4FLIA

Human metap1 with bengamide analog y16, in mn form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fliA00
2B3KA 2V3XA 2B3HA 4KM3A 4MATA 3MX6A 2EA2A 4A6WA 1R5HA 4Z7MA 1YW8A 3FM3A 4U1BA 1QXZA 1BN5A 3PKAA 2HOWA 1YJ3A 2P9AA 1WKMA 3L24A 2GG5A 3Q6DA 2BHBA 2OAZA 2BHCA 2GU4A 4U69A 4U6WA 5FCHA 2IW2A 2Q95A 1KQ0A 4OOKA 2GG2A 2V3ZA 3PKCA 2ZSGA 4ZWOA 2EVMA 3IU7A 1QZYA 5E5BA 3BIPA 4FUKA 4IKSA 4FLJA 3CTZA 1QXYA 5CLSA 3IU8A 2Q94A 4FLLA 2B3LA 2OKNA 4ZNGA 4IDYA 1W7VA 1KP0A 3PKBA 1XGNA 2BH3A 4R60A 2V3YA 1CHMA 2BN7A 2Q8KA 3BIQA 1PV9A 5D6EA 1R58A 2Q92A 1YW7A 4HXXA 4IKTA 2GG8A 2GA2A 4U70A 1C24A 2GU6A 2GG3A 5JFRA 3PKEA 2BWWA 2BWSA 4U71A 3D27A 2P98A 1C27A 1QXWA 3IU9A 4ZWUA 3MATA 4IU6A 4U6CA 1WL6A 4IKRA 5CIKA 2EVOA 2BHAA 4S2RP 2GU5A 1WY2A 4FLKA 3FMQA 3MR1A 1M35A 5CNXA 1XGSA 5CDVA 4S00A 1C23A 2GGBA 4RZZA 4PV4A 1WLRA 1YW9A 4FKCA 3TAVA 4U6JA 4FLIA 5CDLA 2BWVA 5JHUA 1XGOA 4S2TP 1B59A 2MATA 1WN1A 4FO8A 5D6FA 2Q93A 1YVMA 2BHDA 3RORA 2BWTA 2V6CA 4PNCA 4ZWPA 2GU7A 4IECA 4IF7A 2NQ6A 2Q96A 3L7GA 1JAWA 4U6EA 4B28A 1MATA 4A6VA 3TB5A 2EVCA 4QR8A 1A16A 2GG0A 1XGMA 3S6BA 1B6AA 3BITA 3PKDA 1C22A 2BWYA 4RZYA 1BOAA 4RGZ1 2BWXA 4IPAA 3IG4A 4U6ZA 1KQ9A 3CB5A 4U75A 4S01A 2BWUA 5FCFA 3CB6A 4U73A 1N51A 1C21A 1R5GA 1W2MA 2GTXA 2NQ7A 4FO7A 4EGEA 2GGCA 2GZ5A 2BB7A 1O0XA 3RVAA 2EA4A 1WBQA 4IKUA 2GG7A 1WL9A 2G6PA 1Y1NA 5JI6A 4JUQA 4U76A 2P99A 2ADUA 2GG9A 3FMRA 2DFIA 1XNZA 5CE6A 5CDEA
chains in the Genus database with same CATH superfamily
2B3KA 2V3XA 2B3HA 4KM3A 4MATA 3MX6A 2EA2A 4A6WA 1R5HA 4Z7MA 1YW8A 3FM3A 4U1BA 1QXZA 1BN5A 3PKAA 2HOWA 1YJ3A 2P9AA 1WKMA 3L24A 2GG5A 3Q6DA 2BHBA 2OAZA 2BHCA 2GU4A 4U69A 4U6WA 5FCHA 2IW2A 2Q95A 1KQ0A 4OOKA 2GG2A 2V3ZA 3PKCA 2ZSGA 4ZWOA 2EVMA 3IU7A 1QZYA 5E5BA 3BIPA 4FUKA 4IKSA 4FLJA 3CTZA 1QXYA 5CLSA 3IU8A 2Q94A 4FLLA 2B3LA 2OKNA 4ZNGA 4IDYA 1W7VA 1KP0A 3PKBA 1XGNA 2BH3A 4R60A 2V3YA 1CHMA 2BN7A 2Q8KA 3BIQA 1PV9A 5D6EA 1R58A 2Q92A 1YW7A 4HXXA 4IKTA 2GG8A 2GA2A 4U70A 1C24A 2GU6A 2GG3A 5JFRA 3PKEA 2BWWA 2BWSA 4U71A 3D27A 2P98A 1C27A 1QXWA 