4FUKA

Aminopeptidase from trypanosoma brucei
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
336
structure length
329
Chain Sequence
AMKTFDFTGPLRPGKITPRRAVPSHILRPDYADRAGGVSASEEKDRGSKVKVYNIQFLHDDSKAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMYPSPLNYYGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGDLNETVFIGRPDDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQYQCSVVRTYTGHGVGHLFHTSPTVCHYANLGMMRPGHVFTIEPMINLGTWQDVTWPDKWTSTTKDGRRSAQFEHTMVVTNGGVEIFTDWVDGVPTYQKQLKEWGIMLPQRKESATAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aminpeptidase from Trypanosoma brucei (CASP Target)
rcsb
source organism Trypanosoma brucei brucei
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 105
structure length 329
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fukA01
2BHDA 2GG2A 1B6AA 1C27A 3BITA 2BHAA 2GA2A 2NQ6A 4U75A 1QXWA 2DFIA 2Q93A 3IU7A 1WL6A 2BB7A 4IF7A 1BN5A 2EVMA 5CE6A 3MX6A 5FCFA 4RZYA 4PNCA 2GU5A 3RVAA 2P98A 2BWSA 2GGBA 4EGEA 1XGNA 3TB5A 2OAZA 2GZ5A 4ZWOA 5JI6A 3IG4A 1XGOA 5E5BA 3PKCA 4IDYA 2IW2A 4U6WA 4U70A 2OKNA 4R60A 4IU6A 3CTZA 4FLKA 2EA2A 1B59A 3FMQA 1YJ3A 3PKBA 1KP0A 2BH3A 2Q96A 3Q6DA 2B3KA 4U73A 1C23A 1WN1A 2BWXA 2G6PA 1JAWA 2V3ZA 2Q92A 2GTXA 2BWTA 4U6EA 4FUKA 5CLSA 1R5GA 2GG5A 1R58A 1YW9A 1WBQA 4U71A 4ZWPA 2HOWA 2ADUA 3L7GA 3IU9A 1C22A 1WKMA 4FKCA 1BOAA 4FLJA 1A16A 1W7VA 2GG9A 3D27A 4FO8A 1MATA 1CHMA 4IECA 4U69A 1YW8A 2Q8KA 5D6FA 5CDVA 2P9AA 2EVCA 2V3XA 4RGZ1 2GG3A 3PKDA 2EA4A 4IPAA 1WLRA 1WL9A 4ZWUA 3IU8A 4IKRA 1KQ0A 4OOKA 4U6CA 5D6EA 4A6WA 2BWUA 1N51A 2Q95A 4QR8A 4U76A 5CDEA 2B3HA 2GU4A 3MR1A 2GU7A 4FO7A 2BWVA 4Z7MA 1O0XA 2V6CA 3BIQA 3TAVA 4U6JA 1YVMA 2B3LA 3BIPA 4FLLA 1QXZA 1XGMA 2BHCA 2V3YA 1QXYA 4ZNGA 4B28A 4S00A 3CB6A 1W2MA 4RZZA 1C24A 3FMRA 5CDLA 3FM3A 1QZYA 4KM3A 1C21A 4U1BA 2GG0A 4U6ZA 4S2TP 2Q94A 1R5HA 1KQ9A 4IKTA 2P99A 4IKSA 1XNZA 1WY2A 2GU6A 4IKUA 5CIKA 5CNXA 5FCHA 1PV9A 2BWYA 5JFRA 2EVOA 2GG8A 2GG7A 2ZSGA 3RORA 1Y1NA 2NQ7A 1XGSA 2GGCA 3CB5A 3PKAA 2BHBA 2BN7A 2MATA 3S6BA 4S2RP 5JHUA 4S01A 3PKEA 3MATA 4MATA 2BWWA 4HXXA 4PV4A 3L24A 4A6VA 1YW7A 4JUQA 1M35A 4FLIA
chains in the Genus database with same CATH superfamily
