4FLIA

Human metap1 with bengamide analog y16, in mn form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fliA00
2GGCA 1WL9A 1R58A 1YW7A 2GTXA 4Z7MA 2GG3A 3PKDA 1KQ0A 2BWWA 3CTZA 3IG4A 2OKNA 1WKMA 2B3HA 2BWSA 1KP0A 3Q6DA 3S6BA 3L24A 2GU5A 3IU7A 4IDYA 4U6CA 2Q8KA 2BHAA 4R60A 2Q95A 3CB5A 5JI6A 4IKTA 1MATA 4PNCA 5CE6A 1XGNA 1M35A 2BHBA 2EVMA 4MATA 4U6EA 1W7VA 4FLLA 3BIQA 1C23A 4JUQA 2GG9A 4FLIA 4RZYA 4FLKA 3CB6A 2BWYA 4U6WA 4S2TP 4ZWUA 4QR8A 5CDVA 2ADUA 3FMRA 2GU7A 1R5HA 1QXZA 5CNXA 1Y1NA 3D27A 2BWVA 4S2RP 4B28A 2EVCA 1XGOA 4RZZA 1WY2A 3FM3A 1JAWA 3MR1A 4RGZ1 2B3KA 2HOWA 2GU6A 2P99A 3MX6A 3IU9A 4IKSA 1B59A 4EGEA 2V3YA 4A6VA 2BHCA 4ZWOA 4FO7A 2GU4A 3PKAA 1YJ3A 2IW2A 2EA4A 2OAZA 5FCFA 3RORA 4IKUA 4IKRA 2BN7A 2Q92A 4S00A 4FUKA 1WN1A 1C21A 4U69A 1WL6A 2NQ6A 1WBQA 4ZWPA 4FKCA 2BH3A 2V3XA 4HXXA 4S01A 1QXYA 4OOKA 1A16A 2GG8A 3TAVA 4U6ZA 4KM3A 4IU6A 4PV4A 1WLRA 1BN5A 5CLSA 3RVAA 3BIPA 2Q93A 2ZSGA 4U6JA 4U73A 1BOAA 1QZYA 2GGBA 3BITA 1R5GA 1PV9A 5CDLA 5E5BA 4IECA 2MATA 2V6CA 4U1BA 1CHMA 2BWTA 2DFIA 2BB7A 2EVOA 5D6EA 3FMQA 1C22A 1YVMA 1YW9A 2NQ7A 2GG0A 2Q96A 3PKCA 2G6PA 2Q94A 5JFRA 3MATA 5FCHA 5CIKA 3TB5A 4U71A 4IF7A 2BWUA 2V3ZA 2BWXA 4U76A 4FLJA 4ZNGA 1XGSA 4FO8A 1C24A 1KQ9A 2GA2A 2GG2A 4U70A 1C27A 1QXWA 1N51A 2EA2A 2GG7A 2P9AA 1YW8A 4U75A 4IPAA 2P98A 2BHDA 3IU8A 5JHUA 5D6FA 1XNZA 1B6AA 2GZ5A 2B3LA 1XGMA 2GG5A 4A6WA 3PKEA 1W2MA 3PKBA 1O0XA 3L7GA 5CDEA
chains in the Genus database with same CATH superfamily
2GGCA 1WL9A 1R58A 1YW7A 2GTXA 4Z7MA 2GG3A 3PKDA 1KQ0A 2BWWA 3CTZA 3IG4A 2OKNA 1WKMA 2B3HA 2BWSA 1KP0A 3Q6DA 3S6BA 3L24A 2GU5A 3IU7A 4IDYA 4U6CA 2Q8KA 2BHAA 4R60A 2Q95A 3CB5A 5JI6A 4IKTA 1MATA 4PNCA 5CE6A 1XGNA 1M35A 2BHBA 2EVMA 4MATA 4U6EA 1W7VA 4FLLA 3BIQA 1C23A 4JUQA 2GG9A 4FLIA 4RZYA 4FLKA 3CB6A 2BWYA 4U6WA 4S2TP 4ZWUA 4QR8A 5CDVA 2ADUA 3FMRA 2GU7A 1R5HA 1QXZA 5CNXA 1Y1NA 3D27A 2BWVA 4S2RP 4B28A 2EVCA 1XGOA 4RZZA 1WY2A 3FM3A 1JAWA 3MR1A 4RGZ1 2B3KA 2HOWA 2GU6A 2P99A 3MX6A 3IU9A 4IKSA 1B59A 4EGEA 2V3YA 4A6VA 2BHCA 4ZWOA 4FO7A 2GU4A 