1BI1A 2VONA 2HPIA 3VYUB 1MGTA 5LGUA 3BTIA 2P99A 5EG0A 3BR3A 3Q0WA 2GGBA 1IN4A 5IPAA 1ZGWA 5FLXZ 4L9TA 2BHZA 4EV0A 1U9NA 2PQ8A 4M73A 4BHCA 2ZSGA 4S2TP 3EUKL 2QA4I 2WADA 1P4AA 2ZBKA 3GTOJ 2R7FA 4O5VA 4B4CA 1TT0A 2E1MB 3CJRB 3OMYA 1W2MA 4M71A 2ZXJA 5TGTA 4BACA 1W0UA 5J4VA 1OKRA 2GAUA 1WJFA 4A3DJ 5ERIA 1IN7A 1K78A 2PJRA 1EF4A 1HKQA 2EPFA 5HDGA 2W7NA 1MSEC 1ETKA 2GG8A 2LBFA 4EM1A 5EJCA 2M4GA 1IAWA 2E35A 2LY2A 4A3EJ 1Y39A 1J9IA 1R1UA 2MABA 2VE8A 3SXYA 5L3EA 1C23A 2BHDA 3OL4A 4XKCA 2M0CA 5E3LA 4D9JA 2GZ5A 4G7ZF 5D5UB 4RAFA 2MLKA 5K7ZA 2JQ7A 4LG0B 4OOIA 2ZSHB 5D5XB 2FQ4A 1C21A 2K9SA 2M8EA 2XB0X 2QQBA 5FLMJ 2MFZA 4FETA 2B7EA 2MGQA 1BOBA 2XSDC 1R71A 4HDVA 2WTEA 1MATA 1RUOA 2GXAA 2KRCA 3AL0B 2LF8A 4OMZA 1VQ8I 1GLNA 5CVIA 3TP3A 2HPMA 1SEUA 1LDJA 4WXCA 3QYEA 2GTXA 3E1SA 2Q92A 4KMFA 2IGOA 4ENMA 3GTPJ 2F5EA 4L9JA 1X2MA 2J5OA 3ABUA 4IOAF 2JN6A 4DOZA 4EJOA 2LREA 2XAQA 3CCEI 1T2KA 3A0HC 2VKDA 4Y3OA 1WBQA 3BT9A 4L9NA 3L7WA 3KZIC 1WL6A 1B9MA 2ELHA 3E5XA 3ZR8X 2R0QC 3MWMA 4B1RA 3HIFA 5EGOA 3J81Z 5GAHJ 2D2WA 2HS5A 1G8XA 3WHBA 2O8XA 1K61A 4BHPA 2VJ5A 1YJNI 2HDCA 2Y48A 3GZNB 2PI0A 3WTYC 1F43A 4EGEA 4F52A 3I58A 4I2OA 1O57A 3K2AA 1PUFB 1RI7A 1YVMA 4XLCA 1RESA 2E5NA 3BLYA 4YELA 4R1HA 3B02A 2Z33A 1IDYA 1ETXA 3LL7A 4R79A 3VYSB 2ZNZA 3BZ6A 2VT3A 3OIQA 2LRDA 2LTPA 4UVAA 1ZH5A 2R7OA 1SD4A 2P5LC 4CYCB 3ZQCA 2BWSA 1QZEA 4AUXA 4FUKA 4P9FA 3SFZA 1C0WA 1HKSA 1I6XA 3PUFA 4WWCA 1BI3A 3PNTA 3ZMVA 5GPCA 3KX2A 2Y69H 2DMNA 1JHHA 1OCCH 1F1ZA 1TLHB 2QF7A 5E1ZB 1H89C 4AD9A 2PMZN 4RS8A 4BDZA 1WJAA 3DKXA 3E0JB 3P9CA 1KQ0A 1D8JA 1ON1A 2X4HA 4FISA 3RQ4A 4P9UA 1H8AC 2DFEA 2IXSA 3M8EA 2DPUA 1VQNI 2O3FA 4HLYA 3UNGC 2EVOA 5B1BH 5IT9Z 3GO5A 2MA3A 3K70C 1HA8A 