4FLIA

Human metap1 with bengamide analog y16, in mn form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fliA00
1XGSA 2GU6A 1R5GA 4FLLA 1C23A 4MATA 3S6BA 4IU6A 1C21A 4ZWPA 1QXWA 1WY2A 3L24A 2GA2A 2GZ5A 2GG7A 1XGNA 2NQ6A 2GU5A 1KQ0A 2GU4A 2HOWA 4A6WA 1W2MA 2BHDA 3TB5A 2B3LA 3PKDA 2BWXA 2V3ZA 2Q96A 4U70A 4RGZ1 4FUKA 1CHMA 4IKRA 2BWTA 4PV4A 4IECA 1A16A 2B3KA 1WBQA 1KQ9A 2EVCA 5JHUA 2OKNA 1XGOA 3BIQA 4RZYA 2Q94A 5CDEA 4A6VA 5FCHA 2P9AA 3Q6DA 1WL6A 3MR1A 1B6AA 1QXZA 3IU9A 4B28A 1O0XA 2BWYA 1B59A 1JAWA 3CTZA 3CB6A 1QXYA 4IKSA 3TAVA 5CNXA 2BWVA 2BHCA 2OAZA 2GGBA 1WN1A 1C27A 2EVOA 4KM3A 1C24A 1YJ3A 2GG2A 2BHAA 4S2RP 4U76A 4ZWUA 1R58A 1BN5A 1XNZA 4IPAA 4U73A 1R5HA 4IKTA 5FCFA 2ADUA 4EGEA 4IKUA 2EVMA 2GG5A 3BITA 2GTXA 1C22A 2B3HA 1MATA 1W7VA 3IU7A 4U6JA 4FKCA 3RVAA 4RZZA 2GU7A 3IU8A 1N51A 2BH3A 1M35A 3MX6A 3PKBA 4ZNGA 4IF7A 4U6WA 2NQ7A 3BIPA 1XGMA 4U6ZA 4ZWOA 5D6FA 4Z7MA 5JFRA 2IW2A 5CDLA 4R60A 1YW8A 5JI6A 4S01A 2DFIA 1YVMA 2GG8A 3PKCA 4FLKA 5CDVA 5D6EA 2BN7A 3FM3A 2EA4A 1KP0A 4FLJA 2V3YA 2Q8KA 2MATA 4PNCA 1QZYA 3FMRA 3L7GA 3PKAA 4U71A 3D27A 3PKEA 2P99A 4U69A 2BWWA 5CLSA 1YW7A 2GG3A 2Q92A 3FMQA 4FO7A 3CB5A 2BWSA 4S00A 2BWUA 2ZSGA 2P98A 1Y1NA 5CE6A 5E5BA 4U1BA 2V3XA 4U75A 4S2TP 4OOKA 4U6CA 4FO8A 4QR8A 2BB7A 4FLIA 2V6CA 1YW9A 4HXXA 2Q95A 1WL9A 1WLRA 2GG9A 3IG4A 2Q93A 3MATA 5CIKA 1WKMA 2GG0A 1PV9A 2G6PA 3RORA 4U6EA 4IDYA 2GGCA 4JUQA 2EA2A 1BOAA 2BHBA
chains in the Genus database with same CATH superfamily
1XGSA 2GU6A 1R5GA 4FLLA 1C23A 4MATA 3S6BA 4IU6A 1C21A 4ZWPA 1QXWA 1WY2A 3L24A 2GA2A 2GZ5A 2GG7A 1XGNA 2NQ6A 2GU5A 1KQ0A 2GU4A 2HOWA 4A6WA 1W2MA 2BHDA 3TB5A 2B3LA 3PKDA 2BWXA 2V3ZA 2Q96A 4U70A 4RGZ1 4FUKA 1CHMA 4IKRA 2BWTA 4PV4A 4IECA 1A16A 2B3KA 1WBQA 1KQ9A 2EVCA 5JHUA 2OKNA 1XGOA 3BIQA 4RZYA 2Q94A 5CDEA 4A6VA 5FCHA 2P9AA 3Q6DA 1WL6A 3MR1A 1B6AA 1QXZA 3IU9A 4B28A 1O0XA 2BWYA 1B59A 1JAWA 3CTZA 3CB6A 1QXYA 4IKSA 3TAVA 5CNXA 2BWVA 2BHCA 2OAZA 2GGBA 1WN1A 1C27A 2EVOA 4KM3A 1C24A 1YJ3A 2GG2A 2BHAA 4S2RP 4U76A 4ZWUA 1R58A 1BN5A 1XNZA 4IPAA 