3IU9A 4ZWUA 3MATA 4IU6A 4U6CA 1WL6A 4IKRA 5CIKA 2EVOA 2BHAA 4S2RP 2GU5A 1WY2A 4FLKA 3FMQA 3MR1A 1M35A 5CNXA 1XGSA 5CDVA 4S00A 1C23A 2GGBA 4RZZA 4PV4A 1WLRA 1YW9A 4FKCA 3TAVA 4U6JA 4FLIA 5CDLA 2BWVA 5JHUA 1XGOA 4S2TP 1B59A 2MATA 1WN1A 4FO8A 5D6FA 2Q93A 1YVMA 2BHDA 3RORA 2BWTA 2V6CA 4PNCA 4ZWPA 2GU7A 4IECA 4IF7A 2NQ6A 2Q96A 3L7GA 1JAWA 4U6EA 4B28A 1MATA 4A6VA 3TB5A 2EVCA 4QR8A 1A16A 2GG0A 1XGMA 3S6BA 1B6AA 3BITA 3PKDA 1C22A 2BWYA 4RZYA 1BOAA 4RGZ1 2BWXA 4IPAA 3IG4A 4U6ZA 1KQ9A 3CB5A 4U75A 4S01A 2BWUA 5FCFA 3CB6A 4U73A 1N51A 1C21A 1R5GA 1W2MA 2GTXA 2NQ7A 4FO7A 4EGEA 2GGCA 2GZ5A 2BB7A 1O0XA 3RVAA 2EA4A 1WBQA 4IKUA 2GG7A 1WL9A 2G6PA 1Y1NA 5JI6A 4JUQA 4U76A 2P99A 2ADUA 2GG9A 3FMRA 2DFIA 1XNZA 5CE6A 5CDEA
chains in the Genus database with same CATH topology
2B3KA 2V3XA 2B3HA 4KM3A 4MATA 3MX6A 2EA2A 4A6WA 1R5HA 4Z7MA 1YW8A 3FM3A 4U1BA 1QXZA 1BN5A 3PKAA 2HOWA 1YJ3A 2P9AA 1WKMA 3L24A 2GG5A 3Q6DA 2BHBA 2OAZA 2BHCA 2GU4A 4U69A 4U6WA 5FCHA 2IW2A 2Q95A 1KQ0A 4OOKA 2GG2A 2V3ZA 3PKCA 2ZSGA 4ZWOA 2EVMA 3IU7A 1QZYA 5E5BA 3BIPA 4FUKA 4IKSA 4FLJA 3CTZA 1QXYA 5CLSA 3IU8A 2Q94A 4FLLA 2B3LA 2OKNA 4ZNGA 4IDYA 1W7VA 1KP0A 3PKBA 1XGNA 2BH3A 4R60A 2V3YA 1CHMA 2BN7A 2Q8KA 3BIQA 1PV9A 5D6EA 1R58A 2Q92A 1YW7A 4HXXA 4IKTA 2GG8A 2GA2A 4U70A 1C24A 2GU6A 2GG3A 5JFRA 3PKEA 2BWWA 2BWSA 4U71A 3D27A 2P98A 1C27A 1QXWA 3IU9A 4ZWUA 3MATA 4IU6A 4U6CA 1WL6A 4IKRA 5CIKA 2EVOA 2BHAA 4S2RP 2GU5A 1WY2A 4FLKA 3FMQA 3MR1A 1M35A 5CNXA 1XGSA 5CDVA 4S00A 1C23A 2GGBA 4RZZA 4PV4A 1WLRA 1YW9A 4FKCA 3TAVA 4U6JA 4FLIA 5CDLA 2BWVA 5JHUA 1XGOA 4S2TP 1B59A 2MATA 1WN1A 4FO8A 5D6FA 2Q93A 1YVMA 2BHDA 3RORA 2BWTA 2V6CA 4PNCA 4ZWPA 2GU7A 4IECA 4IF7A 2NQ6A 2Q96A 3L7GA 1JAWA 4U6EA 4B28A 1MATA 4A6VA 3TB5A 2EVCA 4QR8A 1A16A 2GG0A 1XGMA 3S6BA 1B6AA 3BITA 3PKDA 1C22A 2BWYA 4RZYA 1BOAA 4RGZ1 2BWXA 4IPAA 3IG4A 4U6ZA 1KQ9A 3CB5A 4U75A 4S01A 2BWUA 5FCFA 3CB6A 4U73A 1N51A 1C21A 1R5GA 1W2MA 2GTXA 2NQ7A 4FO7A 4EGEA 2GGCA 2GZ5A 2BB7A 1O0XA 3RVAA 2EA4A 1WBQA 4IKUA 2GG7A 1WL9A 2G6PA 1Y1NA 5JI6A 4JUQA 