3VSKA 2K27A 3ERMA 1MBKA 3H5AA 2L4AA 1LFUP 1SFEA 2F5VA 4RZYA 4U88A 3U21A 3MKLA 2EILH 2FMLA 1Y0UA 2TDXA 1ZKGA 2RN7A 3L1PA 4M9SA 1USTA 3A4CA 2VC1A 2BW3B 4E7KA 3T5XA 3FBNB 3KEQA 2WWYA 4Q4ZF 1EH6A 4HNUA 4HW0A 4XLEA 4RBOA 1YJ9I 1GVDA 4OWRB 1WKMA 3HKZN 3QPLA 3RYRA 1EKEA 3GZ5A 3GX4X 1VQ4I 1BM9A 3FK7A 3V7RA 5HLTA 5CVJA 1X19A
chains in the Genus database with same CATH topology
5D5VB 5CIKA 3JSOA 5HDNA 4U70A 2EA4A 4A5NA 3F8MA 5A2QZ 1BOAA 4PV4A 3V8LA 3WTWC 1O3TA 1XGNA 1MZBA 2DQLA 1LQ1A 2GXBA 4I09A 2KJCA 3HHHA 3CLOA 3E6CC 5TJJA 3HHGA 5J6XA 3Q5FA 1H9TA 5J8CA 5FFXA 1FYKA 3IU9A 1KP0A 4Q47A 1XCVA 2F5DA 4KNYA 1FX7A 3HOSA 4OIOF 1R7JA 5CNXA 2B0LA 2GA2A 1QZZA 3HRUA 2BN7A 2EK5A 1KU9A 2XROA 1ULYA 2UXNA 4KFCA 5KK1A 3DPLC 4JBAA 4HF1A 5F64A 1CF7B 1W5SA 2LDUA 2HOEA 3MQ0A 3DFGA 3L09A 1K7AA 2FRHA 1T6SA 2JT1A 3G73A 5FB2A 1XN7A 5H6RA 3BJOA 3K0LA 2HZTA 1U8RA 1IXCA 5LRSA 4HV6A 1OPCA 4B09A 2IPQX 5DCFA 2QLZA 1J5YA 4L5JA 1EH7A 5LEJA 2JRTA 1XSXA 3ZMZA 4ZYHA 1XDSA 4YIFA 3R0AA 4LFUA 5ICGA 3F72A 2XAJA 2FA5A 4HQMA 1W7PB 2CQKA 4BXUA 5D8KB 1HW1A 2COMA 4A0YA 4LLLA 3L00A 3NQOA 1E2XA 1HW2A 2PG4A 2G6PA 2DPDA 3CUQB 2JPCA 5E5BA 2CG4A 3WE3A 3MATA 4B28A 4P55A 4IKUA 2A07F 4U6WA 2YSRA 2BB7A 3BY6A 3RPUA 2HEOA 2ZFWA 3F8FA 2GZWA 4Y13A 2WC2A 3L2CA 1V3FA 3ML6A 1BBYA 5ED4A 2HKOA 4KUMA 2KIMA 2QBYA 3JTHA 3K2ZA 2H94A 3TDUC 4YIIA 4A5MA 3J80Z 3RYPA 1I5ZA 2A69F 5E1XA 3TO6A 2E1CA 4G7HF 2GG3A 3WTTC 1QXWA 1PDNC 2FF4A 1YG2A 2FSWA 3MZYA 4AIKA 4KIBA 3GW2A 1I27A 2Y0MA 3KETA 4FLKA 1FNNA 1Y1NA 4ZYEA 2OZUA 1FYLA 1W7PD 1XCBA 4TV7A 2VN2A 1LDKB 1SD7A 4ZYDA 3GWZA 2IT0A 3DPTA 1ZG3A 4LGWA 1T39A 3L9FA 1XB4A 2RC4A 2FBIA 1UB9A 1XNZA 4S05A 3LA7A 1WN1A 1YTYA 2MC3A 2PN6A 1TQIA 1O3SA 