4FLIA

Human metap1 with bengamide analog y16, in mn form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fliA00
2NQ7A 1WY2A 1KP0A 5E5BA 2MATA 1KQ0A 4ZNGA 2B3HA 3PKBA 1R5HA 1QZYA 2G6PA 3L24A 1A16A 4QR8A 4KM3A 2IW2A 2GG7A 4A6WA 3BIQA 2BWWA 4U73A 5CNXA 1R58A 1M35A 2EVOA 4HXXA 1YW8A 2Q94A 4Z7MA 4IPAA 2GG0A 1XNZA 1YJ3A 5JFRA 1C24A 1C27A 1WKMA 1W7VA 1YW9A 3IU9A 4EGEA 4S00A 4U6ZA 1XGNA 4U71A 4S01A 3D27A 2P99A 2P98A 2OKNA 4IKRA 5CIKA 5CLSA 2Q8KA 1WL6A 2GTXA 4U6CA 2GZ5A 4U6EA 1KQ9A 2BN7A 3S6BA 2HOWA 1C23A 4B28A 1O0XA 4FUKA 1YVMA 2GG9A 1B6AA 1R5GA 4FLJA 2GG5A 4R60A 2B3KA 1XGOA 1QXZA 2DFIA 4U6WA 4RGZ1 3PKAA 1C22A 2Q92A 2EVCA 4IECA 1BOAA 2B3LA 3PKEA 4IDYA 1XGMA 1WN1A 1Y1NA 2BHAA 3MATA 4U75A 2GGCA 5D6EA 3IU7A 1BN5A 4S2TP 3IG4A 2GU7A 2V6CA 4FLIA 3FM3A 2BWUA 2ADUA 3Q6DA 2BB7A 3IU8A 4IF7A 1XGSA 1YW7A 2BHCA 4IU6A 2BWVA 1CHMA 2GG8A 4JUQA 4RZZA 4RZYA 2OAZA 2Q96A 4U69A 5JHUA 3CTZA 4PNCA 4OOKA 2GG2A 1PV9A 3PKDA 2Q95A 4FO8A 2BH3A 5CDEA 1B59A 1N51A 2ZSGA 4FLKA 2EVMA 2GGBA 5FCHA 4PV4A 4ZWOA 3TB5A 4MATA 1MATA 3L7GA 5CDLA 4ZWUA 3BITA 4U70A 2BHBA 1C21A 5FCFA 2EA2A 3RVAA 2GU4A 2V3YA 3BIPA 4FKCA 4IKSA 3FMQA 4S2RP 5JI6A 3CB6A 2BHDA 2BWTA 1QXYA 1WL9A 3MR1A 2BWYA 5CDVA 2EA4A 3TAVA 4IKUA 4U6JA 4A6VA 1WLRA 3FMRA 3RORA 2GG3A 2V3XA 4ZWPA 4FLLA 2BWSA 4IKTA 2NQ6A 1JAWA 2Q93A 2GU6A 4U76A 3MX6A 5D6FA 2GA2A 4FO7A 5CE6A 2BWXA 2P9AA 4U1BA 3PKCA 2GU5A 3CB5A 1QXWA 1WBQA 1W2MA 2V3ZA
chains in the Genus database with same CATH superfamily
2NQ7A 1WY2A 1KP0A 5E5BA 2MATA 1KQ0A 4ZNGA 2B3HA 3PKBA 1R5HA 1QZYA 2G6PA 3L24A 1A16A 4QR8A 4KM3A 2IW2A 2GG7A 4A6WA 3BIQA 2BWWA 4U73A 5CNXA 1R58A 1M35A 2EVOA 4HXXA 1YW8A 2Q94A 4Z7MA 4IPAA 2GG0A 1XNZA 1YJ3A 5JFRA 1C24A 1C27A 1WKMA 1W7VA 1YW9A 3IU9A 4EGEA 4S00A 4U6ZA 1XGNA 4U71A 4S01A 3D27A 2P99A 2P98A 2OKNA 4IKRA 5CIKA 5CLSA 2Q8KA 1WL6A 2GTXA 4U6CA 2GZ5A 4U6EA 1KQ9A 2BN7A 3S6BA 2HOWA 1C23A 4B28A 1O0XA 4FUKA 1YVMA 2GG9A 1B6AA 1R5GA 4FLJA 2GG5A 4R60A 2B3KA 1XGOA 1QXZA 2DFIA 4U6WA 4RGZ1 3PKAA 1C22A 2Q92A 2EVCA 4IECA 1BOAA 2B3LA 3PKEA 4IDYA 