4FLIA

Human metap1 with bengamide analog y16, in mn form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fliA00
1WL9A 1MATA 5E5BA 5FCFA 4OOKA 5CE6A 4U6WA 2BN7A 4FUKA 2GG8A 2GG2A 4S2RP 2ADUA 2Q92A 2EA2A 1XGNA 4U1BA 1KQ9A 3MX6A 4FO7A 1C23A 5D6EA 4FKCA 2BWTA 2EVMA 4QR8A 4RZYA 4A6WA 2P98A 1R5GA 2ZSGA 4IKTA 4Z7MA 3S6BA 4R60A 2GU7A 2Q8KA 5CDLA 2BHBA 1R5HA 4IU6A 5JFRA 1Y1NA 1YJ3A 1C24A 4RGZ1 3CTZA 2Q93A 2Q95A 3PKBA 1PV9A 1QXYA 3L24A 2BHAA 2BB7A 5CNXA 1CHMA 2GU4A 1XGMA 2GZ5A 2IW2A 1QXZA 3TAVA 1YVMA 5CDEA 5CLSA 4U70A 1WY2A 4S00A 2BH3A 5CDVA 1KQ0A 1BN5A 1R58A 2Q94A 1WBQA 2GU6A 4MATA 3Q6DA 4IPAA 2BWUA 4ZNGA 2BWYA 4U6ZA 1A16A 2DFIA 2B3KA 2GA2A 1B6AA 1W7VA 2BHCA 1WKMA 3IU9A 4PV4A 1M35A 2NQ6A 1WLRA 3IU7A 4IKSA 4U71A 1N51A 2GG7A 2GU5A 1O0XA 3FM3A 4B28A 2G6PA 2GG9A 1XGSA 2BWVA 2B3HA 4FLJA 4U6EA 2V6CA 3IG4A 3PKAA 3BIQA 2P99A 3BITA 5FCHA 4U76A 4A6VA 4FLLA 4PNCA 3RORA 1WN1A 4IKRA 4RZZA 3IU8A 2V3XA 5JI6A 2HOWA 3MR1A 4ZWOA 4IECA 2B3LA 1QZYA 2GG0A 2BHDA 3CB5A 2EA4A 2GTXA 2BWSA 2Q96A 1QXWA 4HXXA 2EVCA 2MATA 1C21A 1C27A 4KM3A 3FMRA 2GGBA 5D6FA 3PKEA 1C22A 4ZWPA 1B59A 3FMQA 2V3ZA 1WL6A 4U6JA 2OKNA 4IDYA 2V3YA 3PKDA 4JUQA 5JHUA 2OAZA 1YW9A 3BIPA 1JAWA 1YW7A 3MATA 1W2MA 2GGCA 4FLIA 4S01A 2BWXA 4IKUA 1KP0A 1XNZA 2GG3A 2P9AA 4U69A 2GG5A 1XGOA 2EVOA 2NQ7A 3D27A 4ZWUA 3RVAA 4U73A 4S2TP 3L7GA 4U6CA 4IF7A 4U75A 2BWWA 1BOAA 1YW8A 4FLKA 5CIKA 3PKCA 4EGEA 3CB6A 4FO8A 3TB5A
chains in the Genus database with same CATH superfamily
1WL9A 1MATA 5E5BA 5FCFA 4OOKA 5CE6A 4U6WA 2BN7A 4FUKA 2GG8A 2GG2A 4S2RP 2ADUA 2Q92A 2EA2A 1XGNA 4U1BA 1KQ9A 3MX6A 4FO7A 1C23A 5D6EA 4FKCA 2BWTA 2EVMA 4QR8A 4RZYA 4A6WA 2P98A 1R5GA 2ZSGA 4IKTA 4Z7MA 3S6BA 4R60A 2GU7A 2Q8KA 5CDLA 2BHBA 1R5HA 4IU6A 5JFRA 1Y1NA 1YJ3A 1C24A 4RGZ1 3CTZA 2Q93A 2Q95A 3PKBA 1PV9A 1QXYA 3L24A 2BHAA 2BB7A 5CNXA 1CHMA 2GU4A 1XGMA 2GZ5A 2IW2A 1QXZA 3TAVA 1YVMA 5CDEA 5CLSA 4U70A 1WY2A 4S00A 2BH3A 5CDVA 1KQ0A 1BN5A 1R58A 2Q94A 1WBQA 2GU6A 4MATA 3Q6DA 4IPAA 2BWUA 4ZNGA 2BWYA 4U6ZA 1A16A 2DFIA 2B3KA 2GA2A 1B6AA 1W7VA 