1IRFA 3VB2A 2KJBA 2XKOA 3U1DA 3F8BA 4OINF 2OKNA 3KP2A 1TTYA 3JW4A 2PBIA 4LLNA 2A68F 4U75A 3WTXC 3V7CA 3F8CA 2QYOA 2FXAA 2EB7A 4U6JA 4IDYA 1H9GA 1X3UA 4U1BA 2EFOA 2BHCA 4WK8F 4YG2F 2Q2EA 2FBKA 4OIRF 1QZYA 2XHKA 5J8FA 5ICCA 1WWXA 2OBPA 3E5QA 1C24A 3C1DA 2FBHA 3LAJA 3IC7A 5BPIA 2P4WA 1AOYA 4BNCA 1IF1A 2YX4A 3T1BA 2RVCA 1D8KA 3CUOA 1B9NA 3VEPA 4KM3A 5DYMA 3RKWA 2Q0OA 4U0YA 3REOA 1FP2A 5EEHA 1TQMA 3WU0A 3TO7A 2X0LA 4I0BA 2L54A 3T8RA 2NAZA 2PMUA 4AIHA 2KIUA 5DCMA 1K78B 5HLIA 3HTUA 2M45A 3RDIA 1F5TA 1TW3A 1J0RA 3IKTA 4IU6A 4ESFA 3FX3A 2XVCA 4A0XA 1IN8A 3CO7C 2GGCA 4DNCA 2FNAA 5E8IA 1R22A 4NQWA 3HRSA 3P9KA 2V3ZA 5HLGA 4GYIA 5LLQA 1KU2A 2M87A 3HSFA 2Q93A 2O0YA 4FKCA 4U69A 1R36A 3ZMUA 3L24A 1WY2A 1ODDA 3C3WA 5H6QA 4FHTA 1J2XA 1YO5C 3RKXA 1KQ8A 2Z3YA 2BWWA 4M74A 2B3KA 2A5YB 1SMYF 1H0MA 1C22A 2ADUA 3E6MA 1U5TA 1B59A 2PLYA 4RAYA 5LBQA 4L0ZB 1XDUA 2QQAA 3CDHA 3M8FA 1F4KA 1W7VA 3GFIA 1YQAA 1STZA 1XSDA 3W6JB 1IXRC 1KGSA 3W6KB 1S7AA 3LSTA 3FMSA 4IECA 5AONA 2QM3A 4B8XA 5CVUA 3WU1B 2WV0A 4IF7A 2Z99A 4NB5A 1OMIA 2IJLA 3FHZA 3CUQC 5DD4A 1G3WA 3K1PA 1R00A 1R1VA 2JZYA 1CGPA 1SFUA 3V4GA 1YW9A 4PZJA 1GVJA 4S01A 3M7GA 2EFQA 3ZP5A 1FPQA 1QGPA 4R60A 4GGGA 2EFNA 2P7VB 2F5CA 4A0ZA 2A6EF 1USSA 3SZPA 3FXRA 2VXZA 1MJ9A 1EH8A 5D6EA 3GUDA 3TKYA 2BYVE 2W25A 1R58A 1QPMA 4U71A 4EVIA 2DBBA 3ROUA 2IA2A 1SFXA 2VODA 4CGZA 5CDLA 4A6EA 3FM5A 4CXFA 1G4DA 1C27A 1WQ2A 5JHUA 4M6YA 2IRFG 3U9GA 3GF2A 3F23A 5FGMA 1UHWA 1BC8C 1GHCA 3RIRA 3K1NA 4EMSA 3I59B 2MBFA 2EVCA 3BPVA 1S3JA 4LLGF 1TW2A 1KYWA 3IKVA 3BOQA 3DEUA 4UV9A 2OAZA 5LHIA 5CJ9A 2D45A 5DDGA 4Y15A 1R23A 3F6VA 4G7OF 3WE2A 3D5LA 1LB2A 1HSTA 2DK8A 2QZ8A 1O7FA 2W85A 5LHGA 2G9WA 1PUEE 3IHUA 3HSRA 4LG0A 