1XGMA 1WN1A 1Y1NA 2BHAA 3MATA 4U75A 2GGCA 5D6EA 3IU7A 1BN5A 4S2TP 3IG4A 2GU7A 2V6CA 4FLIA 3FM3A 2BWUA 2ADUA 3Q6DA 2BB7A 3IU8A 4IF7A 1XGSA 1YW7A 2BHCA 4IU6A 2BWVA 1CHMA 2GG8A 4JUQA 4RZZA 4RZYA 2OAZA 2Q96A 4U69A 5JHUA 3CTZA 4PNCA 4OOKA 2GG2A 1PV9A 3PKDA 2Q95A 4FO8A 2BH3A 5CDEA 1B59A 1N51A 2ZSGA 4FLKA 2EVMA 2GGBA 5FCHA 4PV4A 4ZWOA 3TB5A 4MATA 1MATA 3L7GA 5CDLA 4ZWUA 3BITA 4U70A 2BHBA 1C21A 5FCFA 2EA2A 3RVAA 2GU4A 2V3YA 3BIPA 4FKCA 4IKSA 3FMQA 4S2RP 5JI6A 3CB6A 2BHDA 2BWTA 1QXYA 1WL9A 3MR1A 2BWYA 5CDVA 2EA4A 3TAVA 4IKUA 4U6JA 4A6VA 1WLRA 3FMRA 3RORA 2GG3A 2V3XA 4ZWPA 4FLLA 2BWSA 4IKTA 2NQ6A 1JAWA 2Q93A 2GU6A 4U76A 3MX6A 5D6FA 2GA2A 4FO7A 5CE6A 2BWXA 2P9AA 4U1BA 3PKCA 2GU5A 3CB5A 1QXWA 1WBQA 1W2MA 2V3ZA
chains in the Genus database with same CATH topology
2NQ7A 1WY2A 1KP0A 5E5BA 2MATA 1KQ0A 4ZNGA 2B3HA 3PKBA 1R5HA 1QZYA 2G6PA 3L24A 1A16A 4QR8A 4KM3A 2IW2A 2GG7A 4A6WA 3BIQA 2BWWA 4U73A 5CNXA 1R58A 1M35A 2EVOA 4HXXA 1YW8A 2Q94A 4Z7MA 4IPAA 2GG0A 1XNZA 1YJ3A 5JFRA 1C24A 1C27A 1WKMA 1W7VA 1YW9A 3IU9A 4EGEA 4S00A 4U6ZA 1XGNA 4U71A 4S01A 3D27A 2P99A 2P98A 2OKNA 4IKRA 5CIKA 5CLSA 2Q8KA 1WL6A 2GTXA 4U6CA 2GZ5A 4U6EA 1KQ9A 2BN7A 3S6BA 2HOWA 1C23A 4B28A 1O0XA 4FUKA 1YVMA 2GG9A 1B6AA 1R5GA 4FLJA 2GG5A 4R60A 2B3KA 1XGOA 1QXZA 2DFIA 4U6WA 4RGZ1 3PKAA 1C22A 2Q92A 2EVCA 4IECA 1BOAA 2B3LA 3PKEA 4IDYA 1XGMA 1WN1A 1Y1NA 2BHAA 3MATA 4U75A 2GGCA 5D6EA 3IU7A 1BN5A 4S2TP 3IG4A 2GU7A 2V6CA 4FLIA 3FM3A 2BWUA 2ADUA 3Q6DA 2BB7A 3IU8A 4IF7A 1XGSA 1YW7A 2BHCA 4IU6A 2BWVA 1CHMA 2GG8A 4JUQA 4RZZA 4RZYA 2OAZA 2Q96A 4U69A 5JHUA 3CTZA 4PNCA 4OOKA 2GG2A 1PV9A 3PKDA 2Q95A 4FO8A 2BH3A 5CDEA 1B59A 1N51A 2ZSGA 4FLKA 2EVMA 2GGBA 5FCHA 4PV4A 4ZWOA 3TB5A 4MATA 1MATA 3L7GA 5CDLA 4ZWUA 3BITA 4U70A 2BHBA 1C21A 5FCFA 2EA2A 3RVAA 2GU4A 2V3YA 3BIPA 4FKCA 4IKSA 3FMQA 4S2RP 5JI6A 3CB6A 2BHDA 2BWTA 1QXYA 1WL9A 3MR1A 2BWYA 5CDVA 2EA4A 3TAVA 4IKUA 4U6JA 4A6VA 1WLRA 3FMRA 3RORA 2GG3A 2V3XA 4ZWPA 4FLLA 2BWSA 4IKTA 2NQ6A 1JAWA 2Q93A 2GU6A 4U76A 3MX6A 5D6FA 2GA2A 4FO7A 5CE6A 2BWXA 