3PKAA 1YJ3A 2IW2A 2EA4A 2OAZA 5FCFA 3RORA 4IKUA 4IKRA 2BN7A 2Q92A 4S00A 4FUKA 1WN1A 1C21A 4U69A 1WL6A 2NQ6A 1WBQA 4ZWPA 4FKCA 2BH3A 2V3XA 4HXXA 4S01A 1QXYA 4OOKA 1A16A 2GG8A 3TAVA 4U6ZA 4KM3A 4IU6A 4PV4A 1WLRA 1BN5A 5CLSA 3RVAA 3BIPA 2Q93A 2ZSGA 4U6JA 4U73A 1BOAA 1QZYA 2GGBA 3BITA 1R5GA 1PV9A 5CDLA 5E5BA 4IECA 2MATA 2V6CA 4U1BA 1CHMA 2BWTA 2DFIA 2BB7A 2EVOA 5D6EA 3FMQA 1C22A 1YVMA 1YW9A 2NQ7A 2GG0A 2Q96A 3PKCA 2G6PA 2Q94A 5JFRA 3MATA 5FCHA 5CIKA 3TB5A 4U71A 4IF7A 2BWUA 2V3ZA 2BWXA 4U76A 4FLJA 4ZNGA 1XGSA 4FO8A 1C24A 1KQ9A 2GA2A 2GG2A 4U70A 1C27A 1QXWA 1N51A 2EA2A 2GG7A 2P9AA 1YW8A 4U75A 4IPAA 2P98A 2BHDA 3IU8A 5JHUA 5D6FA 1XNZA 1B6AA 2GZ5A 2B3LA 1XGMA 2GG5A 4A6WA 3PKEA 1W2MA 3PKBA 1O0XA 3L7GA 5CDEA
chains in the Genus database with same CATH topology
2GGCA 1WL9A 1R58A 1YW7A 2GTXA 4Z7MA 2GG3A 3PKDA 1KQ0A 2BWWA 3CTZA 3IG4A 2OKNA 1WKMA 2B3HA 2BWSA 1KP0A 3Q6DA 3S6BA 3L24A 2GU5A 3IU7A 4IDYA 4U6CA 2Q8KA 2BHAA 4R60A 2Q95A 3CB5A 5JI6A 4IKTA 1MATA 4PNCA 5CE6A 1XGNA 1M35A 2BHBA 2EVMA 4MATA 4U6EA 1W7VA 4FLLA 3BIQA 1C23A 4JUQA 2GG9A 4FLIA 4RZYA 4FLKA 3CB6A 2BWYA 4U6WA 4S2TP 4ZWUA 4QR8A 5CDVA 2ADUA 3FMRA 2GU7A 1R5HA 1QXZA 5CNXA 1Y1NA 3D27A 2BWVA 4S2RP 4B28A 2EVCA 1XGOA 4RZZA 1WY2A 3FM3A 1JAWA 3MR1A 4RGZ1 2B3KA 2HOWA 2GU6A 2P99A 3MX6A 3IU9A 4IKSA 1B59A 4EGEA 2V3YA 4A6VA 2BHCA 4ZWOA 4FO7A 2GU4A 3PKAA 1YJ3A 2IW2A 2EA4A 2OAZA 5FCFA 3RORA 4IKUA 4IKRA 2BN7A 2Q92A 4S00A 4FUKA 1WN1A 1C21A 4U69A 1WL6A 2NQ6A 1WBQA 4ZWPA 4FKCA 2BH3A 2V3XA 4HXXA 4S01A 1QXYA 4OOKA 1A16A 2GG8A 3TAVA 4U6ZA 4KM3A 4IU6A 4PV4A 1WLRA 1BN5A 5CLSA 3RVAA 3BIPA 2Q93A 2ZSGA 4U6JA 4U73A 1BOAA 1QZYA 2GGBA 3BITA 1R5GA 1PV9A 5CDLA 5E5BA 4IECA 2MATA 2V6CA 4U1BA 1CHMA 2BWTA 2DFIA 2BB7A 2EVOA 5D6EA 3FMQA 1C22A 1YVMA 1YW9A 2NQ7A 2GG0A 2Q96A 3PKCA 2G6PA 2Q94A 5JFRA 3MATA 5FCHA 5CIKA 3TB5A 4U71A 4IF7A 2BWUA 2V3ZA 2BWXA 4U76A 4FLJA 4ZNGA 1XGSA 4FO8A 1C24A 1KQ9A 2GA2A 2GG2A 4U70A 1C27A 1QXWA 1N51A 2EA2A 2GG7A 2P9AA 1YW8A 4U75A 4IPAA 2P98A 2BHDA 3IU8A 5JHUA 5D6FA 1XNZA 1B6AA 2GZ5A 2B3LA 