5AIPA 3BDDA 4I0AA 2NNYA 2FU4A 2HYGD 4QWQA 2A3SA 3I5UA 1E17A 2BWXA 5CLSA 1XGMA 4I7HA 4QLCU 2D1VA 3FM3A 2FMYA 3I54A 1JE8A 3IU7A 3ECHA 1YS6A 4XLPF 4HXXA 1IZ1A 1IXSB 3K9TA 3TO9A 3WGIA 3F6OA 4IPAA 4KICA 2DU9A 5HOOA 2AS5F 4Q5SF 3JAMZ 1O7LA 3H92A 4EJWA 2MLGA 5HS9A 4ZWUA 2OZ6A 1UCRA 4ZYGA 2GIVA 2RV8A 4UVBA 4KMUX 1HKTA 2XIGA 2IA0A 1YS7A 2GQQA 3F22A 4RB3C 5ICFA 2BWUA 4OIQF 2ESHA 2VE9A 3BITA 3SQNA 4HF2A 1HXDA 3H3UA 5ILUA 3CJNA 3CTZA 1ZLKA 3WTZA 4G8XA 2GU5A 5ILVA 2HTJA 2VOPA 2K02A 3EDPA 1FOKA 5L3CA 2DTRA 2Q96A 3JTGA 1Z7UA 2K4BA 2Z9OA 5JFRA 4CZZA 3VOEA 1T98A 1BI2A 3RPQA 6PAXA 3FXQA 2DQRA 3IWZA 2DAOA 2QBYB 4MNUA 4N9IA 4LMYA 3GFJA 3M1EA 2HFHA 5KVRA 2ISYA 4EM0B 2IA1A 1AWCA 1XMAA 4IJAA 1A04A 4XLNF 1FBSA 2ZMEB 1T0FA 3GVAA 2GU4A 4ETSA 1OYYA 3P7NA 3QP5A 1B1BA 2HOWA 1FT9A 1LDDA 2MH2A 1ZLJA 2CFXA 4Z7MA 1TQPA 1FBUA 3TOAA 4KA4A 4HX7A 3RTRA 1WI9A 3JSPA 3HYIA 4UUVA 4XBFA 3QU3A 5E1WA 3QRFF 1GXPA 2FE3A 1KQ9A 4LK0F 2V1DA 3IRQA 1B4AA 2QWWA 2DI3A 4A12A 1KU7A 2XAHA 1ZRCA 4RGUA 1W5TA 1DP7P 1RUNA 4N0BA 2E1NA 3DKWA 2B3HA 2XV4S 3DF8A 1L0OC 3RJPA 1T38A 3MR1A 4FO7A 3U2RA 5JR3A 3TQNA 3N4MA 2OQRA 1Z05A 2JSCA 3IWFA 2KRFA 3KZYA 2V9VA 1YLFA 1J59A 2V6CA 5DUKA 5DV5A 4LB5A 3PKAA 4KYWA 1ZARA 1CF7A 1BIAA 4IKRA 4UHTA 2BWTA 5TRDA 2E7WA 5DEQA 3MZHA 4MQ9F 2P6SA 5HLHA 3HRTA 1O0XA 4CICA 1OYWA 2RGVA 3H3ZA 2R7DA 1L3LA 4LB6B 3EYIA 2MH9A 3R6SA 2FEZA 3FXUA 4S04A 5LRRA 1N51A 2O6GE 2BE5F 5F6FA 5DCMB 4XSZF 3BIPA 4HYEA 3M9AA 3PKDA 1W7PA 1TNSA 2GG9A 1S6LA 2P7CB 1MDMA 2CGPA 4LD5A 2DLLA 3I4PA 1JGSA 4HX8A 1J75A 2BHAA 1ZN2A 3NEUA 2L02A 1P92A 1MJBA 4XRFA 5K5RA 4GCVA 4GXOA 4P96A 2L01A 1TNTA 2VC0A 2XAFA 3KP6A 2YX7A 5L3FA 4YFXF 3R60A 2NYXA 2P9AA 1R5HA 1ONVA 5D4RA 1G3YA 