4FUKA

Aminopeptidase from trypanosoma brucei
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
336
structure length
329
Chain Sequence
AMKTFDFTGPLRPGKITPRRAVPSHILRPDYADRAGGVSASEEKDRGSKVKVYNIQFLHDDSKAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMYPSPLNYYGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGDLNETVFIGRPDDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQYQCSVVRTYTGHGVGHLFHTSPTVCHYANLGMMRPGHVFTIEPMINLGTWQDVTWPDKWTSTTKDGRRSAQFEHTMVVTNGGVEIFTDWVDGVPTYQKQLKEWGIMLPQRKESATAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Aminpeptidase from Trypanosoma brucei (CASP Target)
rcsb
source organism Trypanosoma brucei brucei
molecule tags Hydrolase
total genus 105
structure length 329
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fukA01
3D27A 3IU8A 5CDLA 3PKAA 4IKTA 4FUKA 1B6AA 3CB5A 2NQ7A 1W2MA 2ADUA 1XGOA 1YW7A 1C21A 2EA2A 2GG8A 4OOKA 3RVAA 4RGZ1 3PKDA 2GG3A 4U76A 3FMRA 2GGCA 1R5GA 1QXYA 1N51A 4IECA 4EGEA 3CTZA 4IKRA 1QXWA 4S2TP 2P98A 5CIKA 5JI6A 1QZYA 4HXXA 4U6EA 3L24A 1XNZA 2P99A 1C24A 2Q8KA 2V3YA 2GU6A 4RZZA 2BWWA 3IU9A 4S01A 3PKCA 1XGSA 2Q92A 2GU5A 1YJ3A 4QR8A 2BHDA 2P9AA 4ZWUA 4U6CA 2BH3A 3BIQA 4U73A 2BWYA 1CHMA 3BITA 2Q93A 2ZSGA 4PNCA 2BWXA 3TB5A 2G6PA 5CDVA 3IU7A 4U6ZA 2EA4A 2DFIA 4U71A 1Y1NA 2GG9A 2GTXA 1C22A 3L7GA 4U75A 4FLKA 5FCFA 1PV9A 2EVMA 1C23A 2Q94A 2BWTA 2GG5A 1C27A 2Q96A 4FLIA 4ZNGA 4IKSA 2B3LA 2B3KA 3MR1A 4IKUA 1YW8A 2BWSA 1WY2A 3MATA 3PKBA 4S00A 5CLSA 2GU7A 2OAZA 2V3XA 2HOWA 2Q95A 4U6WA 3FM3A 5CNXA 4A6VA 2BWUA 5E5BA 4U6JA 1WKMA 1M35A 2EVCA 4ZWPA 1XGNA 4FKCA 2NQ6A 4PV4A 1WL9A 2BHAA 4S2RP 4RZYA 2V3ZA 1BN5A 2EVOA 3BIPA 5JFRA 2BN7A 1KQ9A 2GU4A 3S6BA 3Q6DA 1XGMA 1BOAA 3MX6A 4U69A 4ZWOA 1WLRA 2GZ5A 2IW2A 2BB7A 2GG0A 2MATA 5FCHA 3CB6A 1W7VA 5D6FA 4A6WA 3IG4A 1KQ0A 2BWVA 2GGBA 4FO7A 5CE6A 4B28A 1MATA 3RORA 1R5HA 1B59A 4MATA 3PKEA 2V6CA 4IF7A 4IPAA 4IU6A 3TAVA 5D6EA 4U70A 2BHBA 2GG2A 1QXZA 1R58A 4FLLA 4IDYA 2B3HA 4FO8A 4JUQA 4Z7MA 1O0XA 1WN1A 4U1BA 4KM3A 1WBQA 1WL6A 1YVMA 1YW9A 4FLJA 2GA2A 2OKNA 1KP0A 2GG7A 3FMQA 5CDEA 2BHCA 4R60A 1A16A 5JHUA 1JAWA
chains in the Genus database with same CATH superfamily