2P9AA 4U1BA 3PKCA 2GU5A 3CB5A 1QXWA 1WBQA 1W2MA 2V3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQ7 A;  1WY2 A;  1KP0 A;  5E5B A;  2MAT A;  1KQ0 A;  4ZNG A;  2B3H A;  3PKB A;  1R5H A;  1QZY A;  2G6P A;  3L24 A;  1A16 A;  4QR8 A;  4KM3 A;  2IW2 A;  2GG7 A;  4A6W A;  3BIQ A;  2BWW A;  4U73 A;  5CNX A;  1R58 A;  1M35 A;  2EVO A;  4HXX A;  1YW8 A;  2Q94 A;  4Z7M A;  4IPA A;  2GG0 A;  1XNZ A;  1YJ3 A;  5JFR A;  1C24 A;  1C27 A;  1WKM A;  1W7V A;  1YW9 A;  3IU9 A;  4EGE A;  4S00 A;  4U6Z A;  1XGN A;  4U71 A;  4S01 A;  3D27 A;  2P99 A;  2P98 A;  2OKN A;  4IKR A;  5CIK A;  5CLS A;  2Q8K A;  1WL6 A;  2GTX A;  4U6C A;  2GZ5 A;  4U6E A;  1KQ9 A;  2BN7 A;  3S6B A;  2HOW A;  1C23 A;  4B28 A;  1O0X A;  4FUK A;  1YVM A;  2GG9 A;  1B6A A;  1R5G A;  4FLJ A;  2GG5 A;  4R60 A;  2B3K A;  1XGO A;  1QXZ A;  2DFI A;  4U6W A;  4RGZ 1;  3PKA A;  1C22 A;  2Q92 A;  2EVC A;  4IEC A;  1BOA A;  2B3L A;  3PKE A;  4IDY A;  1XGM A;  1WN1 A;  1Y1N A;  2BHA A;  3MAT A;  4U75 A;  2GGC A;  5D6E A;  3IU7 A;  1BN5 A;  4S2T P;  3IG4 A;  2GU7 A;  2V6C A;  4FLI A;  3FM3 A;  2BWU A;  2ADU A;  3Q6D A;  2BB7 A;  3IU8 A;  4IF7 A;  1XGS A;  1YW7 A;  2BHC A;  4IU6 A;  2BWV A;  1CHM A;  2GG8 A;  4JUQ A;  4RZZ A;  4RZY A;  2OAZ A;  2Q96 A;  4U69 A;  5JHU A;  3CTZ A;  4PNC A;  4OOK A;  2GG2 A;  1PV9 A;  3PKD A;  2Q95 A;  4FO8 A;  2BH3 A;  5CDE A;  1B59 A;  1N51 A;  2ZSG A;  4FLK A;  2EVM A;  2GGB A;  5FCH A;  4PV4 A;  4ZWO A;  3TB5 A;  4MAT A;  1MAT A;  3L7G A;  5CDL A;  4ZWU A;  3BIT A;  4U70 A;  2BHB A;  1C21 A;  5FCF A;  2EA2 A;  3RVA A;  2GU4 A;  2V3Y A;  3BIP A;  4FKC A;  4IKS A;  3FMQ A;  4S2R P;  5JI6 A;  3CB6 A;  2BHD A;  2BWT A;  1QXY A;  1WL9 A;  3MR1 A;  2BWY A;  5CDV A;  2EA4 A;  3TAV A;  4IKU A;  4U6J A;  4A6V A;  1WLR A;  3FMR A;  3ROR A;  2GG3 A;  2V3X A;  4ZWP A;  4FLL A;  2BWS A;  4IKT A;  2NQ6 A;  1JAW A;  2Q93 A;  2GU6 A;  4U76 A;  3MX6 A;  5D6F A;  2GA2 A;  4FO7 A;  5CE6 A;  2BWX A;  2P9A A;  4U1B A;  3PKC A;  2GU5 A;  3CB5 A;  1QXW A;  1WBQ A;  1W2M A;  2V3Z A; 