4U73A 1R5HA 4IKTA 5FCFA 2ADUA 4EGEA 4IKUA 2EVMA 2GG5A 3BITA 2GTXA 1C22A 2B3HA 1MATA 1W7VA 3IU7A 4U6JA 4FKCA 3RVAA 4RZZA 2GU7A 3IU8A 1N51A 2BH3A 1M35A 3MX6A 3PKBA 4ZNGA 4IF7A 4U6WA 2NQ7A 3BIPA 1XGMA 4U6ZA 4ZWOA 5D6FA 4Z7MA 5JFRA 2IW2A 5CDLA 4R60A 1YW8A 5JI6A 4S01A 2DFIA 1YVMA 2GG8A 3PKCA 4FLKA 5CDVA 5D6EA 2BN7A 3FM3A 2EA4A 1KP0A 4FLJA 2V3YA 2Q8KA 2MATA 4PNCA 1QZYA 3FMRA 3L7GA 3PKAA 4U71A 3D27A 3PKEA 2P99A 4U69A 2BWWA 5CLSA 1YW7A 2GG3A 2Q92A 3FMQA 4FO7A 3CB5A 2BWSA 4S00A 2BWUA 2ZSGA 2P98A 1Y1NA 5CE6A 5E5BA 4U1BA 2V3XA 4U75A 4S2TP 4OOKA 4U6CA 4FO8A 4QR8A 2BB7A 4FLIA 2V6CA 1YW9A 4HXXA 2Q95A 1WL9A 1WLRA 2GG9A 3IG4A 2Q93A 3MATA 5CIKA 1WKMA 2GG0A 1PV9A 2G6PA 3RORA 4U6EA 4IDYA 2GGCA 4JUQA 2EA2A 1BOAA 2BHBA
chains in the Genus database with same CATH topology
1XGSA 2GU6A 1R5GA 4FLLA 1C23A 4MATA 3S6BA 4IU6A 1C21A 4ZWPA 1QXWA 1WY2A 3L24A 2GA2A 2GZ5A 2GG7A 1XGNA 2NQ6A 2GU5A 1KQ0A 2GU4A 2HOWA 4A6WA 1W2MA 2BHDA 3TB5A 2B3LA 3PKDA 2BWXA 2V3ZA 2Q96A 4U70A 4RGZ1 4FUKA 1CHMA 4IKRA 2BWTA 4PV4A 4IECA 1A16A 2B3KA 1WBQA 1KQ9A 2EVCA 5JHUA 2OKNA 1XGOA 3BIQA 4RZYA 2Q94A 5CDEA 4A6VA 5FCHA 2P9AA 3Q6DA 1WL6A 3MR1A 1B6AA 1QXZA 3IU9A 4B28A 1O0XA 2BWYA 1B59A 1JAWA 3CTZA 3CB6A 1QXYA 4IKSA 3TAVA 5CNXA 2BWVA 2BHCA 2OAZA 2GGBA 1WN1A 1C27A 2EVOA 4KM3A 1C24A 1YJ3A 2GG2A 2BHAA 4S2RP 4U76A 4ZWUA 1R58A 1BN5A 1XNZA 4IPAA 4U73A 1R5HA 4IKTA 5FCFA 2ADUA 4EGEA 4IKUA 2EVMA 2GG5A 3BITA 2GTXA 1C22A 2B3HA 1MATA 1W7VA 3IU7A 4U6JA 4FKCA 3RVAA 4RZZA 2GU7A 3IU8A 1N51A 2BH3A 1M35A 3MX6A 3PKBA 4ZNGA 4IF7A 4U6WA 2NQ7A 3BIPA 1XGMA 4U6ZA 4ZWOA 5D6FA 4Z7MA 5JFRA 2IW2A 5CDLA 4R60A 1YW8A 5JI6A 4S01A 2DFIA 1YVMA 2GG8A 3PKCA 4FLKA 5CDVA 5D6EA 2BN7A 3FM3A 2EA4A 1KP0A 4FLJA 2V3YA 2Q8KA 2MATA 4PNCA 1QZYA 3FMRA 3L7GA 3PKAA 4U71A 3D27A 3PKEA 2P99A 4U69A 2BWWA 5CLSA 1YW7A 2GG3A 2Q92A 3FMQA 4FO7A 3CB5A 2BWSA 4S00A 2BWUA 2ZSGA 2P98A 1Y1NA 5CE6A 5E5BA 4U1BA 2V3XA 4U75A 4S2TP 4OOKA 4U6CA 4FO8A 4QR8A 2BB7A 4FLIA 2V6CA 1YW9A 4HXXA 2Q95A 1WL9A 1WLRA 2GG9A 3IG4A 2Q93A 3MATA 5CIKA 1WKMA 2GG0A 1PV9A 