2BHDA 2GG2A 1B6AA 1C27A 3BITA 2BHAA 2GA2A 2NQ6A 4U75A 1QXWA 2DFIA 2Q93A 3IU7A 1WL6A 2BB7A 4IF7A 1BN5A 2EVMA 5CE6A 3MX6A 5FCFA 4RZYA 4PNCA 2GU5A 3RVAA 2P98A 2BWSA 2GGBA 4EGEA 1XGNA 3TB5A 2OAZA 2GZ5A 4ZWOA 5JI6A 3IG4A 1XGOA 5E5BA 3PKCA 4IDYA 2IW2A 4U6WA 4U70A 2OKNA 4R60A 4IU6A 3CTZA 4FLKA 2EA2A 1B59A 3FMQA 1YJ3A 3PKBA 1KP0A 2BH3A 2Q96A 3Q6DA 2B3KA 4U73A 1C23A 1WN1A 2BWXA 2G6PA 1JAWA 2V3ZA 2Q92A 2GTXA 2BWTA 4U6EA 4FUKA 5CLSA 1R5GA 2GG5A 1R58A 1YW9A 1WBQA 4U71A 4ZWPA 2HOWA 2ADUA 3L7GA 3IU9A 1C22A 1WKMA 4FKCA 1BOAA 4FLJA 1A16A 1W7VA 2GG9A 3D27A 4FO8A 1MATA 1CHMA 4IECA 4U69A 1YW8A 2Q8KA 5D6FA 5CDVA 2P9AA 2EVCA 2V3XA 4RGZ1 2GG3A 3PKDA 2EA4A 4IPAA 1WLRA 1WL9A 4ZWUA 3IU8A 4IKRA 1KQ0A 4OOKA 4U6CA 5D6EA 4A6WA 2BWUA 1N51A 2Q95A 4QR8A 4U76A 5CDEA 2B3HA 2GU4A 3MR1A 2GU7A 4FO7A 2BWVA 4Z7MA 1O0XA 2V6CA 3BIQA 3TAVA 4U6JA 1YVMA 2B3LA 3BIPA 4FLLA 1QXZA 1XGMA 2BHCA 2V3YA 1QXYA 4ZNGA 4B28A 4S00A 3CB6A 1W2MA 4RZZA 1C24A 3FMRA 5CDLA 3FM3A 1QZYA 4KM3A 1C21A 4U1BA 2GG0A 4U6ZA 4S2TP 2Q94A 1R5HA 1KQ9A 4IKTA 2P99A 4IKSA 1XNZA 1WY2A 2GU6A 4IKUA 5CIKA 5CNXA 5FCHA 1PV9A 2BWYA 5JFRA 2EVOA 2GG8A 2GG7A 2ZSGA 3RORA 1Y1NA 2NQ7A 1XGSA 2GGCA 3CB5A 3PKAA 2BHBA 2BN7A 2MATA 3S6BA 4S2RP 5JHUA 4S01A 3PKEA 3MATA 4MATA 2BWWA 4HXXA 4PV4A 3L24A 4A6VA 1YW7A 4JUQA 1M35A 4FLIA
chains in the Genus database with same CATH topology
2BHDA 2GG2A 1B6AA 1C27A 3BITA 2BHAA 2GA2A 2NQ6A 4U75A 1QXWA 2DFIA 2Q93A 3IU7A 1WL6A 2BB7A 4IF7A 1BN5A 2EVMA 5CE6A 3MX6A 5FCFA 4RZYA 4PNCA 2GU5A 3RVAA 2P98A 2BWSA 2GGBA 4EGEA 1XGNA 3TB5A 2OAZA 2GZ5A 4ZWOA 5JI6A 3IG4A 1XGOA 5E5BA 3PKCA 4IDYA 2IW2A 4U6WA 4U70A 2OKNA 4R60A 4IU6A 3CTZA 4FLKA 2EA2A 1B59A 3FMQA 1YJ3A 3PKBA 1KP0A 2BH3A 2Q96A 3Q6DA 2B3KA 4U73A 1C23A 1WN1A 2BWXA 2G6PA 1JAWA 2V3ZA 2Q92A 2GTXA 2BWTA 4U6EA 4FUKA 5CLSA 1R5GA 2GG5A 1R58A 1YW9A 1WBQA 4U71A 4ZWPA 2HOWA 2ADUA 3L7GA 3IU9A 1C22A 1WKMA 4FKCA 1BOAA 4FLJA 1A16A 1W7VA 2GG9A 3D27A 4FO8A 1MATA 1CHMA 4IECA 4U69A 1YW8A 2Q8KA 5D6FA 5CDVA 2P9AA 2EVCA 2V3XA 4RGZ1 2GG3A 3PKDA 2EA4A 4IPAA 1WLRA 1WL9A 4ZWUA 3IU8A 4IKRA 1KQ0A 4OOKA 4U6CA 5D6EA 4A6WA 2BWUA 1N51A 2Q95A 4QR8A 4U76A 5CDEA 2B3HA 2GU4A 3MR1A 2GU7A 4FO7A 2BWVA 4Z7MA 