#chains in the Genus database with same CATH topology
 2NQ7 A;  1WY2 A;  1KP0 A;  5E5B A;  2MAT A;  1KQ0 A;  4ZNG A;  2B3H A;  3PKB A;  1R5H A;  1QZY A;  2G6P A;  3L24 A;  1A16 A;  4QR8 A;  4KM3 A;  2IW2 A;  2GG7 A;  4A6W A;  3BIQ A;  2BWW A;  4U73 A;  5CNX A;  1R58 A;  1M35 A;  2EVO A;  4HXX A;  1YW8 A;  2Q94 A;  4Z7M A;  4IPA A;  2GG0 A;  1XNZ A;  1YJ3 A;  5JFR A;  1C24 A;  1C27 A;  1WKM A;  1W7V A;  1YW9 A;  3IU9 A;  4EGE A;  4S00 A;  4U6Z A;  1XGN A;  4U71 A;  4S01 A;  3D27 A;  2P99 A;  2P98 A;  2OKN A;  4IKR A;  5CIK A;  5CLS A;  2Q8K A;  1WL6 A;  2GTX A;  4U6C A;  2GZ5 A;  4U6E A;  1KQ9 A;  2BN7 A;  3S6B A;  2HOW A;  1C23 A;  4B28 A;  1O0X A;  4FUK A;  1YVM A;  2GG9 A;  1B6A A;  1R5G A;  4FLJ A;  2GG5 A;  4R60 A;  2B3K A;  1XGO A;  1QXZ A;  2DFI A;  4U6W A;  4RGZ 1;  3PKA A;  1C22 A;  2Q92 A;  2EVC A;  4IEC A;  1BOA A;  2B3L A;  3PKE A;  4IDY A;  1XGM A;  1WN1 A;  1Y1N A;  2BHA A;  3MAT A;  4U75 A;  2GGC A;  5D6E A;  3IU7 A;  1BN5 A;  4S2T P;  3IG4 A;  2GU7 A;  2V6C A;  4FLI A;  3FM3 A;  2BWU A;  2ADU A;  3Q6D A;  2BB7 A;  3IU8 A;  4IF7 A;  1XGS A;  1YW7 A;  2BHC A;  4IU6 A;  2BWV A;  1CHM A;  2GG8 A;  4JUQ A;  4RZZ A;  4RZY A;  2OAZ A;  2Q96 A;  4U69 A;  5JHU A;  3CTZ A;  4PNC A;  4OOK A;  2GG2 A;  1PV9 A;  3PKD A;  2Q95 A;  4FO8 A;  2BH3 A;  5CDE A;  1B59 A;  1N51 A;  2ZSG A;  4FLK A;  2EVM A;  2GGB A;  5FCH A;  4PV4 A;  4ZWO A;  3TB5 A;  4MAT A;  1MAT A;  3L7G A;  5CDL A;  4ZWU A;  3BIT A;  4U70 A;  2BHB A;  1C21 A;  5FCF A;  2EA2 A;  3RVA A;  2GU4 A;  2V3Y A;  3BIP A;  4FKC A;  4IKS A;  3FMQ A;  4S2R P;  5JI6 A;  3CB6 A;  2BHD A;  2BWT A;  1QXY A;  1WL9 A;  3MR1 A;  2BWY A;  5CDV A;  2EA4 A;  3TAV A;  4IKU A;  4U6J A;  4A6V A;  1WLR A;  3FMR A;  3ROR A;  2GG3 A;  2V3X A;  4ZWP A;  4FLL A;  2BWS A;  4IKT A;  2NQ6 A;  1JAW A;  2Q93 A;  2GU6 A;  4U76 A;  3MX6 A;  5D6F A;  2GA2 A;  4FO7 A;  5CE6 A;  2BWX A;  2P9A A;  4U1B A;  3PKC A;  2GU5 A;  3CB5 A;  1QXW A;  1WBQ A;  1W2M A;  2V3Z A; 