3D27A 3IU8A 5CDLA 3PKAA 4IKTA 4FUKA 1B6AA 3CB5A 2NQ7A 1W2MA 2ADUA 1XGOA 1YW7A 1C21A 2EA2A 2GG8A 4OOKA 3RVAA 4RGZ1 3PKDA 2GG3A 4U76A 3FMRA 2GGCA 1R5GA 1QXYA 1N51A 4IECA 4EGEA 3CTZA 4IKRA 1QXWA 4S2TP 2P98A 5CIKA 5JI6A 1QZYA 4HXXA 4U6EA 3L24A 1XNZA 2P99A 1C24A 2Q8KA 2V3YA 2GU6A 4RZZA 2BWWA 3IU9A 4S01A 3PKCA 1XGSA 2Q92A 2GU5A 1YJ3A 4QR8A 2BHDA 2P9AA 4ZWUA 4U6CA 2BH3A 3BIQA 4U73A 2BWYA 1CHMA 3BITA 2Q93A 2ZSGA 4PNCA 2BWXA 3TB5A 2G6PA 5CDVA 3IU7A 4U6ZA 2EA4A 2DFIA 4U71A 1Y1NA 2GG9A 2GTXA 1C22A 3L7GA 4U75A 4FLKA 5FCFA 1PV9A 2EVMA 1C23A 2Q94A 2BWTA 2GG5A 1C27A 2Q96A 4FLIA 4ZNGA 4IKSA 2B3LA 2B3KA 3MR1A 4IKUA 1YW8A 2BWSA 1WY2A 3MATA 3PKBA 4S00A 5CLSA 2GU7A 2OAZA 2V3XA 2HOWA 2Q95A 4U6WA 3FM3A 5CNXA 4A6VA 2BWUA 5E5BA 4U6JA 1WKMA 1M35A 2EVCA 4ZWPA 1XGNA 4FKCA 2NQ6A 4PV4A 1WL9A 2BHAA 4S2RP 4RZYA 2V3ZA 1BN5A 2EVOA 3BIPA 5JFRA 2BN7A 1KQ9A 2GU4A 3S6BA 3Q6DA 1XGMA 1BOAA 3MX6A 4U69A 4ZWOA 1WLRA 2GZ5A 2IW2A 2BB7A 2GG0A 2MATA 5FCHA 3CB6A 1W7VA 5D6FA 4A6WA 3IG4A 1KQ0A 2BWVA 2GGBA 4FO7A 5CE6A 4B28A 1MATA 3RORA 1R5HA 1B59A 4MATA 3PKEA 2V6CA 4IF7A 4IPAA 4IU6A 3TAVA 5D6EA 4U70A 2BHBA 2GG2A 1QXZA 1R58A 4FLLA 4IDYA 2B3HA 4FO8A 4JUQA 4Z7MA 1O0XA 1WN1A 4U1BA 4KM3A 1WBQA 1WL6A 1YVMA 1YW9A 4FLJA 2GA2A 2OKNA 1KP0A 2GG7A 3FMQA 5CDEA 2BHCA 4R60A 1A16A 5JHUA 1JAWA
chains in the Genus database with same CATH topology
3D27A 3IU8A 5CDLA 3PKAA 4IKTA 4FUKA 1B6AA 3CB5A 2NQ7A 1W2MA 2ADUA 1XGOA 1YW7A 1C21A 2EA2A 2GG8A 4OOKA 3RVAA 4RGZ1 3PKDA 2GG3A 4U76A 3FMRA 2GGCA 1R5GA 1QXYA 1N51A 4IECA 4EGEA 3CTZA 4IKRA 1QXWA 4S2TP 2P98A 5CIKA 5JI6A 1QZYA 4HXXA 4U6EA 3L24A 1XNZA 2P99A 1C24A 2Q8KA 2V3YA 2GU6A 4RZZA 2BWWA 3IU9A 4S01A 3PKCA 1XGSA 2Q92A 2GU5A 1YJ3A 4QR8A 2BHDA 2P9AA 4ZWUA 4U6CA 2BH3A 3BIQA 4U73A 2BWYA 1CHMA 3BITA 2Q93A 2ZSGA 4PNCA 2BWXA 3TB5A 2G6PA 5CDVA 3IU7A 4U6ZA 2EA4A 2DFIA 4U71A 1Y1NA 2GG9A 2GTXA 1C22A 3L7GA 4U75A 4FLKA 5FCFA 1PV9A 2EVMA 1C23A 2Q94A 2BWTA 2GG5A 1C27A 2Q96A 4FLIA 4ZNGA 4IKSA 2B3LA 2B3KA 3MR1A 4IKUA 1YW8A 2BWSA 1WY2A 3MATA 3PKBA 4S00A 5CLSA 2GU7A 2OAZA 2V3XA 2HOWA 2Q95A 4U6WA 3FM3A 5CNXA 4A6VA 2BWUA 5E5BA 4U6JA 1WKMA 1M35A 2EVCA 4ZWPA 1XGNA 4FKCA 2NQ6A 4PV4A 1WL9A 2BHAA 4S2RP 4RZYA 2V3ZA 