1O0XA 2V6CA 3BIQA 3TAVA 4U6JA 1YVMA 2B3LA 3BIPA 4FLLA 1QXZA 1XGMA 2BHCA 2V3YA 1QXYA 4ZNGA 4B28A 4S00A 3CB6A 1W2MA 4RZZA 1C24A 3FMRA 5CDLA 3FM3A 1QZYA 4KM3A 1C21A 4U1BA 2GG0A 4U6ZA 4S2TP 2Q94A 1R5HA 1KQ9A 4IKTA 2P99A 4IKSA 1XNZA 1WY2A 2GU6A 4IKUA 5CIKA 5CNXA 5FCHA 1PV9A 2BWYA 5JFRA 2EVOA 2GG8A 2GG7A 2ZSGA 3RORA 1Y1NA 2NQ7A 1XGSA 2GGCA 3CB5A 3PKAA 2BHBA 2BN7A 2MATA 3S6BA 4S2RP 5JHUA 4S01A 3PKEA 3MATA 4MATA 2BWWA 4HXXA 4PV4A 3L24A 4A6VA 1YW7A 4JUQA 1M35A 4FLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHD A;  2GG2 A;  1B6A A;  1C27 A;  3BIT A;  2BHA A;  2GA2 A;  2NQ6 A;  4U75 A;  1QXW A;  2DFI A;  2Q93 A;  3IU7 A;  1WL6 A;  2BB7 A;  4IF7 A;  1BN5 A;  2EVM A;  5CE6 A;  3MX6 A;  5FCF A;  4RZY A;  4PNC A;  2GU5 A;  3RVA A;  2P98 A;  2BWS A;  2GGB A;  4EGE A;  1XGN A;  3TB5 A;  2OAZ A;  2GZ5 A;  4ZWO A;  5JI6 A;  3IG4 A;  1XGO A;  5E5B A;  3PKC A;  4IDY A;  2IW2 A;  4U6W A;  4U70 A;  2OKN A;  4R60 A;  4IU6 A;  3CTZ A;  4FLK A;  2EA2 A;  1B59 A;  3FMQ A;  1YJ3 A;  3PKB A;  1KP0 A;  2BH3 A;  2Q96 A;  3Q6D A;  2B3K A;  4U73 A;  1C23 A;  1WN1 A;  2BWX A;  2G6P A;  1JAW A;  2V3Z A;  2Q92 A;  2GTX A;  2BWT A;  4U6E A;  4FUK A;  5CLS A;  1R5G A;  2GG5 A;  1R58 A;  1YW9 A;  1WBQ A;  4U71 A;  4ZWP A;  2HOW A;  2ADU A;  3L7G A;  3IU9 A;  1C22 A;  1WKM A;  4FKC A;  1BOA A;  4FLJ A;  1A16 A;  1W7V A;  2GG9 A;  3D27 A;  4FO8 A;  1MAT A;  1CHM A;  4IEC A;  4U69 A;  1YW8 A;  2Q8K A;  5D6F A;  5CDV A;  2P9A A;  2EVC A;  2V3X A;  4RGZ 1;  2GG3 A;  3PKD A;  2EA4 A;  4IPA A;  1WLR A;  1WL9 A;  4ZWU A;  3IU8 A;  4IKR A;  1KQ0 A;  4OOK A;  4U6C A;  5D6E A;  4A6W A;  2BWU A;  1N51 A;  2Q95 A;  4QR8 A;  4U76 A;  5CDE A;  2B3H A;  2GU4 A;  3MR1 A;  2GU7 A;  4FO7 A;  2BWV A;  4Z7M A;  1O0X A;  2V6C A;  3BIQ A;  3TAV A;  4U6J A;  1YVM A;  2B3L A;  3BIP A;  4FLL A;  1QXZ A;  1XGM A;  2BHC A;  2V3Y A;  1QXY A;  4ZNG A;  4B28 A;  4S00 A;  3CB6 A;  1W2M A;  4RZZ A;  1C24 A;  3FMR A;  5CDL A;  3FM3 A;  1QZY A;  4KM3 A;  1C21 A;  4U1B A;  2GG0 A;  4U6Z A;  4S2T P;  2Q94 A;  1R5H A;  1KQ9 A;  4IKT A;  2P99 A;  4IKS A;  1XNZ A;  1WY2 A;  2GU6 A;  4IKU A;  5CIK A;  5CNX A;  5FCH A;  1PV9 A;  2BWY A;  5JFR A;  2EVO A;  2GG8 A;  2GG7 A;  2ZSG A;  3ROR A;  1Y1N A;  2NQ7 A;  1XGS A;  2GGC A;  3CB5 A;  3PKA A;  2BHB A;  2BN7 A;  2MAT A;  3S6B A;  4S2R P;  5JHU A;  4S01 A;  3PKE A;  3MAT A;  4MAT A;  2BWW A;  4HXX A;  4PV4 A;  3L24 A;  4A6V A;  1YW7 A;  4JUQ A;  1M35 A;  4FLI A; 