2G6PA 3RORA 4U6EA 4IDYA 2GGCA 4JUQA 2EA2A 1BOAA 2BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGS A;  2GU6 A;  1R5G A;  4FLL A;  1C23 A;  4MAT A;  3S6B A;  4IU6 A;  1C21 A;  4ZWP A;  1QXW A;  1WY2 A;  3L24 A;  2GA2 A;  2GZ5 A;  2GG7 A;  1XGN A;  2NQ6 A;  2GU5 A;  1KQ0 A;  2GU4 A;  2HOW A;  4A6W A;  1W2M A;  2BHD A;  3TB5 A;  2B3L A;  3PKD A;  2BWX A;  2V3Z A;  2Q96 A;  4U70 A;  4RGZ 1;  4FUK A;  1CHM A;  4IKR A;  2BWT A;  4PV4 A;  4IEC A;  1A16 A;  2B3K A;  1WBQ A;  1KQ9 A;  2EVC A;  5JHU A;  2OKN A;  1XGO A;  3BIQ A;  4RZY A;  2Q94 A;  5CDE A;  4A6V A;  5FCH A;  2P9A A;  3Q6D A;  1WL6 A;  3MR1 A;  1B6A A;  1QXZ A;  3IU9 A;  4B28 A;  1O0X A;  2BWY A;  1B59 A;  1JAW A;  3CTZ A;  3CB6 A;  1QXY A;  4IKS A;  3TAV A;  5CNX A;  2BWV A;  2BHC A;  2OAZ A;  2GGB A;  1WN1 A;  1C27 A;  2EVO A;  4KM3 A;  1C24 A;  1YJ3 A;  2GG2 A;  2BHA A;  4S2R P;  4U76 A;  4ZWU A;  1R58 A;  1BN5 A;  1XNZ A;  4IPA A;  4U73 A;  1R5H A;  4IKT A;  5FCF A;  2ADU A;  4EGE A;  4IKU A;  2EVM A;  2GG5 A;  3BIT A;  2GTX A;  1C22 A;  2B3H A;  1MAT A;  1W7V A;  3IU7 A;  4U6J A;  4FKC A;  3RVA A;  4RZZ A;  2GU7 A;  3IU8 A;  1N51 A;  2BH3 A;  1M35 A;  3MX6 A;  3PKB A;  4ZNG A;  4IF7 A;  4U6W A;  2NQ7 A;  3BIP A;  1XGM A;  4U6Z A;  4ZWO A;  5D6F A;  4Z7M A;  5JFR A;  2IW2 A;  5CDL A;  4R60 A;  1YW8 A;  5JI6 A;  4S01 A;  2DFI A;  1YVM A;  2GG8 A;  3PKC A;  4FLK A;  5CDV A;  5D6E A;  2BN7 A;  3FM3 A;  2EA4 A;  1KP0 A;  4FLJ A;  2V3Y A;  2Q8K A;  2MAT A;  4PNC A;  1QZY A;  3FMR A;  3L7G A;  3PKA A;  4U71 A;  3D27 A;  3PKE A;  2P99 A;  4U69 A;  2BWW A;  5CLS A;  1YW7 A;  2GG3 A;  2Q92 A;  3FMQ A;  4FO7 A;  3CB5 A;  2BWS A;  4S00 A;  2BWU A;  2ZSG A;  2P98 A;  1Y1N A;  5CE6 A;  5E5B A;  4U1B A;  2V3X A;  4U75 A;  4S2T P;  4OOK A;  4U6C A;  4FO8 A;  4QR8 A;  2BB7 A;  4FLI A;  2V6C A;  1YW9 A;  4HXX A;  2Q95 A;  1WL9 A;  1WLR A;  2GG9 A;  3IG4 A;  2Q93 A;  3MAT A;  5CIK A;  1WKM A;  2GG0 A;  1PV9 A;  2G6P A;  3ROR A;  4U6E A;  4IDY A;  2GGC A;  4JUQ A;  2EA2 A;  1BOA A;  2BHB A; 