1XGMA 2GG5A 4A6WA 3PKEA 1W2MA 3PKBA 1O0XA 3L7GA 5CDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGC A;  1WL9 A;  1R58 A;  1YW7 A;  2GTX A;  4Z7M A;  2GG3 A;  3PKD A;  1KQ0 A;  2BWW A;  3CTZ A;  3IG4 A;  2OKN A;  1WKM A;  2B3H A;  2BWS A;  1KP0 A;  3Q6D A;  3S6B A;  3L24 A;  2GU5 A;  3IU7 A;  4IDY A;  4U6C A;  2Q8K A;  2BHA A;  4R60 A;  2Q95 A;  3CB5 A;  5JI6 A;  4IKT A;  1MAT A;  4PNC A;  5CE6 A;  1XGN A;  1M35 A;  2BHB A;  2EVM A;  4MAT A;  4U6E A;  1W7V A;  4FLL A;  3BIQ A;  1C23 A;  4JUQ A;  2GG9 A;  4FLI A;  4RZY A;  4FLK A;  3CB6 A;  2BWY A;  4U6W A;  4S2T P;  4ZWU A;  4QR8 A;  5CDV A;  2ADU A;  3FMR A;  2GU7 A;  1R5H A;  1QXZ A;  5CNX A;  1Y1N A;  3D27 A;  2BWV A;  4S2R P;  4B28 A;  2EVC A;  1XGO A;  4RZZ A;  1WY2 A;  3FM3 A;  1JAW A;  3MR1 A;  4RGZ 1;  2B3K A;  2HOW A;  2GU6 A;  2P99 A;  3MX6 A;  3IU9 A;  4IKS A;  1B59 A;  4EGE A;  2V3Y A;  4A6V A;  2BHC A;  4ZWO A;  4FO7 A;  2GU4 A;  3PKA A;  1YJ3 A;  2IW2 A;  2EA4 A;  2OAZ A;  5FCF A;  3ROR A;  4IKU A;  4IKR A;  2BN7 A;  2Q92 A;  4S00 A;  4FUK A;  1WN1 A;  1C21 A;  4U69 A;  1WL6 A;  2NQ6 A;  1WBQ A;  4ZWP A;  4FKC A;  2BH3 A;  2V3X A;  4HXX A;  4S01 A;  1QXY A;  4OOK A;  1A16 A;  2GG8 A;  3TAV A;  4U6Z A;  4KM3 A;  4IU6 A;  4PV4 A;  1WLR A;  1BN5 A;  5CLS A;  3RVA A;  3BIP A;  2Q93 A;  2ZSG A;  4U6J A;  4U73 A;  1BOA A;  1QZY A;  2GGB A;  3BIT A;  1R5G A;  1PV9 A;  5CDL A;  5E5B A;  4IEC A;  2MAT A;  2V6C A;  4U1B A;  1CHM A;  2BWT A;  2DFI A;  2BB7 A;  2EVO A;  5D6E A;  3FMQ A;  1C22 A;  1YVM A;  1YW9 A;  2NQ7 A;  2GG0 A;  2Q96 A;  3PKC A;  2G6P A;  2Q94 A;  5JFR A;  3MAT A;  5FCH A;  5CIK A;  3TB5 A;  4U71 A;  4IF7 A;  2BWU A;  2V3Z A;  2BWX A;  4U76 A;  4FLJ A;  4ZNG A;  1XGS A;  4FO8 A;  1C24 A;  1KQ9 A;  2GA2 A;  2GG2 A;  4U70 A;  1C27 A;  1QXW A;  1N51 A;  2EA2 A;  2GG7 A;  2P9A A;  1YW8 A;  4U75 A;  4IPA A;  2P98 A;  2BHD A;  3IU8 A;  5JHU A;  5D6F A;  1XNZ A;  1B6A A;  2GZ5 A;  2B3L A;  1XGM A;  2GG5 A;  4A6W A;  3PKE A;  1W2M A;  3PKB A;  1O0X A;  3L7G A;  5CDE A; 