2BHCA 1WKMA 3IU9A 4PV4A 1M35A 2NQ6A 1WLRA 3IU7A 4IKSA 4U71A 1N51A 2GG7A 2GU5A 1O0XA 3FM3A 4B28A 2G6PA 2GG9A 1XGSA 2BWVA 2B3HA 4FLJA 4U6EA 2V6CA 3IG4A 3PKAA 3BIQA 2P99A 3BITA 5FCHA 4U76A 4A6VA 4FLLA 4PNCA 3RORA 1WN1A 4IKRA 4RZZA 3IU8A 2V3XA 5JI6A 2HOWA 3MR1A 4ZWOA 4IECA 2B3LA 1QZYA 2GG0A 2BHDA 3CB5A 2EA4A 2GTXA 2BWSA 2Q96A 1QXWA 4HXXA 2EVCA 2MATA 1C21A 1C27A 4KM3A 3FMRA 2GGBA 5D6FA 3PKEA 1C22A 4ZWPA 1B59A 3FMQA 2V3ZA 1WL6A 4U6JA 2OKNA 4IDYA 2V3YA 3PKDA 4JUQA 5JHUA 2OAZA 1YW9A 3BIPA 1JAWA 1YW7A 3MATA 1W2MA 2GGCA 4FLIA 4S01A 2BWXA 4IKUA 1KP0A 1XNZA 2GG3A 2P9AA 4U69A 2GG5A 1XGOA 2EVOA 2NQ7A 3D27A 4ZWUA 3RVAA 4U73A 4S2TP 3L7GA 4U6CA 4IF7A 4U75A 2BWWA 1BOAA 1YW8A 4FLKA 5CIKA 3PKCA 4EGEA 3CB6A 4FO8A 3TB5A
chains in the Genus database with same CATH topology
1WL9A 1MATA 5E5BA 5FCFA 4OOKA 5CE6A 4U6WA 2BN7A 4FUKA 2GG8A 2GG2A 4S2RP 2ADUA 2Q92A 2EA2A 1XGNA 4U1BA 1KQ9A 3MX6A 4FO7A 1C23A 5D6EA 4FKCA 2BWTA 2EVMA 4QR8A 4RZYA 4A6WA 2P98A 1R5GA 2ZSGA 4IKTA 4Z7MA 3S6BA 4R60A 2GU7A 2Q8KA 5CDLA 2BHBA 1R5HA 4IU6A 5JFRA 1Y1NA 1YJ3A 1C24A 4RGZ1 3CTZA 2Q93A 2Q95A 3PKBA 1PV9A 1QXYA 3L24A 2BHAA 2BB7A 5CNXA 1CHMA 2GU4A 1XGMA 2GZ5A 2IW2A 1QXZA 3TAVA 1YVMA 5CDEA 5CLSA 4U70A 1WY2A 4S00A 2BH3A 5CDVA 1KQ0A 1BN5A 1R58A 2Q94A 1WBQA 2GU6A 4MATA 3Q6DA 4IPAA 2BWUA 4ZNGA 2BWYA 4U6ZA 1A16A 2DFIA 2B3KA 2GA2A 1B6AA 1W7VA 2BHCA 1WKMA 3IU9A 4PV4A 1M35A 2NQ6A 1WLRA 3IU7A 4IKSA 4U71A 1N51A 2GG7A 2GU5A 1O0XA 3FM3A 4B28A 2G6PA 2GG9A 1XGSA 2BWVA 2B3HA 4FLJA 4U6EA 2V6CA 3IG4A 3PKAA 3BIQA 2P99A 3BITA 5FCHA 4U76A 4A6VA 4FLLA 4PNCA 3RORA 1WN1A 4IKRA 4RZZA 3IU8A 2V3XA 5JI6A 2HOWA 3MR1A 4ZWOA 4IECA 2B3LA 1QZYA 2GG0A 2BHDA 3CB5A 2EA4A 2GTXA 2BWSA 2Q96A 1QXWA 4HXXA 2EVCA 2MATA 1C21A 1C27A 4KM3A 3FMRA 2GGBA 5D6FA 3PKEA 1C22A 4ZWPA 1B59A 3FMQA 2V3ZA 1WL6A 4U6JA 2OKNA 4IDYA 2V3YA 3PKDA 4JUQA 5JHUA 2OAZA 1YW9A 3BIPA 1JAWA 1YW7A 3MATA 1W2MA 2GGCA 4FLIA 4S01A 2BWXA 4IKUA 1KP0A 1XNZA 2GG3A 2P9AA 4U69A 2GG5A 1XGOA 2EVOA 2NQ7A 3D27A 4ZWUA 3RVAA 4U73A 4S2TP 3L7GA 4U6CA 4IF7A 4U75A 2BWWA 