1BN5A 2EVOA 3BIPA 5JFRA 2BN7A 1KQ9A 2GU4A 3S6BA 3Q6DA 1XGMA 1BOAA 3MX6A 4U69A 4ZWOA 1WLRA 2GZ5A 2IW2A 2BB7A 2GG0A 2MATA 5FCHA 3CB6A 1W7VA 5D6FA 4A6WA 3IG4A 1KQ0A 2BWVA 2GGBA 4FO7A 5CE6A 4B28A 1MATA 3RORA 1R5HA 1B59A 4MATA 3PKEA 2V6CA 4IF7A 4IPAA 4IU6A 3TAVA 5D6EA 4U70A 2BHBA 2GG2A 1QXZA 1R58A 4FLLA 4IDYA 2B3HA 4FO8A 4JUQA 4Z7MA 1O0XA 1WN1A 4U1BA 4KM3A 1WBQA 1WL6A 1YVMA 1YW9A 4FLJA 2GA2A 2OKNA 1KP0A 2GG7A 3FMQA 5CDEA 2BHCA 4R60A 1A16A 5JHUA 1JAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D27 A;  3IU8 A;  5CDL A;  3PKA A;  4IKT A;  4FUK A;  1B6A A;  3CB5 A;  2NQ7 A;  1W2M A;  2ADU A;  1XGO A;  1YW7 A;  1C21 A;  2EA2 A;  2GG8 A;  4OOK A;  3RVA A;  4RGZ 1;  3PKD A;  2GG3 A;  4U76 A;  3FMR A;  2GGC A;  1R5G A;  1QXY A;  1N51 A;  4IEC A;  4EGE A;  3CTZ A;  4IKR A;  1QXW A;  4S2T P;  2P98 A;  5CIK A;  5JI6 A;  1QZY A;  4HXX A;  4U6E A;  3L24 A;  1XNZ A;  2P99 A;  1C24 A;  2Q8K A;  2V3Y A;  2GU6 A;  4RZZ A;  2BWW A;  3IU9 A;  4S01 A;  3PKC A;  1XGS A;  2Q92 A;  2GU5 A;  1YJ3 A;  4QR8 A;  2BHD A;  2P9A A;  4ZWU A;  4U6C A;  2BH3 A;  3BIQ A;  4U73 A;  2BWY A;  1CHM A;  3BIT A;  2Q93 A;  2ZSG A;  4PNC A;  2BWX A;  3TB5 A;  2G6P A;  5CDV A;  3IU7 A;  4U6Z A;  2EA4 A;  2DFI A;  4U71 A;  1Y1N A;  2GG9 A;  2GTX A;  1C22 A;  3L7G A;  4U75 A;  4FLK A;  5FCF A;  1PV9 A;  2EVM A;  1C23 A;  2Q94 A;  2BWT A;  2GG5 A;  1C27 A;  2Q96 A;  4FLI A;  4ZNG A;  4IKS A;  2B3L A;  2B3K A;  3MR1 A;  4IKU A;  1YW8 A;  2BWS A;  1WY2 A;  3MAT A;  3PKB A;  4S00 A;  5CLS A;  2GU7 A;  2OAZ A;  2V3X A;  2HOW A;  2Q95 A;  4U6W A;  3FM3 A;  5CNX A;  4A6V A;  2BWU A;  5E5B A;  4U6J A;  1WKM A;  1M35 A;  2EVC A;  4ZWP A;  1XGN A;  4FKC A;  2NQ6 A;  4PV4 A;  1WL9 A;  2BHA A;  4S2R P;  4RZY A;  2V3Z A;  1BN5 A;  2EVO A;  3BIP A;  5JFR A;  2BN7 A;  1KQ9 A;  2GU4 A;  3S6B A;  3Q6D A;  1XGM A;  1BOA A;  3MX6 A;  4U69 A;  4ZWO A;  1WLR A;  2GZ5 A;  2IW2 A;  2BB7 A;  2GG0 A;  2MAT A;  5FCH A;  3CB6 A;  1W7V A;  5D6F A;  4A6W A;  3IG4 A;  1KQ0 A;  2BWV A;  2GGB A;  4FO7 A;  5CE6 A;  4B28 A;  1MAT A;  3ROR A;  1R5H A;  1B59 A;  4MAT A;  3PKE A;  2V6C A;  4IF7 A;  4IPA A;  4IU6 A;  3TAV A;  5D6E A;  4U70 A;  2BHB A;  2GG2 A;  1QXZ A;  1R58 A;  4FLL A;  4IDY A;  2B3H A;  4FO8 A;  4JUQ A;  4Z7M A;  1O0X A;  1WN1 A;  4U1B A;  4KM3 A;  1WBQ A;  1WL6 A;  1YVM A;  1YW9 A;  4FLJ A;  2GA2 A;  2OKN A;  1KP0 A;  2GG7 A;  3FMQ A;  5CDE A;  2BHC A;  4R60 A;  1A16 A;  5JHU A;  1JAW A; 
