4FUKA

Aminopeptidase from trypanosoma brucei
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
336
structure length
329
Chain Sequence
b'AMKTFDFTGPLRPGKITPRRAVPSHILRPDYADRAGGVSASEEKDRGSKVKVYNIQFLHDDSKAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMYPSPLNYYGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGDLNETVFIGRPDDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQYQCSVVRTYTGHGVGHLFHTSPTVCHYANLGMMRPGHVFTIEPMINLGTWQDVTWPDKWTSTTKDGRRSAQFEHTMVVTNGGVEIFTDWVDGVPTYQKQLKEWGIMLPQRKESATAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Aminpeptidase from Trypanosoma brucei (CASP Target)
rcsb
source organism Trypanosoma brucei brucei
molecule tags Hydrolase
total genus 105
structure length 329
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fukA01
4U6EA 3RORA 2B3LA 2BHBA 4U6CA 3PKBA 5JHUA 4KM3A 2GU5A 2Q93A 2BHCA 4U76A 2V3YA 1XGMA 1W7VA 3BITA 4Z7MA 4A6VA 1YJ3A 1BN5A 2GG7A 5CLSA 1B59A 1CHMA 3MX6A 4A6WA 2GG9A 1XGOA 1Y1NA 1WLRA 2B3HA 3PKEA 3PKAA 3CB5A 1C21A 2NQ6A 2BWWA 4U6WA 3BIPA 2MATA 1C23A 2BHAA 2BWSA 2BWYA 1M35A 2GU4A 4FO7A 3L24A 2V3ZA 1R5GA 4PV4A 1C22A 2B3KA 2V3XA 5E5BA 4FLLA 4S2RP 1QZYA 1WY2A 2OKNA 3CB6A 1QXWA 1BOAA 4U70A 3IU7A 4MATA 2EA4A 4B28A 1YW8A 2GTXA 1PV9A 3S6BA 5JI6A 2EVOA 1W2MA 5CIKA 1YW7A 1C27A 1YVMA 5D6FA 3CTZA 1C24A 1JAWA 2EVMA 4OOKA 1WBQA 3BIQA 4R60A 1QXZA 3D27A 2DFIA 2Q95A 1WL9A 2Q94A 3RVAA 2EVCA 4IU6A 1R58A 2BWXA 4QR8A 2GA2A 2GG2A 5CDLA 4U69A 2P9AA 4IF7A 1XGNA 1O0XA 4ZWUA 2V6CA 3IG4A 4IECA 4FLIA 1B6AA 1KQ9A 1WL6A 4IKTA 4RZZA 4FKCA 1YW9A 1A16A 2GG5A 3MR1A 4PNCA 1WN1A 2BH3A 4S01A 3FMQA 1N51A 2GGCA 4IDYA 4IKUA 2BWUA 4S00A 5D6EA 2GG0A 1KQ0A 4U6ZA 3TB5A 5CDVA 1R5HA 2NQ7A 4FUKA 4FO8A 4JUQA 3PKDA 4FLKA 1XGSA 2OAZA 3PKCA 1KP0A 5CE6A 2GU6A 5FCFA 2GZ5A 2BWVA 2BB7A 4U73A 5FCHA 2GG8A 2GGBA 2HOWA 3L7GA 4RGZ1 4ZWOA 2Q96A 4IPAA 1WKMA 2G6PA 5CNXA 1MATA 2BHDA 2GG3A 4EGEA 2Q92A 2P98A 5CDEA 4IKSA 4ZNGA 3FM3A 2Q8KA 3IU8A 3MATA 4U1BA 1XNZA 2EA2A 1QXYA 2BN7A 2BWTA 5JFRA 4U6JA 2ADUA 3IU9A 2P99A 4FLJA 4HXXA 3FMRA 2GU7A 3Q6DA 4IKRA 4U75A 2IW2A 4RZYA 4ZWPA 2ZSGA 4S2TP 4U71A 3TAVA
chains in the Genus database with same CATH superfamily