#chains in the Genus database with same CATH topology
 1XGS A;  2GU6 A;  1R5G A;  4FLL A;  1C23 A;  4MAT A;  3S6B A;  4IU6 A;  1C21 A;  4ZWP A;  1QXW A;  1WY2 A;  3L24 A;  2GA2 A;  2GZ5 A;  2GG7 A;  1XGN A;  2NQ6 A;  2GU5 A;  1KQ0 A;  2GU4 A;  2HOW A;  4A6W A;  1W2M A;  2BHD A;  3TB5 A;  2B3L A;  3PKD A;  2BWX A;  2V3Z A;  2Q96 A;  4U70 A;  4RGZ 1;  4FUK A;  1CHM A;  4IKR A;  2BWT A;  4PV4 A;  4IEC A;  1A16 A;  2B3K A;  1WBQ A;  1KQ9 A;  2EVC A;  5JHU A;  2OKN A;  1XGO A;  3BIQ A;  4RZY A;  2Q94 A;  5CDE A;  4A6V A;  5FCH A;  2P9A A;  3Q6D A;  1WL6 A;  3MR1 A;  1B6A A;  1QXZ A;  3IU9 A;  4B28 A;  1O0X A;  2BWY A;  1B59 A;  1JAW A;  3CTZ A;  3CB6 A;  1QXY A;  4IKS A;  3TAV A;  5CNX A;  2BWV A;  2BHC A;  2OAZ A;  2GGB A;  1WN1 A;  1C27 A;  2EVO A;  4KM3 A;  1C24 A;  1YJ3 A;  2GG2 A;  2BHA A;  4S2R P;  4U76 A;  4ZWU A;  1R58 A;  1BN5 A;  1XNZ A;  4IPA A;  4U73 A;  1R5H A;  4IKT A;  5FCF A;  2ADU A;  4EGE A;  4IKU A;  2EVM A;  2GG5 A;  3BIT A;  2GTX A;  1C22 A;  2B3H A;  1MAT A;  1W7V A;  3IU7 A;  4U6J A;  4FKC A;  3RVA A;  4RZZ A;  2GU7 A;  3IU8 A;  1N51 A;  2BH3 A;  1M35 A;  3MX6 A;  3PKB A;  4ZNG A;  4IF7 A;  4U6W A;  2NQ7 A;  3BIP A;  1XGM A;  4U6Z A;  4ZWO A;  5D6F A;  4Z7M A;  5JFR A;  2IW2 A;  5CDL A;  4R60 A;  1YW8 A;  5JI6 A;  4S01 A;  2DFI A;  1YVM A;  2GG8 A;  3PKC A;  4FLK A;  5CDV A;  5D6E A;  2BN7 A;  3FM3 A;  2EA4 A;  1KP0 A;  4FLJ A;  2V3Y A;  2Q8K A;  2MAT A;  4PNC A;  1QZY A;  3FMR A;  3L7G A;  3PKA A;  4U71 A;  3D27 A;  3PKE A;  2P99 A;  4U69 A;  2BWW A;  5CLS A;  1YW7 A;  2GG3 A;  2Q92 A;  3FMQ A;  4FO7 A;  3CB5 A;  2BWS A;  4S00 A;  2BWU A;  2ZSG A;  2P98 A;  1Y1N A;  5CE6 A;  5E5B A;  4U1B A;  2V3X A;  4U75 A;  4S2T P;  4OOK A;  4U6C A;  4FO8 A;  4QR8 A;  2BB7 A;  4FLI A;  2V6C A;  1YW9 A;  4HXX A;  2Q95 A;  1WL9 A;  1WLR A;  2GG9 A;  3IG4 A;  2Q93 A;  3MAT A;  5CIK A;  1WKM A;  2GG0 A;  1PV9 A;  2G6P A;  3ROR A;  4U6E A;  4IDY A;  2GGC A;  4JUQ A;  2EA2 A;  1BOA A;  2BHB A; 