3QAHA 1FY7A 5CYVA 5L3DA 3R4KA 1FP1D 2MD5A 5LEKA 1S7OA 1FYMA 2BWVA 1MKMA 1U5TB 3T0YA 5A2QK 1YJ3A 3R61A 5JVTA 4GO1A 2EA2A 2XGXA 3BROA 5CVVA 2BV6A 3O3KA 3NRVA 2OQGA 3BP8A 1D5VA 1VTNC 3PQJA 3OOPA 4AWXB 3CO6C 4U76A 3O6BB 2LNBA 1G3SA 1K79A 1IN5A 4RB0A 4HOBA 4ESBA 5FFZA 3V8JA 1Z1DA 5AIQA 2UXXA 4HA8A 2C6YA 2GG2A 3HSEA 1WL9A 4EJVA 1B6AA 3F3XA 4O3MA 3DQVC 1GXQA 2GA1A 2VBYA 3ZPLA 3HRMA 3TAVA 3E97A 1SMTA 2L4MA 5FD6A 2HKXA 1D3YA 4Y17A 2YR2A 4EGZA 4R8HA 3GFMA 4RGSA 5D8LB 2NNNA 1FBQA 1MD0A 2Q94A 2PEXA 2EV0A 5CDEA 2GU7A 3SHFA 4PGGA 3KE2A 4RGXA 4FO8A 3GLXA 3K1MA 1EV7A 2STWA 1DUXC 2KIFA 4Q48A 2RKHA 2EV5A 1G6NA 2BEOA 2H6CA 2H6BA 4UV8A 1LNWA 2H27A 3T8TA 1FWZA 4UNOA 1M35A 3N97A 3I64A 1O3QA 3KP5A 1U78A 2QQ9A 4PCQA 2DFIA 4HF0A 2ISZA 1KU3A 4HLXA 2E7XA 4BH9A 3LFKA 3WTVC 3Q9SA 2FQ3A 3E6DA 4MEXF 3LQRA 3QPHA 3FMRA 1ZGAA 2GG5A 2ETHA 4UXNA 3RI4A 3MX6A 3MEXA 4I01A 3CTAA 4KN4X 1MJAA 2ACJA 1LEAA 4O6JA 4G6DA 1WRJA 3EUHA 2G7HA 2MATA 4U73A 4ZH4F 2V1UA 1YW7A 1FZPB 1IRGA 1WSUA 4ZWOA 1XD7A 4IF4A 2M5WA 4AVPA 4IKSA 4OU0A 4FT8A 4JK1X 4CYDA 4BHBA 1OYIA 2DW4A 4L9VA 1Z9CA 5FO5A 3J80K 2XRNA 3O2PE 3QP6A 4M9XA 4KIGA 4U0VA 4BAYA 4RAZA 1P6RA 4EJTA 3S2WA 1P4WA 2HGCA 3TDZC 3WTUC 3GYHX 3FMQA 4H0EA 1U3EM 3I0TA 4MHGA 2PJPA 3C18A 1Z6RA 4HZFA 4M72A 2HQNA 4KIFA 4FLJA 2BBYA 1XGOA 4HDUA 1JXSA 2EFPA 3EYYA 1WLRA 2OU2A 3IRRA 1BI0A 3KCCA 3OV8A 2K4JA 4ESJA 2GWRA 2IP2A 3Q9VA 2PFBA 2CWEA 3I71A 4HAMA 4RGZ1 1DDNA 2QENA 1YFHA 2NQ7A 2D1HA 1V4RA 4WCGA 1J7KA 3MCZA 1ZYRF 5IT3A 4P5OA 3ZMTA 4U6EA 2CO5A 3LAPA 3LA3A 3ZN0A 1SD6A 3E6BA 2K7LA 3WTSC 2LF7A 2EJRA 1R1TA 5JI6A 4EQQA 2HWVA 4CDGA 2K86A 5BPDA 3ELKA 5ICEA 1UHMA 2QVOA 3LWFA 2HYFA 4RGRA 1KYZA 3WODF 2F5FA 4L18B 5F1RA 1HW5A 2F2EA 