#chains in the Genus database with same CATH topology
 3D27 A;  3IU8 A;  5CDL A;  3PKA A;  4IKT A;  4FUK A;  1B6A A;  3CB5 A;  2NQ7 A;  1W2M A;  2ADU A;  1XGO A;  1YW7 A;  1C21 A;  2EA2 A;  2GG8 A;  4OOK A;  3RVA A;  4RGZ 1;  3PKD A;  2GG3 A;  4U76 A;  3FMR A;  2GGC A;  1R5G A;  1QXY A;  1N51 A;  4IEC A;  4EGE A;  3CTZ A;  4IKR A;  1QXW A;  4S2T P;  2P98 A;  5CIK A;  5JI6 A;  1QZY A;  4HXX A;  4U6E A;  3L24 A;  1XNZ A;  2P99 A;  1C24 A;  2Q8K A;  2V3Y A;  2GU6 A;  4RZZ A;  2BWW A;  3IU9 A;  4S01 A;  3PKC A;  1XGS A;  2Q92 A;  2GU5 A;  1YJ3 A;  4QR8 A;  2BHD A;  2P9A A;  4ZWU A;  4U6C A;  2BH3 A;  3BIQ A;  4U73 A;  2BWY A;  1CHM A;  3BIT A;  2Q93 A;  2ZSG A;  4PNC A;  2BWX A;  3TB5 A;  2G6P A;  5CDV A;  3IU7 A;  4U6Z A;  2EA4 A;  2DFI A;  4U71 A;  1Y1N A;  2GG9 A;  2GTX A;  1C22 A;  3L7G A;  4U75 A;  4FLK A;  5FCF A;  1PV9 A;  2EVM A;  1C23 A;  2Q94 A;  2BWT A;  2GG5 A;  1C27 A;  2Q96 A;  4FLI A;  4ZNG A;  4IKS A;  2B3L A;  2B3K A;  3MR1 A;  4IKU A;  1YW8 A;  2BWS A;  1WY2 A;  3MAT A;  3PKB A;  4S00 A;  5CLS A;  2GU7 A;  2OAZ A;  2V3X A;  2HOW A;  2Q95 A;  4U6W A;  3FM3 A;  5CNX A;  4A6V A;  2BWU A;  5E5B A;  4U6J A;  1WKM A;  1M35 A;  2EVC A;  4ZWP A;  1XGN A;  4FKC A;  2NQ6 A;  4PV4 A;  1WL9 A;  2BHA A;  4S2R P;  4RZY A;  2V3Z A;  1BN5 A;  2EVO A;  3BIP A;  5JFR A;  2BN7 A;  1KQ9 A;  2GU4 A;  3S6B A;  3Q6D A;  1XGM A;  1BOA A;  3MX6 A;  4U69 A;  4ZWO A;  1WLR A;  2GZ5 A;  2IW2 A;  2BB7 A;  2GG0 A;  2MAT A;  5FCH A;  3CB6 A;  1W7V A;  5D6F A;  4A6W A;  3IG4 A;  1KQ0 A;  2BWV A;  2GGB A;  4FO7 A;  5CE6 A;  4B28 A;  1MAT A;  3ROR A;  1R5H A;  1B59 A;  4MAT A;  3PKE A;  2V6C A;  4IF7 A;  4IPA A;  4IU6 A;  3TAV A;  5D6E A;  4U70 A;  2BHB A;  2GG2 A;  1QXZ A;  1R58 A;  4FLL A;  4IDY A;  2B3H A;  4FO8 A;  4JUQ A;  4Z7M A;  1O0X A;  1WN1 A;  4U1B A;  4KM3 A;  1WBQ A;  1WL6 A;  1YVM A;  1YW9 A;  4FLJ A;  2GA2 A;  2OKN A;  1KP0 A;  2GG7 A;  3FMQ A;  5CDE A;  2BHC A;  4R60 A;  1A16 A;  5JHU A;  1JAW A; 