#chains in the Genus database with same CATH homology
 2NQ7 A;  1WY2 A;  1KP0 A;  5E5B A;  2MAT A;  1KQ0 A;  4ZNG A;  2B3H A;  3PKB A;  1R5H A;  1QZY A;  2G6P A;  3L24 A;  1A16 A;  4QR8 A;  4KM3 A;  2IW2 A;  2GG7 A;  4A6W A;  3BIQ A;  2BWW A;  4U73 A;  5CNX A;  1R58 A;  1M35 A;  2EVO A;  4HXX A;  1YW8 A;  2Q94 A;  4Z7M A;  4IPA A;  2GG0 A;  1XNZ A;  1YJ3 A;  5JFR A;  1C24 A;  1C27 A;  1WKM A;  1W7V A;  1YW9 A;  3IU9 A;  4EGE A;  4S00 A;  4U6Z A;  1XGN A;  4U71 A;  4S01 A;  3D27 A;  2P99 A;  2P98 A;  2OKN A;  4IKR A;  5CIK A;  5CLS A;  2Q8K A;  1WL6 A;  2GTX A;  4U6C A;  2GZ5 A;  4U6E A;  1KQ9 A;  2BN7 A;  3S6B A;  2HOW A;  1C23 A;  4B28 A;  1O0X A;  4FUK A;  1YVM A;  2GG9 A;  1B6A A;  1R5G A;  4FLJ A;  2GG5 A;  4R60 A;  2B3K A;  1XGO A;  1QXZ A;  2DFI A;  4U6W A;  4RGZ 1;  3PKA A;  1C22 A;  2Q92 A;  2EVC A;  4IEC A;  1BOA A;  2B3L A;  3PKE A;  4IDY A;  1XGM A;  1WN1 A;  1Y1N A;  2BHA A;  3MAT A;  4U75 A;  2GGC A;  5D6E A;  3IU7 A;  1BN5 A;  4S2T P;  3IG4 A;  2GU7 A;  2V6C A;  4FLI A;  3FM3 A;  2BWU A;  2ADU A;  3Q6D A;  2BB7 A;  3IU8 A;  4IF7 A;  1XGS A;  1YW7 A;  2BHC A;  4IU6 A;  2BWV A;  1CHM A;  2GG8 A;  4JUQ A;  4RZZ A;  4RZY A;  2OAZ A;  2Q96 A;  4U69 A;  5JHU A;  3CTZ A;  4PNC A;  4OOK A;  2GG2 A;  1PV9 A;  3PKD A;  2Q95 A;  4FO8 A;  2BH3 A;  5CDE A;  1B59 A;  1N51 A;  2ZSG A;  4FLK A;  2EVM A;  2GGB A;  5FCH A;  4PV4 A;  4ZWO A;  3TB5 A;  4MAT A;  1MAT A;  3L7G A;  5CDL A;  4ZWU A;  3BIT A;  4U70 A;  2BHB A;  1C21 A;  5FCF A;  2EA2 A;  3RVA A;  2GU4 A;  2V3Y A;  3BIP A;  4FKC A;  4IKS A;  3FMQ A;  4S2R P;  5JI6 A;  3CB6 A;  2BHD A;  2BWT A;  1QXY A;  1WL9 A;  3MR1 A;  2BWY A;  5CDV A;  2EA4 A;  3TAV A;  4IKU A;  4U6J A;  4A6V A;  1WLR A;  3FMR A;  3ROR A;  2GG3 A;  2V3X A;  4ZWP A;  4FLL A;  2BWS A;  4IKT A;  2NQ6 A;  1JAW A;  2Q93 A;  2GU6 A;  4U76 A;  3MX6 A;  5D6F A;  2GA2 A;  4FO7 A;  5CE6 A;  2BWX A;  2P9A A;  4U1B A;  3PKC A;  2GU5 A;  3CB5 A;  1QXW A;  1WBQ A;  1W2M A;  2V3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...