1BOAA 1YW8A 4FLKA 5CIKA 3PKCA 4EGEA 3CB6A 4FO8A 3TB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WL9 A;  1MAT A;  5E5B A;  5FCF A;  4OOK A;  5CE6 A;  4U6W A;  2BN7 A;  4FUK A;  2GG8 A;  2GG2 A;  4S2R P;  2ADU A;  2Q92 A;  2EA2 A;  1XGN A;  4U1B A;  1KQ9 A;  3MX6 A;  4FO7 A;  1C23 A;  5D6E A;  4FKC A;  2BWT A;  2EVM A;  4QR8 A;  4RZY A;  4A6W A;  2P98 A;  1R5G A;  2ZSG A;  4IKT A;  4Z7M A;  3S6B A;  4R60 A;  2GU7 A;  2Q8K A;  5CDL A;  2BHB A;  1R5H A;  4IU6 A;  5JFR A;  1Y1N A;  1YJ3 A;  1C24 A;  4RGZ 1;  3CTZ A;  2Q93 A;  2Q95 A;  3PKB A;  1PV9 A;  1QXY A;  3L24 A;  2BHA A;  2BB7 A;  5CNX A;  1CHM A;  2GU4 A;  1XGM A;  2GZ5 A;  2IW2 A;  1QXZ A;  3TAV A;  1YVM A;  5CDE A;  5CLS A;  4U70 A;  1WY2 A;  4S00 A;  2BH3 A;  5CDV A;  1KQ0 A;  1BN5 A;  1R58 A;  2Q94 A;  1WBQ A;  2GU6 A;  4MAT A;  3Q6D A;  4IPA A;  2BWU A;  4ZNG A;  2BWY A;  4U6Z A;  1A16 A;  2DFI A;  2B3K A;  2GA2 A;  1B6A A;  1W7V A;  2BHC A;  1WKM A;  3IU9 A;  4PV4 A;  1M35 A;  2NQ6 A;  1WLR A;  3IU7 A;  4IKS A;  4U71 A;  1N51 A;  2GG7 A;  2GU5 A;  1O0X A;  3FM3 A;  4B28 A;  2G6P A;  2GG9 A;  1XGS A;  2BWV A;  2B3H A;  4FLJ A;  4U6E A;  2V6C A;  3IG4 A;  3PKA A;  3BIQ A;  2P99 A;  3BIT A;  5FCH A;  4U76 A;  4A6V A;  4FLL A;  4PNC A;  3ROR A;  1WN1 A;  4IKR A;  4RZZ A;  3IU8 A;  2V3X A;  5JI6 A;  2HOW A;  3MR1 A;  4ZWO A;  4IEC A;  2B3L A;  1QZY A;  2GG0 A;  2BHD A;  3CB5 A;  2EA4 A;  2GTX A;  2BWS A;  2Q96 A;  1QXW A;  4HXX A;  2EVC A;  2MAT A;  1C21 A;  1C27 A;  4KM3 A;  3FMR A;  2GGB A;  5D6F A;  3PKE A;  1C22 A;  4ZWP A;  1B59 A;  3FMQ A;  2V3Z A;  1WL6 A;  4U6J A;  2OKN A;  4IDY A;  2V3Y A;  3PKD A;  4JUQ A;  5JHU A;  2OAZ A;  1YW9 A;  3BIP A;  1JAW A;  1YW7 A;  3MAT A;  1W2M A;  2GGC A;  4FLI A;  4S01 A;  2BWX A;  4IKU A;  1KP0 A;  1XNZ A;  2GG3 A;  2P9A A;  4U69 A;  2GG5 A;  1XGO A;  2EVO A;  2NQ7 A;  3D27 A;  4ZWU A;  3RVA A;  4U73 A;  4S2T P;  3L7G A;  4U6C A;  4IF7 A;  4U75 A;  2BWW A;  1BOA A;  1YW8 A;  4FLK A;  5CIK A;  3PKC A;  4EGE A;  3CB6 A;  4FO8 A;  3TB5 A; 