1LEBA 3KLNA 4ENKA 2VBXA 4XSXF 2KKOA 2W84A 5D4SA 4JQFA 3BIQA 2JPBA 4PDKA 3FF5A 3COAC 4S2RP 5CVRA 1U5TC 3RKYA 2O03A 4L0YB 2B3LA 4ENJA 2BHBA 4A6DA 2HR3A 3V8KA 5E20A 3KFWX 1FC3A 4MATA 5K1YA 2W24A 3ULQB 3GFLA 2W57A 3HTSB 2OD5A 4G94A 4U6CA 4UVCA 5FD5A 1YW8A 1XMKA 3L7GA 3GEZA 1ZG5A 5HS8A 4BYYA 4IRIA 1YYVA 1Z91A 5CE6A 3I59A 4I98B 2Q8KA 1G3TA 4CO8A 4WF2A 3F21A 2QUFA 2R3SA 3VODA 3ERED 2V79A 2H09A 1P2FA 4MTEA 2EFWA 3FWEA 4BQAA 4OIPF 3Q6DA 5CDVA 5K5QA 4K2EA 4MGRA 4HX4A 1RIOH 2LSOA 4U0WA 5HDKA 3RORA 5H20A 2DT5A 2GG0A 4OMYA 1A16A 1IN6A 2L3DA 2CYYA 2ZCWA 4HBLA 1PP8F 1QQIA 4E70A 4LK1F 4G9YA 1P4XA 3BJ6A 1F9NA 2Z5UA 4KDPA 2GG7A 4YFKF 2ZNYA 3DXJF 3MAJA 4U6ZA 4YFNF 2HQRA 2XKPA 1K6OA 1JAWA 3KZZA 3LA2A 1XSVA 3KEOA 2XAGA 5HS7A 3ECOA 3PQKA 2M30A 4RB2C 1ZREA 1REPC 4HQEA 5FLXK 5D5WB 2P98A 3PKCA 3KP3A 2CSOA 4D0PA 1LJ9A 2PMHA 4MTDA 4WXHA 1HBXG 1CHMA 3P9IA 1MDMB 1OR7A 1FSEA 2BGCA 2OA4A 3E3VA 5BOXA 1O3RA 4KN7X 2RDPA 3BJAA 5LGNA 5K5OA 4NHJA 4RZZA 5L3BA 2JTVA 3HOTA 1Q1HA 3QU6A 2RQPA 3TOBA 2P6TA 5DUIA 4U7BA 1QXZA 2V3YA 4PNCA 1U2WA 4ON0A 5BS6A 2ZO4A 1ZRDA 2P5VA 3LQQA 2HTSA 2AXLA 2RNJA 4ZNGA 2LKPA 1QXYA 1JHFA 1SD5A 2UWMA 5LHHA 4LJZF 5LGTA 2V1XA 4MEYF 1ZRFA 4EM2A 4U7DA 3ABTA 3DP7A 4MQVA 3IU8A 3J81K 2A6HF 2DO7A 5FCFA 2NRAC 4L5IA 2EVMA 4FX4A 1ZAOA 2P8TA 2ZMEA 4IKTA 3KP7A 3E5UA 1QO0D 3WGGA 1S8NA 3MFKA 2CW0F 1RZ4A 4M9ZA 3R0JA 3V7SA 3RVAA 4IHTA 4ZZLA 3GZ6A 2G7UA 1DPUA 4FLIA 5EEGA 2NS0A 1DPRA 4JUQA 1ZGJA 3K69A 3ZN1A 2V3XA 3D27A 2BWYA 4FLLA 4N9HA 1IUYA 3F8NA 3ISPA 4WXDA 4FX0A 3BPXA 1UFMA 4RB1A 1RNLA 5IT9K 2FOKA 3CUQA 1NHAA 2Q95A 3WGHA 2VOOA 3EETA 5FCHA 2Y75A 2XASA 4IRGA 4EJUA 3FZVA 4A2UA 4A6WA 1BJAA 2P5KA 3KLOA 3TB5A 3D0SA 2J5PA 3BWGA 4G6QA 