4U6EA 3RORA 2B3LA 2BHBA 4U6CA 3PKBA 5JHUA 4KM3A 2GU5A 2Q93A 2BHCA 4U76A 2V3YA 1XGMA 1W7VA 3BITA 4Z7MA 4A6VA 1YJ3A 1BN5A 2GG7A 5CLSA 1B59A 1CHMA 3MX6A 4A6WA 2GG9A 1XGOA 1Y1NA 1WLRA 2B3HA 3PKEA 3PKAA 3CB5A 1C21A 2NQ6A 2BWWA 4U6WA 3BIPA 2MATA 1C23A 2BHAA 2BWSA 2BWYA 1M35A 2GU4A 4FO7A 3L24A 2V3ZA 1R5GA 4PV4A 1C22A 2B3KA 2V3XA 5E5BA 4FLLA 4S2RP 1QZYA 1WY2A 2OKNA 3CB6A 1QXWA 1BOAA 4U70A 3IU7A 4MATA 2EA4A 4B28A 1YW8A 2GTXA 1PV9A 3S6BA 5JI6A 2EVOA 1W2MA 5CIKA 1YW7A 1C27A 1YVMA 5D6FA 3CTZA 1C24A 1JAWA 2EVMA 4OOKA 1WBQA 3BIQA 4R60A 1QXZA 3D27A 2DFIA 2Q95A 1WL9A 2Q94A 3RVAA 2EVCA 4IU6A 1R58A 2BWXA 4QR8A 2GA2A 2GG2A 5CDLA 4U69A 2P9AA 4IF7A 1XGNA 1O0XA 4ZWUA 2V6CA 3IG4A 4IECA 4FLIA 1B6AA 1KQ9A 1WL6A 4IKTA 4RZZA 4FKCA 1YW9A 1A16A 2GG5A 3MR1A 4PNCA 1WN1A 2BH3A 4S01A 3FMQA 1N51A 2GGCA 4IDYA 4IKUA 2BWUA 4S00A 5D6EA 2GG0A 1KQ0A 4U6ZA 3TB5A 5CDVA 1R5HA 2NQ7A 4FUKA 4FO8A 4JUQA 3PKDA 4FLKA 1XGSA 2OAZA 3PKCA 1KP0A 5CE6A 2GU6A 5FCFA 2GZ5A 2BWVA 2BB7A 4U73A 5FCHA 2GG8A 2GGBA 2HOWA 3L7GA 4RGZ1 4ZWOA 2Q96A 4IPAA 1WKMA 2G6PA 5CNXA 1MATA 2BHDA 2GG3A 4EGEA 2Q92A 2P98A 5CDEA 4IKSA 4ZNGA 3FM3A 2Q8KA 3IU8A 3MATA 4U1BA 1XNZA 2EA2A 1QXYA 2BN7A 2BWTA 5JFRA 4U6JA 2ADUA 3IU9A 2P99A 4FLJA 4HXXA 3FMRA 2GU7A 3Q6DA 4IKRA 4U75A 2IW2A 4RZYA 4ZWPA 2ZSGA 4S2TP 4U71A 3TAVA
chains in the Genus database with same CATH topology
4U6EA 3RORA 2B3LA 2BHBA 4U6CA 3PKBA 5JHUA 4KM3A 2GU5A 2Q93A 2BHCA 4U76A 2V3YA 1XGMA 1W7VA 3BITA 4Z7MA 4A6VA 1YJ3A 1BN5A 2GG7A 5CLSA 1B59A 1CHMA 3MX6A 4A6WA 2GG9A 1XGOA 1Y1NA 1WLRA 2B3HA 3PKEA 3PKAA 3CB5A 1C21A 2NQ6A 2BWWA 4U6WA 3BIPA 2MATA 1C23A 2BHAA 2BWSA 2BWYA 1M35A 2GU4A 4FO7A 3L24A 2V3ZA 1R5GA 4PV4A 1C22A 2B3KA 2V3XA 5E5BA 4FLLA 4S2RP 1QZYA 1WY2A 2OKNA 3CB6A 1QXWA 1BOAA 4U70A 3IU7A 4MATA 2EA4A 4B28A 1YW8A 2GTXA 1PV9A 3S6BA 5JI6A 2EVOA 1W2MA 5CIKA 1YW7A 1C27A 1YVMA 5D6FA 3CTZA 1C24A 1JAWA 2EVMA 4OOKA 1WBQA 3BIQA 4R60A 1QXZA 3D27A 2DFIA 2Q95A 1WL9A 2Q94A 3RVAA 2EVCA 4IU6A 1R58A 2BWXA 4QR8A 2GA2A 2GG2A 5CDLA 4U69A 2P9AA 4IF7A 1XGNA 1O0XA 4ZWUA 2V6CA 3IG4A 4IECA 4FLIA 1B6AA 1KQ9A 1WL6A 4IKTA 4RZZA 4FKCA 1YW9A 1A16A 2GG5A 3MR1A 4PNCA 1WN1A 2BH3A 4S01A 3FMQA 1N51A 2GGCA 4IDYA 4IKUA 2BWUA 