#chains in the Genus database with same CATH topology
 2BHD A;  2GG2 A;  1B6A A;  1C27 A;  3BIT A;  2BHA A;  2GA2 A;  2NQ6 A;  4U75 A;  1QXW A;  2DFI A;  2Q93 A;  3IU7 A;  1WL6 A;  2BB7 A;  4IF7 A;  1BN5 A;  2EVM A;  5CE6 A;  3MX6 A;  5FCF A;  4RZY A;  4PNC A;  2GU5 A;  3RVA A;  2P98 A;  2BWS A;  2GGB A;  4EGE A;  1XGN A;  3TB5 A;  2OAZ A;  2GZ5 A;  4ZWO A;  5JI6 A;  3IG4 A;  1XGO A;  5E5B A;  3PKC A;  4IDY A;  2IW2 A;  4U6W A;  4U70 A;  2OKN A;  4R60 A;  4IU6 A;  3CTZ A;  4FLK A;  2EA2 A;  1B59 A;  3FMQ A;  1YJ3 A;  3PKB A;  1KP0 A;  2BH3 A;  2Q96 A;  3Q6D A;  2B3K A;  4U73 A;  1C23 A;  1WN1 A;  2BWX A;  2G6P A;  1JAW A;  2V3Z A;  2Q92 A;  2GTX A;  2BWT A;  4U6E A;  4FUK A;  5CLS A;  1R5G A;  2GG5 A;  1R58 A;  1YW9 A;  1WBQ A;  4U71 A;  4ZWP A;  2HOW A;  2ADU A;  3L7G A;  3IU9 A;  1C22 A;  1WKM A;  4FKC A;  1BOA A;  4FLJ A;  1A16 A;  1W7V A;  2GG9 A;  3D27 A;  4FO8 A;  1MAT A;  1CHM A;  4IEC A;  4U69 A;  1YW8 A;  2Q8K A;  5D6F A;  5CDV A;  2P9A A;  2EVC A;  2V3X A;  4RGZ 1;  2GG3 A;  3PKD A;  2EA4 A;  4IPA A;  1WLR A;  1WL9 A;  4ZWU A;  3IU8 A;  4IKR A;  1KQ0 A;  4OOK A;  4U6C A;  5D6E A;  4A6W A;  2BWU A;  1N51 A;  2Q95 A;  4QR8 A;  4U76 A;  5CDE A;  2B3H A;  2GU4 A;  3MR1 A;  2GU7 A;  4FO7 A;  2BWV A;  4Z7M A;  1O0X A;  2V6C A;  3BIQ A;  3TAV A;  4U6J A;  1YVM A;  2B3L A;  3BIP A;  4FLL A;  1QXZ A;  1XGM A;  2BHC A;  2V3Y A;  1QXY A;  4ZNG A;  4B28 A;  4S00 A;  3CB6 A;  1W2M A;  4RZZ A;  1C24 A;  3FMR A;  5CDL A;  3FM3 A;  1QZY A;  4KM3 A;  1C21 A;  4U1B A;  2GG0 A;  4U6Z A;  4S2T P;  2Q94 A;  1R5H A;  1KQ9 A;  4IKT A;  2P99 A;  4IKS A;  1XNZ A;  1WY2 A;  2GU6 A;  4IKU A;  5CIK A;  5CNX A;  5FCH A;  1PV9 A;  2BWY A;  5JFR A;  2EVO A;  2GG8 A;  2GG7 A;  2ZSG A;  3ROR A;  1Y1N A;  2NQ7 A;  1XGS A;  2GGC A;  3CB5 A;  3PKA A;  2BHB A;  2BN7 A;  2MAT A;  3S6B A;  4S2R P;  5JHU A;  4S01 A;  3PKE A;  3MAT A;  4MAT A;  2BWW A;  4HXX A;  4PV4 A;  3L24 A;  4A6V A;  1YW7 A;  4JUQ A;  1M35 A;  4FLI A; 