4U76A 2P99A 2ADUA 2GG9A 3FMRA 2DFIA 1XNZA 5CE6A 5CDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3K A;  2V3X A;  2B3H A;  4KM3 A;  4MAT A;  3MX6 A;  2EA2 A;  4A6W A;  1R5H A;  4Z7M A;  1YW8 A;  3FM3 A;  4U1B A;  1QXZ A;  1BN5 A;  3PKA A;  2HOW A;  1YJ3 A;  2P9A A;  1WKM A;  3L24 A;  2GG5 A;  3Q6D A;  2BHB A;  2OAZ A;  2BHC A;  2GU4 A;  4U69 A;  4U6W A;  5FCH A;  2IW2 A;  2Q95 A;  1KQ0 A;  4OOK A;  2GG2 A;  2V3Z A;  3PKC A;  2ZSG A;  4ZWO A;  2EVM A;  3IU7 A;  1QZY A;  5E5B A;  3BIP A;  4FUK A;  4IKS A;  4FLJ A;  3CTZ A;  1QXY A;  5CLS A;  3IU8 A;  2Q94 A;  4FLL A;  2B3L A;  2OKN A;  4ZNG A;  4IDY A;  1W7V A;  1KP0 A;  3PKB A;  1XGN A;  2BH3 A;  4R60 A;  2V3Y A;  1CHM A;  2BN7 A;  2Q8K A;  3BIQ A;  1PV9 A;  5D6E A;  1R58 A;  2Q92 A;  1YW7 A;  4HXX A;  4IKT A;  2GG8 A;  2GA2 A;  4U70 A;  1C24 A;  2GU6 A;  2GG3 A;  5JFR A;  3PKE A;  2BWW A;  2BWS A;  4U71 A;  3D27 A;  2P98 A;  1C27 A;  1QXW A;  3IU9 A;  4ZWU A;  3MAT A;  4IU6 A;  4U6C A;  1WL6 A;  4IKR A;  5CIK A;  2EVO A;  2BHA A;  4S2R P;  2GU5 A;  1WY2 A;  4FLK A;  3FMQ A;  3MR1 A;  1M35 A;  5CNX A;  1XGS A;  5CDV A;  4S00 A;  1C23 A;  2GGB A;  4RZZ A;  4PV4 A;  1WLR A;  1YW9 A;  4FKC A;  3TAV A;  4U6J A;  4FLI A;  5CDL A;  2BWV A;  5JHU A;  1XGO A;  4S2T P;  1B59 A;  2MAT A;  1WN1 A;  4FO8 A;  5D6F A;  2Q93 A;  1YVM A;  2BHD A;  3ROR A;  2BWT A;  2V6C A;  4PNC A;  4ZWP A;  2GU7 A;  4IEC A;  4IF7 A;  2NQ6 A;  2Q96 A;  3L7G A;  1JAW A;  4U6E A;  4B28 A;  1MAT A;  4A6V A;  3TB5 A;  2EVC A;  4QR8 A;  1A16 A;  2GG0 A;  1XGM A;  3S6B A;  1B6A A;  3BIT A;  3PKD A;  1C22 A;  2BWY A;  4RZY A;  1BOA A;  4RGZ 1;  2BWX A;  4IPA A;  3IG4 A;  4U6Z A;  1KQ9 A;  3CB5 A;  4U75 A;  4S01 A;  2BWU A;  5FCF A;  3CB6 A;  4U73 A;  1N51 A;  1C21 A;  1R5G A;  1W2M A;  2GTX A;  2NQ7 A;  4FO7 A;  4EGE A;  2GGC A;  2GZ5 A;  2BB7 A;  1O0X A;  3RVA A;  2EA4 A;  1WBQ A;  4IKU A;  2GG7 A;  1WL9 A;  2G6P A;  1Y1N A;  5JI6 A;  4JUQ A;  4U76 A;  2P99 A;  2ADU A;  2GG9 A;  3FMR A;  2DFI A;  1XNZ A;  5CE6 A;  5CDE A; 