#chains in the Genus database with same CATH homology
 1XGS A;  2GU6 A;  1R5G A;  4FLL A;  1C23 A;  4MAT A;  3S6B A;  4IU6 A;  1C21 A;  4ZWP A;  1QXW A;  1WY2 A;  3L24 A;  2GA2 A;  2GZ5 A;  2GG7 A;  1XGN A;  2NQ6 A;  2GU5 A;  1KQ0 A;  2GU4 A;  2HOW A;  4A6W A;  1W2M A;  2BHD A;  3TB5 A;  2B3L A;  3PKD A;  2BWX A;  2V3Z A;  2Q96 A;  4U70 A;  4RGZ 1;  4FUK A;  1CHM A;  4IKR A;  2BWT A;  4PV4 A;  4IEC A;  1A16 A;  2B3K A;  1WBQ A;  1KQ9 A;  2EVC A;  5JHU A;  2OKN A;  1XGO A;  3BIQ A;  4RZY A;  2Q94 A;  5CDE A;  4A6V A;  5FCH A;  2P9A A;  3Q6D A;  1WL6 A;  3MR1 A;  1B6A A;  1QXZ A;  3IU9 A;  4B28 A;  1O0X A;  2BWY A;  1B59 A;  1JAW A;  3CTZ A;  3CB6 A;  1QXY A;  4IKS A;  3TAV A;  5CNX A;  2BWV A;  2BHC A;  2OAZ A;  2GGB A;  1WN1 A;  1C27 A;  2EVO A;  4KM3 A;  1C24 A;  1YJ3 A;  2GG2 A;  2BHA A;  4S2R P;  4U76 A;  4ZWU A;  1R58 A;  1BN5 A;  1XNZ A;  4IPA A;  4U73 A;  1R5H A;  4IKT A;  5FCF A;  2ADU A;  4EGE A;  4IKU A;  2EVM A;  2GG5 A;  3BIT A;  2GTX A;  1C22 A;  2B3H A;  1MAT A;  1W7V A;  3IU7 A;  4U6J A;  4FKC A;  3RVA A;  4RZZ A;  2GU7 A;  3IU8 A;  1N51 A;  2BH3 A;  1M35 A;  3MX6 A;  3PKB A;  4ZNG A;  4IF7 A;  4U6W A;  2NQ7 A;  3BIP A;  1XGM A;  4U6Z A;  4ZWO A;  5D6F A;  4Z7M A;  5JFR A;  2IW2 A;  5CDL A;  4R60 A;  1YW8 A;  5JI6 A;  4S01 A;  2DFI A;  1YVM A;  2GG8 A;  3PKC A;  4FLK A;  5CDV A;  5D6E A;  2BN7 A;  3FM3 A;  2EA4 A;  1KP0 A;  4FLJ A;  2V3Y A;  2Q8K A;  2MAT A;  4PNC A;  1QZY A;  3FMR A;  3L7G A;  3PKA A;  4U71 A;  3D27 A;  3PKE A;  2P99 A;  4U69 A;  2BWW A;  5CLS A;  1YW7 A;  2GG3 A;  2Q92 A;  3FMQ A;  4FO7 A;  3CB5 A;  2BWS A;  4S00 A;  2BWU A;  2ZSG A;  2P98 A;  1Y1N A;  5CE6 A;  5E5B A;  4U1B A;  2V3X A;  4U75 A;  4S2T P;  4OOK A;  4U6C A;  4FO8 A;  4QR8 A;  2BB7 A;  4FLI A;  2V6C A;  1YW9 A;  4HXX A;  2Q95 A;  1WL9 A;  1WLR A;  2GG9 A;  3IG4 A;  2Q93 A;  3MAT A;  5CIK A;  1WKM A;  2GG0 A;  1PV9 A;  2G6P A;  3ROR A;  4U6E A;  4IDY A;  2GGC A;  4JUQ A;  2EA2 A;  1BOA A;  2BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...