#chains in the Genus database with same CATH topology
 2GGC A;  1WL9 A;  1R58 A;  1YW7 A;  2GTX A;  4Z7M A;  2GG3 A;  3PKD A;  1KQ0 A;  2BWW A;  3CTZ A;  3IG4 A;  2OKN A;  1WKM A;  2B3H A;  2BWS A;  1KP0 A;  3Q6D A;  3S6B A;  3L24 A;  2GU5 A;  3IU7 A;  4IDY A;  4U6C A;  2Q8K A;  2BHA A;  4R60 A;  2Q95 A;  3CB5 A;  5JI6 A;  4IKT A;  1MAT A;  4PNC A;  5CE6 A;  1XGN A;  1M35 A;  2BHB A;  2EVM A;  4MAT A;  4U6E A;  1W7V A;  4FLL A;  3BIQ A;  1C23 A;  4JUQ A;  2GG9 A;  4FLI A;  4RZY A;  4FLK A;  3CB6 A;  2BWY A;  4U6W A;  4S2T P;  4ZWU A;  4QR8 A;  5CDV A;  2ADU A;  3FMR A;  2GU7 A;  1R5H A;  1QXZ A;  5CNX A;  1Y1N A;  3D27 A;  2BWV A;  4S2R P;  4B28 A;  2EVC A;  1XGO A;  4RZZ A;  1WY2 A;  3FM3 A;  1JAW A;  3MR1 A;  4RGZ 1;  2B3K A;  2HOW A;  2GU6 A;  2P99 A;  3MX6 A;  3IU9 A;  4IKS A;  1B59 A;  4EGE A;  2V3Y A;  4A6V A;  2BHC A;  4ZWO A;  4FO7 A;  2GU4 A;  3PKA A;  1YJ3 A;  2IW2 A;  2EA4 A;  2OAZ A;  5FCF A;  3ROR A;  4IKU A;  4IKR A;  2BN7 A;  2Q92 A;  4S00 A;  4FUK A;  1WN1 A;  1C21 A;  4U69 A;  1WL6 A;  2NQ6 A;  1WBQ A;  4ZWP A;  4FKC A;  2BH3 A;  2V3X A;  4HXX A;  4S01 A;  1QXY A;  4OOK A;  1A16 A;  2GG8 A;  3TAV A;  4U6Z A;  4KM3 A;  4IU6 A;  4PV4 A;  1WLR A;  1BN5 A;  5CLS A;  3RVA A;  3BIP A;  2Q93 A;  2ZSG A;  4U6J A;  4U73 A;  1BOA A;  1QZY A;  2GGB A;  3BIT A;  1R5G A;  1PV9 A;  5CDL A;  5E5B A;  4IEC A;  2MAT A;  2V6C A;  4U1B A;  1CHM A;  2BWT A;  2DFI A;  2BB7 A;  2EVO A;  5D6E A;  3FMQ A;  1C22 A;  1YVM A;  1YW9 A;  2NQ7 A;  2GG0 A;  2Q96 A;  3PKC A;  2G6P A;  2Q94 A;  5JFR A;  3MAT A;  5FCH A;  5CIK A;  3TB5 A;  4U71 A;  4IF7 A;  2BWU A;  2V3Z A;  2BWX A;  4U76 A;  4FLJ A;  4ZNG A;  1XGS A;  4FO8 A;  1C24 A;  1KQ9 A;  2GA2 A;  2GG2 A;  4U70 A;  1C27 A;  1QXW A;  1N51 A;  2EA2 A;  2GG7 A;  2P9A A;  1YW8 A;  4U75 A;  4IPA A;  2P98 A;  2BHD A;  3IU8 A;  5JHU A;  5D6F A;  1XNZ A;  1B6A A;  2GZ5 A;  2B3L A;  1XGM A;  2GG5 A;  4A6W A;  3PKE A;  1W2M A;  3PKB A;  1O0X A;  3L7G A;  5CDE A; 