#chains in the Genus database with same CATH topology
 1WL9 A;  1MAT A;  5E5B A;  5FCF A;  4OOK A;  5CE6 A;  4U6W A;  2BN7 A;  4FUK A;  2GG8 A;  2GG2 A;  4S2R P;  2ADU A;  2Q92 A;  2EA2 A;  1XGN A;  4U1B A;  1KQ9 A;  3MX6 A;  4FO7 A;  1C23 A;  5D6E A;  4FKC A;  2BWT A;  2EVM A;  4QR8 A;  4RZY A;  4A6W A;  2P98 A;  1R5G A;  2ZSG A;  4IKT A;  4Z7M A;  3S6B A;  4R60 A;  2GU7 A;  2Q8K A;  5CDL A;  2BHB A;  1R5H A;  4IU6 A;  5JFR A;  1Y1N A;  1YJ3 A;  1C24 A;  4RGZ 1;  3CTZ A;  2Q93 A;  2Q95 A;  3PKB A;  1PV9 A;  1QXY A;  3L24 A;  2BHA A;  2BB7 A;  5CNX A;  1CHM A;  2GU4 A;  1XGM A;  2GZ5 A;  2IW2 A;  1QXZ A;  3TAV A;  1YVM A;  5CDE A;  5CLS A;  4U70 A;  1WY2 A;  4S00 A;  2BH3 A;  5CDV A;  1KQ0 A;  1BN5 A;  1R58 A;  2Q94 A;  1WBQ A;  2GU6 A;  4MAT A;  3Q6D A;  4IPA A;  2BWU A;  4ZNG A;  2BWY A;  4U6Z A;  1A16 A;  2DFI A;  2B3K A;  2GA2 A;  1B6A A;  1W7V A;  2BHC A;  1WKM A;  3IU9 A;  4PV4 A;  1M35 A;  2NQ6 A;  1WLR A;  3IU7 A;  4IKS A;  4U71 A;  1N51 A;  2GG7 A;  2GU5 A;  1O0X A;  3FM3 A;  4B28 A;  2G6P A;  2GG9 A;  1XGS A;  2BWV A;  2B3H A;  4FLJ A;  4U6E A;  2V6C A;  3IG4 A;  3PKA A;  3BIQ A;  2P99 A;  3BIT A;  5FCH A;  4U76 A;  4A6V A;  4FLL A;  4PNC A;  3ROR A;  1WN1 A;  4IKR A;  4RZZ A;  3IU8 A;  2V3X A;  5JI6 A;  2HOW A;  3MR1 A;  4ZWO A;  4IEC A;  2B3L A;  1QZY A;  2GG0 A;  2BHD A;  3CB5 A;  2EA4 A;  2GTX A;  2BWS A;  2Q96 A;  1QXW A;  4HXX A;  2EVC A;  2MAT A;  1C21 A;  1C27 A;  4KM3 A;  3FMR A;  2GGB A;  5D6F A;  3PKE A;  1C22 A;  4ZWP A;  1B59 A;  3FMQ A;  2V3Z A;  1WL6 A;  4U6J A;  2OKN A;  4IDY A;  2V3Y A;  3PKD A;  4JUQ A;  5JHU A;  2OAZ A;  1YW9 A;  3BIP A;  1JAW A;  1YW7 A;  3MAT A;  1W2M A;  2GGC A;  4FLI A;  4S01 A;  2BWX A;  4IKU A;  1KP0 A;  1XNZ A;  2GG3 A;  2P9A A;  4U69 A;  2GG5 A;  1XGO A;  2EVO A;  2NQ7 A;  3D27 A;  4ZWU A;  3RVA A;  4U73 A;  4S2T P;  3L7G A;  4U6C A;  4IF7 A;  4U75 A;  2BWW A;  1BOA A;  1YW8 A;  4FLK A;  5CIK A;  3PKC A;  4EGE A;  3CB6 A;  4FO8 A;  3TB5 A; 