4S00A 5D6EA 2GG0A 1KQ0A 4U6ZA 3TB5A 5CDVA 1R5HA 2NQ7A 4FUKA 4FO8A 4JUQA 3PKDA 4FLKA 1XGSA 2OAZA 3PKCA 1KP0A 5CE6A 2GU6A 5FCFA 2GZ5A 2BWVA 2BB7A 4U73A 5FCHA 2GG8A 2GGBA 2HOWA 3L7GA 4RGZ1 4ZWOA 2Q96A 4IPAA 1WKMA 2G6PA 5CNXA 1MATA 2BHDA 2GG3A 4EGEA 2Q92A 2P98A 5CDEA 4IKSA 4ZNGA 3FM3A 2Q8KA 3IU8A 3MATA 4U1BA 1XNZA 2EA2A 1QXYA 2BN7A 2BWTA 5JFRA 4U6JA 2ADUA 3IU9A 2P99A 4FLJA 4HXXA 3FMRA 2GU7A 3Q6DA 4IKRA 4U75A 2IW2A 4RZYA 4ZWPA 2ZSGA 4S2TP 4U71A 3TAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6E A;  3ROR A;  2B3L A;  2BHB A;  4U6C A;  3PKB A;  5JHU A;  4KM3 A;  2GU5 A;  2Q93 A;  2BHC A;  4U76 A;  2V3Y A;  1XGM A;  1W7V A;  3BIT A;  4Z7M A;  4A6V A;  1YJ3 A;  1BN5 A;  2GG7 A;  5CLS A;  1B59 A;  1CHM A;  3MX6 A;  4A6W A;  2GG9 A;  1XGO A;  1Y1N A;  1WLR A;  2B3H A;  3PKE A;  3PKA A;  3CB5 A;  1C21 A;  2NQ6 A;  2BWW A;  4U6W A;  3BIP A;  2MAT A;  1C23 A;  2BHA A;  2BWS A;  2BWY A;  1M35 A;  2GU4 A;  4FO7 A;  3L24 A;  2V3Z A;  1R5G A;  4PV4 A;  1C22 A;  2B3K A;  2V3X A;  5E5B A;  4FLL A;  4S2R P;  1QZY A;  1WY2 A;  2OKN A;  3CB6 A;  1QXW A;  1BOA A;  4U70 A;  3IU7 A;  4MAT A;  2EA4 A;  4B28 A;  1YW8 A;  2GTX A;  1PV9 A;  3S6B A;  5JI6 A;  2EVO A;  1W2M A;  5CIK A;  1YW7 A;  1C27 A;  1YVM A;  5D6F A;  3CTZ A;  1C24 A;  1JAW A;  2EVM A;  4OOK A;  1WBQ A;  3BIQ A;  4R60 A;  1QXZ A;  3D27 A;  2DFI A;  2Q95 A;  1WL9 A;  2Q94 A;  3RVA A;  2EVC A;  4IU6 A;  1R58 A;  2BWX A;  4QR8 A;  2GA2 A;  2GG2 A;  5CDL A;  4U69 A;  2P9A A;  4IF7 A;  1XGN A;  1O0X A;  4ZWU A;  2V6C A;  3IG4 A;  4IEC A;  4FLI A;  1B6A A;  1KQ9 A;  1WL6 A;  4IKT A;  4RZZ A;  4FKC A;  1YW9 A;  1A16 A;  2GG5 A;  3MR1 A;  4PNC A;  1WN1 A;  2BH3 A;  4S01 A;  3FMQ A;  1N51 A;  2GGC A;  4IDY A;  4IKU A;  2BWU A;  4S00 A;  5D6E A;  2GG0 A;  1KQ0 A;  4U6Z A;  3TB5 A;  5CDV A;  1R5H A;  2NQ7 A;  4FUK A;  4FO8 A;  4JUQ A;  3PKD A;  4FLK A;  1XGS A;  2OAZ A;  3PKC A;  1KP0 A;  5CE6 A;  2GU6 A;  5FCF A;  2GZ5 A;  2BWV A;  2BB7 A;  4U73 A;  5FCH A;  2GG8 A;  2GGB A;  2HOW A;  3L7G A;  4RGZ 1;  4ZWO A;  2Q96 A;  4IPA A;  1WKM A;  2G6P A;  5CNX A;  1MAT A;  2BHD A;  2GG3 A;  4EGE A;  2Q92 A;  2P98 A;  5CDE A;  4IKS A;  4ZNG A;  3FM3 A;  2Q8K A;  3IU8 A;  3MAT A;  4U1B A;  1XNZ A;  2EA2 A;  1QXY A;  2BN7 A;  2BWT A;  5JFR A;  4U6J A;  2ADU A;  3IU9 A;  2P99 A;  4FLJ A;  4HXX A;  3FMR A;  2GU7 A;  3Q6D A;  4IKR A;  4U75 A;  2IW2 A;  4RZY A;  4ZWP A;  2ZSG A;  4S2T P;  4U71 A;  3TAV A; 