1BC7C 3SZTA 1U6GA 2YPRA 4PGHA 1TBXA 3I53A 3CB5A 5E8GA 1HQCA 4I02A 2YU3A 3QPTA 3VFZA 5BMZA 4IXAA 1FSHA 4GYGA 3JAMK 4Z2YA 2IVMA 4M6XA 3PFIA 2IW5A 3PKEA 1S29A 4A6VA 3CB6A 5BQTA 3TGNA 5E18F 1PP7U 5D6FA 1BN5A 1ZG1A 5HVQC 1Z6TA 2ZJ2A 4WX9A 2A61A 1YIOA 3S6BA 2EV6A 1PV9A 4IHSA 2VT2A 1W4MA 1QBJA 3J7AO 3GXOA 4ZWPA 1QNTA 4S00A 3B73A 2FNPA 1R5GA 4ZZDA 1XGSA 2UZKA 3IG4A 3C7JA 3PKBA 2NQ6A 2VBZA 1KA8A 5L3GA 4AIJA 2GU6A 2EWNA 5DD8A 3HUGA 5ILSA 1SAXA 4F7ZA 1I1GA 3DV8A 1BIBA 1I1SA 2STTA 4IVNA 3ZQ7A 2ESNA 4ASNA 2DK5A 3ZMDA 4EGYA 3ZMSA 2GXGA 1LVAA 4ENNA 1HSJA 4QR8A 3KP4A 3WG9A 1ZHFA 3G3ZA 4OOKA 2XUBA 2ZKZA 4IRHA 2VBWA 2IW2A 1FLIA 3QOPA 1ON2A 3IL2A 1IW7F 4DQ2A 3AAFA 4KT5C 4HV5A 2M1BA 5E17F 2O61A 4CHUA 1BI1A 2VONA 1MGTA 5LGUA 2P99A 2GGBA 1IN4A 5FLXZ 4L9TA 4EV0A 2PQ8A 4M73A 4BHCA 2ZSGA 4S2TP 1P4AA 2ZBKA 2R7FA 4O5VA 1W2MA 4M71A 2ZXJA 1OKRA 2GAUA 5ERIA 1IN7A 1K78A 1HKQA 5HDGA 2GG8A 4EM1A 1IAWA 1J9IA 1R1UA 2VE8A 3SXYA 5L3EA 1C23A 2BHDA 2GZ5A 4G7ZF 5D5UB 4LG0B 2MLKA 4OOIA 5D5XB 1C21A 2M8EA 2QQBA 4HDVA 2WTEA 1MATA 1RUOA 2LF8A 4OMZA 5CVIA 1LDJA 4WXCA 2GTXA 2Q92A 4KMFA 4ENMA 2F5EA 4L9JA 2J5OA 3ABUA 4EJOA 2XAQA 1T2KA 1WBQA 4L9NA 3L7WA 1WL6A 1B9MA 2ELHA 3E5XA 3MWMA 3J81Z 3HIFA 2D2WA 2HS5A 2O8XA 4BHPA 2HDCA 2Y48A 2PI0A 3WTYC 4EGEA 3I58A 4I2OA 1O57A 1RI7A 1YVMA 2Z33A 4R1HA 3B02A 4R79A 2ZNZA 3BZ6A 2VT3A 1ZH5A 4UVAA 1SD4A 2P5LC 2BWSA 4FUKA 4P9FA 3SFZA 1C0WA 1HKSA 1I6XA 4WWCA 1BI3A 3ZMVA 1JHHA 1F1ZA 1TLHB 5E1ZB 4AD9A 4RS8A 1D8JA 3P9CA 1KQ0A 1ON1A 2X4HA 2BH3A 4P9UA 2DPUA 3M8EA 2O3FA 4HLYA 2EVOA 5IT9Z 3GO5A 2MA3A 2K27A 2L4AA 1SFEA 4RZYA 4U88A 2FMLA 1Y0UA 2TDXA 2RN7A 4M9SA 1USTA 2VC1A 3T5XA 3KEQA 2WWYA 4Q4ZF 1EH6A 4HW0A 3RYRA 1WKMA 3GX4X 3GZ5A