#chains in the Genus database with same CATH homology
 2BHD A;  2GG2 A;  1B6A A;  1C27 A;  3BIT A;  2BHA A;  2GA2 A;  2NQ6 A;  4U75 A;  1QXW A;  2DFI A;  2Q93 A;  3IU7 A;  1WL6 A;  2BB7 A;  4IF7 A;  1BN5 A;  2EVM A;  5CE6 A;  3MX6 A;  5FCF A;  4RZY A;  4PNC A;  2GU5 A;  3RVA A;  2P98 A;  2BWS A;  2GGB A;  4EGE A;  1XGN A;  3TB5 A;  2OAZ A;  2GZ5 A;  4ZWO A;  5JI6 A;  3IG4 A;  1XGO A;  5E5B A;  3PKC A;  4IDY A;  2IW2 A;  4U6W A;  4U70 A;  2OKN A;  4R60 A;  4IU6 A;  3CTZ A;  4FLK A;  2EA2 A;  1B59 A;  3FMQ A;  1YJ3 A;  3PKB A;  1KP0 A;  2BH3 A;  2Q96 A;  3Q6D A;  2B3K A;  4U73 A;  1C23 A;  1WN1 A;  2BWX A;  2G6P A;  1JAW A;  2V3Z A;  2Q92 A;  2GTX A;  2BWT A;  4U6E A;  4FUK A;  5CLS A;  1R5G A;  2GG5 A;  1R58 A;  1YW9 A;  1WBQ A;  4U71 A;  4ZWP A;  2HOW A;  2ADU A;  3L7G A;  3IU9 A;  1C22 A;  1WKM A;  4FKC A;  1BOA A;  4FLJ A;  1A16 A;  1W7V A;  2GG9 A;  3D27 A;  4FO8 A;  1MAT A;  1CHM A;  4IEC A;  4U69 A;  1YW8 A;  2Q8K A;  5D6F A;  5CDV A;  2P9A A;  2EVC A;  2V3X A;  4RGZ 1;  2GG3 A;  3PKD A;  2EA4 A;  4IPA A;  1WLR A;  1WL9 A;  4ZWU A;  3IU8 A;  4IKR A;  1KQ0 A;  4OOK A;  4U6C A;  5D6E A;  4A6W A;  2BWU A;  1N51 A;  2Q95 A;  4QR8 A;  4U76 A;  5CDE A;  2B3H A;  2GU4 A;  3MR1 A;  2GU7 A;  4FO7 A;  2BWV A;  4Z7M A;  1O0X A;  2V6C A;  3BIQ A;  3TAV A;  4U6J A;  1YVM A;  2B3L A;  3BIP A;  4FLL A;  1QXZ A;  1XGM A;  2BHC A;  2V3Y A;  1QXY A;  4ZNG A;  4B28 A;  4S00 A;  3CB6 A;  1W2M A;  4RZZ A;  1C24 A;  3FMR A;  5CDL A;  3FM3 A;  1QZY A;  4KM3 A;  1C21 A;  4U1B A;  2GG0 A;  4U6Z A;  4S2T P;  2Q94 A;  1R5H A;  1KQ9 A;  4IKT A;  2P99 A;  4IKS A;  1XNZ A;  1WY2 A;  2GU6 A;  4IKU A;  5CIK A;  5CNX A;  5FCH A;  1PV9 A;  2BWY A;  5JFR A;  2EVO A;  2GG8 A;  2GG7 A;  2ZSG A;  3ROR A;  1Y1N A;  2NQ7 A;  1XGS A;  2GGC A;  3CB5 A;  3PKA A;  2BHB A;  2BN7 A;  2MAT A;  3S6B A;  4S2R P;  5JHU A;  4S01 A;  3PKE A;  3MAT A;  4MAT A;  2BWW A;  4HXX A;  4PV4 A;  3L24 A;  4A6V A;  1YW7 A;  4JUQ A;  1M35 A;  4FLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...