#chains in the Genus database with same CATH topology
 4U6E A;  3ROR A;  2B3L A;  2BHB A;  4U6C A;  3PKB A;  5JHU A;  4KM3 A;  2GU5 A;  2Q93 A;  2BHC A;  4U76 A;  2V3Y A;  1XGM A;  1W7V A;  3BIT A;  4Z7M A;  4A6V A;  1YJ3 A;  1BN5 A;  2GG7 A;  5CLS A;  1B59 A;  1CHM A;  3MX6 A;  4A6W A;  2GG9 A;  1XGO A;  1Y1N A;  1WLR A;  2B3H A;  3PKE A;  3PKA A;  3CB5 A;  1C21 A;  2NQ6 A;  2BWW A;  4U6W A;  3BIP A;  2MAT A;  1C23 A;  2BHA A;  2BWS A;  2BWY A;  1M35 A;  2GU4 A;  4FO7 A;  3L24 A;  2V3Z A;  1R5G A;  4PV4 A;  1C22 A;  2B3K A;  2V3X A;  5E5B A;  4FLL A;  4S2R P;  1QZY A;  1WY2 A;  2OKN A;  3CB6 A;  1QXW A;  1BOA A;  4U70 A;  3IU7 A;  4MAT A;  2EA4 A;  4B28 A;  1YW8 A;  2GTX A;  1PV9 A;  3S6B A;  5JI6 A;  2EVO A;  1W2M A;  5CIK A;  1YW7 A;  1C27 A;  1YVM A;  5D6F A;  3CTZ A;  1C24 A;  1JAW A;  2EVM A;  4OOK A;  1WBQ A;  3BIQ A;  4R60 A;  1QXZ A;  3D27 A;  2DFI A;  2Q95 A;  1WL9 A;  2Q94 A;  3RVA A;  2EVC A;  4IU6 A;  1R58 A;  2BWX A;  4QR8 A;  2GA2 A;  2GG2 A;  5CDL A;  4U69 A;  2P9A A;  4IF7 A;  1XGN A;  1O0X A;  4ZWU A;  2V6C A;  3IG4 A;  4IEC A;  4FLI A;  1B6A A;  1KQ9 A;  1WL6 A;  4IKT A;  4RZZ A;  4FKC A;  1YW9 A;  1A16 A;  2GG5 A;  3MR1 A;  4PNC A;  1WN1 A;  2BH3 A;  4S01 A;  3FMQ A;  1N51 A;  2GGC A;  4IDY A;  4IKU A;  2BWU A;  4S00 A;  5D6E A;  2GG0 A;  1KQ0 A;  4U6Z A;  3TB5 A;  5CDV A;  1R5H A;  2NQ7 A;  4FUK A;  4FO8 A;  4JUQ A;  3PKD A;  4FLK A;  1XGS A;  2OAZ A;  3PKC A;  1KP0 A;  5CE6 A;  2GU6 A;  5FCF A;  2GZ5 A;  2BWV A;  2BB7 A;  4U73 A;  5FCH A;  2GG8 A;  2GGB A;  2HOW A;  3L7G A;  4RGZ 1;  4ZWO A;  2Q96 A;  4IPA A;  1WKM A;  2G6P A;  5CNX A;  1MAT A;  2BHD A;  2GG3 A;  4EGE A;  2Q92 A;  2P98 A;  5CDE A;  4IKS A;  4ZNG A;  3FM3 A;  2Q8K A;  3IU8 A;  3MAT A;  4U1B A;  1XNZ A;  2EA2 A;  1QXY A;  2BN7 A;  2BWT A;  5JFR A;  4U6J A;  2ADU A;  3IU9 A;  2P99 A;  4FLJ A;  4HXX A;  3FMR A;  2GU7 A;  3Q6D A;  4IKR A;  4U75 A;  2IW2 A;  4RZY A;  4ZWP A;  2ZSG A;  4S2T P;  4U71 A;  3TAV A; 