#chains in the Genus database with same CATH homology
 1WL9 A;  1MAT A;  5E5B A;  5FCF A;  4OOK A;  5CE6 A;  4U6W A;  2BN7 A;  4FUK A;  2GG8 A;  2GG2 A;  4S2R P;  2ADU A;  2Q92 A;  2EA2 A;  1XGN A;  4U1B A;  1KQ9 A;  3MX6 A;  4FO7 A;  1C23 A;  5D6E A;  4FKC A;  2BWT A;  2EVM A;  4QR8 A;  4RZY A;  4A6W A;  2P98 A;  1R5G A;  2ZSG A;  4IKT A;  4Z7M A;  3S6B A;  4R60 A;  2GU7 A;  2Q8K A;  5CDL A;  2BHB A;  1R5H A;  4IU6 A;  5JFR A;  1Y1N A;  1YJ3 A;  1C24 A;  4RGZ 1;  3CTZ A;  2Q93 A;  2Q95 A;  3PKB A;  1PV9 A;  1QXY A;  3L24 A;  2BHA A;  2BB7 A;  5CNX A;  1CHM A;  2GU4 A;  1XGM A;  2GZ5 A;  2IW2 A;  1QXZ A;  3TAV A;  1YVM A;  5CDE A;  5CLS A;  4U70 A;  1WY2 A;  4S00 A;  2BH3 A;  5CDV A;  1KQ0 A;  1BN5 A;  1R58 A;  2Q94 A;  1WBQ A;  2GU6 A;  4MAT A;  3Q6D A;  4IPA A;  2BWU A;  4ZNG A;  2BWY A;  4U6Z A;  1A16 A;  2DFI A;  2B3K A;  2GA2 A;  1B6A A;  1W7V A;  2BHC A;  1WKM A;  3IU9 A;  4PV4 A;  1M35 A;  2NQ6 A;  1WLR A;  3IU7 A;  4IKS A;  4U71 A;  1N51 A;  2GG7 A;  2GU5 A;  1O0X A;  3FM3 A;  4B28 A;  2G6P A;  2GG9 A;  1XGS A;  2BWV A;  2B3H A;  4FLJ A;  4U6E A;  2V6C A;  3IG4 A;  3PKA A;  3BIQ A;  2P99 A;  3BIT A;  5FCH A;  4U76 A;  4A6V A;  4FLL A;  4PNC A;  3ROR A;  1WN1 A;  4IKR A;  4RZZ A;  3IU8 A;  2V3X A;  5JI6 A;  2HOW A;  3MR1 A;  4ZWO A;  4IEC A;  2B3L A;  1QZY A;  2GG0 A;  2BHD A;  3CB5 A;  2EA4 A;  2GTX A;  2BWS A;  2Q96 A;  1QXW A;  4HXX A;  2EVC A;  2MAT A;  1C21 A;  1C27 A;  4KM3 A;  3FMR A;  2GGB A;  5D6F A;  3PKE A;  1C22 A;  4ZWP A;  1B59 A;  3FMQ A;  2V3Z A;  1WL6 A;  4U6J A;  2OKN A;  4IDY A;  2V3Y A;  3PKD A;  4JUQ A;  5JHU A;  2OAZ A;  1YW9 A;  3BIP A;  1JAW A;  1YW7 A;  3MAT A;  1W2M A;  2GGC A;  4FLI A;  4S01 A;  2BWX A;  4IKU A;  1KP0 A;  1XNZ A;  2GG3 A;  2P9A A;  4U69 A;  2GG5 A;  1XGO A;  2EVO A;  2NQ7 A;  3D27 A;  4ZWU A;  3RVA A;  4U73 A;  4S2T P;  3L7G A;  4U6C A;  4IF7 A;  4U75 A;  2BWW A;  1BOA A;  1YW8 A;  4FLK A;  5CIK A;  3PKC A;  4EGE A;  3CB6 A;  4FO8 A;  3TB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...