#chains in the Genus database with same CATH topology
 2B3K A;  2V3X A;  2B3H A;  4KM3 A;  4MAT A;  3MX6 A;  2EA2 A;  4A6W A;  1R5H A;  4Z7M A;  1YW8 A;  3FM3 A;  4U1B A;  1QXZ A;  1BN5 A;  3PKA A;  2HOW A;  1YJ3 A;  2P9A A;  1WKM A;  3L24 A;  2GG5 A;  3Q6D A;  2BHB A;  2OAZ A;  2BHC A;  2GU4 A;  4U69 A;  4U6W A;  5FCH A;  2IW2 A;  2Q95 A;  1KQ0 A;  4OOK A;  2GG2 A;  2V3Z A;  3PKC A;  2ZSG A;  4ZWO A;  2EVM A;  3IU7 A;  1QZY A;  5E5B A;  3BIP A;  4FUK A;  4IKS A;  4FLJ A;  3CTZ A;  1QXY A;  5CLS A;  3IU8 A;  2Q94 A;  4FLL A;  2B3L A;  2OKN A;  4ZNG A;  4IDY A;  1W7V A;  1KP0 A;  3PKB A;  1XGN A;  2BH3 A;  4R60 A;  2V3Y A;  1CHM A;  2BN7 A;  2Q8K A;  3BIQ A;  1PV9 A;  5D6E A;  1R58 A;  2Q92 A;  1YW7 A;  4HXX A;  4IKT A;  2GG8 A;  2GA2 A;  4U70 A;  1C24 A;  2GU6 A;  2GG3 A;  5JFR A;  3PKE A;  2BWW A;  2BWS A;  4U71 A;  3D27 A;  2P98 A;  1C27 A;  1QXW A;  3IU9 A;  4ZWU A;  3MAT A;  4IU6 A;  4U6C A;  1WL6 A;  4IKR A;  5CIK A;  2EVO A;  2BHA A;  4S2R P;  2GU5 A;  1WY2 A;  4FLK A;  3FMQ A;  3MR1 A;  1M35 A;  5CNX A;  1XGS A;  5CDV A;  4S00 A;  1C23 A;  2GGB A;  4RZZ A;  4PV4 A;  1WLR A;  1YW9 A;  4FKC A;  3TAV A;  4U6J A;  4FLI A;  5CDL A;  2BWV A;  5JHU A;  1XGO A;  4S2T P;  1B59 A;  2MAT A;  1WN1 A;  4FO8 A;  5D6F A;  2Q93 A;  1YVM A;  2BHD A;  3ROR A;  2BWT A;  2V6C A;  4PNC A;  4ZWP A;  2GU7 A;  4IEC A;  4IF7 A;  2NQ6 A;  2Q96 A;  3L7G A;  1JAW A;  4U6E A;  4B28 A;  1MAT A;  4A6V A;  3TB5 A;  2EVC A;  4QR8 A;  1A16 A;  2GG0 A;  1XGM A;  3S6B A;  1B6A A;  3BIT A;  3PKD A;  1C22 A;  2BWY A;  4RZY A;  1BOA A;  4RGZ 1;  2BWX A;  4IPA A;  3IG4 A;  4U6Z A;  1KQ9 A;  3CB5 A;  4U75 A;  4S01 A;  2BWU A;  5FCF A;  3CB6 A;  4U73 A;  1N51 A;  1C21 A;  1R5G A;  1W2M A;  2GTX A;  2NQ7 A;  4FO7 A;  4EGE A;  2GGC A;  2GZ5 A;  2BB7 A;  1O0X A;  3RVA A;  2EA4 A;  1WBQ A;  4IKU A;  2GG7 A;  1WL9 A;  2G6P A;  1Y1N A;  5JI6 A;  4JUQ A;  4U76 A;  2P99 A;  2ADU A;  2GG9 A;  3FMR A;  2DFI A;  1XNZ A;  5CE6 A;  5CDE A; 