#chains in the Genus database with same CATH homology
 3D27 A;  3IU8 A;  5CDL A;  3PKA A;  4IKT A;  4FUK A;  1B6A A;  3CB5 A;  2NQ7 A;  1W2M A;  2ADU A;  1XGO A;  1YW7 A;  1C21 A;  2EA2 A;  2GG8 A;  4OOK A;  3RVA A;  4RGZ 1;  3PKD A;  2GG3 A;  4U76 A;  3FMR A;  2GGC A;  1R5G A;  1QXY A;  1N51 A;  4IEC A;  4EGE A;  3CTZ A;  4IKR A;  1QXW A;  4S2T P;  2P98 A;  5CIK A;  5JI6 A;  1QZY A;  4HXX A;  4U6E A;  3L24 A;  1XNZ A;  2P99 A;  1C24 A;  2Q8K A;  2V3Y A;  2GU6 A;  4RZZ A;  2BWW A;  3IU9 A;  4S01 A;  3PKC A;  1XGS A;  2Q92 A;  2GU5 A;  1YJ3 A;  4QR8 A;  2BHD A;  2P9A A;  4ZWU A;  4U6C A;  2BH3 A;  3BIQ A;  4U73 A;  2BWY A;  1CHM A;  3BIT A;  2Q93 A;  2ZSG A;  4PNC A;  2BWX A;  3TB5 A;  2G6P A;  5CDV A;  3IU7 A;  4U6Z A;  2EA4 A;  2DFI A;  4U71 A;  1Y1N A;  2GG9 A;  2GTX A;  1C22 A;  3L7G A;  4U75 A;  4FLK A;  5FCF A;  1PV9 A;  2EVM A;  1C23 A;  2Q94 A;  2BWT A;  2GG5 A;  1C27 A;  2Q96 A;  4FLI A;  4ZNG A;  4IKS A;  2B3L A;  2B3K A;  3MR1 A;  4IKU A;  1YW8 A;  2BWS A;  1WY2 A;  3MAT A;  3PKB A;  4S00 A;  5CLS A;  2GU7 A;  2OAZ A;  2V3X A;  2HOW A;  2Q95 A;  4U6W A;  3FM3 A;  5CNX A;  4A6V A;  2BWU A;  5E5B A;  4U6J A;  1WKM A;  1M35 A;  2EVC A;  4ZWP A;  1XGN A;  4FKC A;  2NQ6 A;  4PV4 A;  1WL9 A;  2BHA A;  4S2R P;  4RZY A;  2V3Z A;  1BN5 A;  2EVO A;  3BIP A;  5JFR A;  2BN7 A;  1KQ9 A;  2GU4 A;  3S6B A;  3Q6D A;  1XGM A;  1BOA A;  3MX6 A;  4U69 A;  4ZWO A;  1WLR A;  2GZ5 A;  2IW2 A;  2BB7 A;  2GG0 A;  2MAT A;  5FCH A;  3CB6 A;  1W7V A;  5D6F A;  4A6W A;  3IG4 A;  1KQ0 A;  2BWV A;  2GGB A;  4FO7 A;  5CE6 A;  4B28 A;  1MAT A;  3ROR A;  1R5H A;  1B59 A;  4MAT A;  3PKE A;  2V6C A;  4IF7 A;  4IPA A;  4IU6 A;  3TAV A;  5D6E A;  4U70 A;  2BHB A;  2GG2 A;  1QXZ A;  1R58 A;  4FLL A;  4IDY A;  2B3H A;  4FO8 A;  4JUQ A;  4Z7M A;  1O0X A;  1WN1 A;  4U1B A;  4KM3 A;  1WBQ A;  1WL6 A;  1YVM A;  1YW9 A;  4FLJ A;  2GA2 A;  2OKN A;  1KP0 A;  2GG7 A;  3FMQ A;  5CDE A;  2BHC A;  4R60 A;  1A16 A;  5JHU A;  1JAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...