#chains in the Genus database with same CATH homology
 4U6E A;  3ROR A;  2B3L A;  2BHB A;  4U6C A;  3PKB A;  5JHU A;  4KM3 A;  2GU5 A;  2Q93 A;  2BHC A;  4U76 A;  2V3Y A;  1XGM A;  1W7V A;  3BIT A;  4Z7M A;  4A6V A;  1YJ3 A;  1BN5 A;  2GG7 A;  5CLS A;  1B59 A;  1CHM A;  3MX6 A;  4A6W A;  2GG9 A;  1XGO A;  1Y1N A;  1WLR A;  2B3H A;  3PKE A;  3PKA A;  3CB5 A;  1C21 A;  2NQ6 A;  2BWW A;  4U6W A;  3BIP A;  2MAT A;  1C23 A;  2BHA A;  2BWS A;  2BWY A;  1M35 A;  2GU4 A;  4FO7 A;  3L24 A;  2V3Z A;  1R5G A;  4PV4 A;  1C22 A;  2B3K A;  2V3X A;  5E5B A;  4FLL A;  4S2R P;  1QZY A;  1WY2 A;  2OKN A;  3CB6 A;  1QXW A;  1BOA A;  4U70 A;  3IU7 A;  4MAT A;  2EA4 A;  4B28 A;  1YW8 A;  2GTX A;  1PV9 A;  3S6B A;  5JI6 A;  2EVO A;  1W2M A;  5CIK A;  1YW7 A;  1C27 A;  1YVM A;  5D6F A;  3CTZ A;  1C24 A;  1JAW A;  2EVM A;  4OOK A;  1WBQ A;  3BIQ A;  4R60 A;  1QXZ A;  3D27 A;  2DFI A;  2Q95 A;  1WL9 A;  2Q94 A;  3RVA A;  2EVC A;  4IU6 A;  1R58 A;  2BWX A;  4QR8 A;  2GA2 A;  2GG2 A;  5CDL A;  4U69 A;  2P9A A;  4IF7 A;  1XGN A;  1O0X A;  4ZWU A;  2V6C A;  3IG4 A;  4IEC A;  4FLI A;  1B6A A;  1KQ9 A;  1WL6 A;  4IKT A;  4RZZ A;  4FKC A;  1YW9 A;  1A16 A;  2GG5 A;  3MR1 A;  4PNC A;  1WN1 A;  2BH3 A;  4S01 A;  3FMQ A;  1N51 A;  2GGC A;  4IDY A;  4IKU A;  2BWU A;  4S00 A;  5D6E A;  2GG0 A;  1KQ0 A;  4U6Z A;  3TB5 A;  5CDV A;  1R5H A;  2NQ7 A;  4FUK A;  4FO8 A;  4JUQ A;  3PKD A;  4FLK A;  1XGS A;  2OAZ A;  3PKC A;  1KP0 A;  5CE6 A;  2GU6 A;  5FCF A;  2GZ5 A;  2BWV A;  2BB7 A;  4U73 A;  5FCH A;  2GG8 A;  2GGB A;  2HOW A;  3L7G A;  4RGZ 1;  4ZWO A;  2Q96 A;  4IPA A;  1WKM A;  2G6P A;  5CNX A;  1MAT A;  2BHD A;  2GG3 A;  4EGE A;  2Q92 A;  2P98 A;  5CDE A;  4IKS A;  4ZNG A;  3FM3 A;  2Q8K A;  3IU8 A;  3MAT A;  4U1B A;  1XNZ A;  2EA2 A;  1QXY A;  2BN7 A;  2BWT A;  5JFR A;  4U6J A;  2ADU A;  3IU9 A;  2P99 A;  4FLJ A;  4HXX A;  3FMR A;  2GU7 A;  3Q6D A;  4IKR A;  4U75 A;  2IW2 A;  4RZY A;  4ZWP A;  2ZSG A;  4S2T P;  4U71 A;  3TAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...