#chains in the Genus database with same CATH homology
 2B3K A;  2V3X A;  2B3H A;  4KM3 A;  4MAT A;  3MX6 A;  2EA2 A;  4A6W A;  1R5H A;  4Z7M A;  1YW8 A;  3FM3 A;  4U1B A;  1QXZ A;  1BN5 A;  3PKA A;  2HOW A;  1YJ3 A;  2P9A A;  1WKM A;  3L24 A;  2GG5 A;  3Q6D A;  2BHB A;  2OAZ A;  2BHC A;  2GU4 A;  4U69 A;  4U6W A;  5FCH A;  2IW2 A;  2Q95 A;  1KQ0 A;  4OOK A;  2GG2 A;  2V3Z A;  3PKC A;  2ZSG A;  4ZWO A;  2EVM A;  3IU7 A;  1QZY A;  5E5B A;  3BIP A;  4FUK A;  4IKS A;  4FLJ A;  3CTZ A;  1QXY A;  5CLS A;  3IU8 A;  2Q94 A;  4FLL A;  2B3L A;  2OKN A;  4ZNG A;  4IDY A;  1W7V A;  1KP0 A;  3PKB A;  1XGN A;  2BH3 A;  4R60 A;  2V3Y A;  1CHM A;  2BN7 A;  2Q8K A;  3BIQ A;  1PV9 A;  5D6E A;  1R58 A;  2Q92 A;  1YW7 A;  4HXX A;  4IKT A;  2GG8 A;  2GA2 A;  4U70 A;  1C24 A;  2GU6 A;  2GG3 A;  5JFR A;  3PKE A;  2BWW A;  2BWS A;  4U71 A;  3D27 A;  2P98 A;  1C27 A;  1QXW A;  3IU9 A;  4ZWU A;  3MAT A;  4IU6 A;  4U6C A;  1WL6 A;  4IKR A;  5CIK A;  2EVO A;  2BHA A;  4S2R P;  2GU5 A;  1WY2 A;  4FLK A;  3FMQ A;  3MR1 A;  1M35 A;  5CNX A;  1XGS A;  5CDV A;  4S00 A;  1C23 A;  2GGB A;  4RZZ A;  4PV4 A;  1WLR A;  1YW9 A;  4FKC A;  3TAV A;  4U6J A;  4FLI A;  5CDL A;  2BWV A;  5JHU A;  1XGO A;  4S2T P;  1B59 A;  2MAT A;  1WN1 A;  4FO8 A;  5D6F A;  2Q93 A;  1YVM A;  2BHD A;  3ROR A;  2BWT A;  2V6C A;  4PNC A;  4ZWP A;  2GU7 A;  4IEC A;  4IF7 A;  2NQ6 A;  2Q96 A;  3L7G A;  1JAW A;  4U6E A;  4B28 A;  1MAT A;  4A6V A;  3TB5 A;  2EVC A;  4QR8 A;  1A16 A;  2GG0 A;  1XGM A;  3S6B A;  1B6A A;  3BIT A;  3PKD A;  1C22 A;  2BWY A;  4RZY A;  1BOA A;  4RGZ 1;  2BWX A;  4IPA A;  3IG4 A;  4U6Z A;  1KQ9 A;  3CB5 A;  4U75 A;  4S01 A;  2BWU A;  5FCF A;  3CB6 A;  4U73 A;  1N51 A;  1C21 A;  1R5G A;  1W2M A;  2GTX A;  2NQ7 A;  4FO7 A;  4EGE A;  2GGC A;  2GZ5 A;  2BB7 A;  1O0X A;  3RVA A;  2EA4 A;  1WBQ A;  4IKU A;  2GG7 A;  1WL9 A;  2G6P A;  1Y1N A;  5JI6 A;  4JUQ A;  4U76 A;  2P99 A;  2ADU A;  2GG9 A;  3FMR A;  2DFI A;  1XNZ A;  5CE6 A;  5CDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...