#chains in the Genus database with same CATH homology
 2GGC A;  1WL9 A;  1R58 A;  1YW7 A;  2GTX A;  4Z7M A;  2GG3 A;  3PKD A;  1KQ0 A;  2BWW A;  3CTZ A;  3IG4 A;  2OKN A;  1WKM A;  2B3H A;  2BWS A;  1KP0 A;  3Q6D A;  3S6B A;  3L24 A;  2GU5 A;  3IU7 A;  4IDY A;  4U6C A;  2Q8K A;  2BHA A;  4R60 A;  2Q95 A;  3CB5 A;  5JI6 A;  4IKT A;  1MAT A;  4PNC A;  5CE6 A;  1XGN A;  1M35 A;  2BHB A;  2EVM A;  4MAT A;  4U6E A;  1W7V A;  4FLL A;  3BIQ A;  1C23 A;  4JUQ A;  2GG9 A;  4FLI A;  4RZY A;  4FLK A;  3CB6 A;  2BWY A;  4U6W A;  4S2T P;  4ZWU A;  4QR8 A;  5CDV A;  2ADU A;  3FMR A;  2GU7 A;  1R5H A;  1QXZ A;  5CNX A;  1Y1N A;  3D27 A;  2BWV A;  4S2R P;  4B28 A;  2EVC A;  1XGO A;  4RZZ A;  1WY2 A;  3FM3 A;  1JAW A;  3MR1 A;  4RGZ 1;  2B3K A;  2HOW A;  2GU6 A;  2P99 A;  3MX6 A;  3IU9 A;  4IKS A;  1B59 A;  4EGE A;  2V3Y A;  4A6V A;  2BHC A;  4ZWO A;  4FO7 A;  2GU4 A;  3PKA A;  1YJ3 A;  2IW2 A;  2EA4 A;  2OAZ A;  5FCF A;  3ROR A;  4IKU A;  4IKR A;  2BN7 A;  2Q92 A;  4S00 A;  4FUK A;  1WN1 A;  1C21 A;  4U69 A;  1WL6 A;  2NQ6 A;  1WBQ A;  4ZWP A;  4FKC A;  2BH3 A;  2V3X A;  4HXX A;  4S01 A;  1QXY A;  4OOK A;  1A16 A;  2GG8 A;  3TAV A;  4U6Z A;  4KM3 A;  4IU6 A;  4PV4 A;  1WLR A;  1BN5 A;  5CLS A;  3RVA A;  3BIP A;  2Q93 A;  2ZSG A;  4U6J A;  4U73 A;  1BOA A;  1QZY A;  2GGB A;  3BIT A;  1R5G A;  1PV9 A;  5CDL A;  5E5B A;  4IEC A;  2MAT A;  2V6C A;  4U1B A;  1CHM A;  2BWT A;  2DFI A;  2BB7 A;  2EVO A;  5D6E A;  3FMQ A;  1C22 A;  1YVM A;  1YW9 A;  2NQ7 A;  2GG0 A;  2Q96 A;  3PKC A;  2G6P A;  2Q94 A;  5JFR A;  3MAT A;  5FCH A;  5CIK A;  3TB5 A;  4U71 A;  4IF7 A;  2BWU A;  2V3Z A;  2BWX A;  4U76 A;  4FLJ A;  4ZNG A;  1XGS A;  4FO8 A;  1C24 A;  1KQ9 A;  2GA2 A;  2GG2 A;  4U70 A;  1C27 A;  1QXW A;  1N51 A;  2EA2 A;  2GG7 A;  2P9A A;  1YW8 A;  4U75 A;  4IPA A;  2P98 A;  2BHD A;  3IU8 A;  5JHU A;  5D6F A;  1XNZ A;  1B6A A;  2GZ5 A;  2B3L A;  1XGM A;  2GG5 A;  4A6W A;  3PKE A;  1W2M A;  3PKB A;  1O0X A;  3L7G A;  5CDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...