4A6VA

X-ray structures of oxazole hydroxamate ecmetap-mn complexes
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
pubmed doi rcsb
total genus 86
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4a6vA00
3BIQA 3FM3A 3TAVA 4U70A 2Q93A 2EVMA 4IKTA 4S01A 5CDEA 1YJ3A 4PV4A 2BWUA 1XGMA 4U1BA 1N51A 4FO7A 4U75A 4U69A 1YW8A 4Z7MA 2GG8A 2Q94A 4FLKA 4JUQA 1YW9A 1C22A 3PKDA 4IKUA 2GG2A 1BOAA 4B28A 1KQ0A 1M35A 1WKMA 2GGBA 3D27A 2BB7A 4IPAA 4IKRA 3MR1A 3PKCA 3TB5A 1C21A 2BWTA 2P98A 5CE6A 3PKAA 2BHDA 4ZWPA 4HXXA 3CB5A 2GA2A 3IU8A 1KQ9A 5D6EA 2BWYA 5FCHA 3RVAA 1QXYA 2Q92A 4U73A 4FO8A 4U76A 2NQ7A 3PKEA 1XNZA 2BHCA 4RGZ1 5CDLA 1XGOA 2V6CA 3IU7A 2B3KA 1QXZA 4S2TP 1WL6A 2BN7A 1WLRA 4S2RP 2V3ZA 4R60A 3S6BA 2BWSA 3IU9A 2G6PA 1XGNA 4U6ZA 2Q96A 3FMRA 1WBQA 2GU6A 3L7GA 4IU6A 1C23A 4IDYA 4IKSA 1A16A 5JI6A 4FLIA 2MATA 2GG5A 2EVOA 4QR8A 4FUKA 4ZWUA 4RZZA 5CNXA 4A6VA 4FKCA 4U71A 1QXWA 2EVCA 2GGCA 5CDVA 2OKNA 2GG0A 1XGSA 1C24A 2HOWA 2ZSGA 5JHUA 2BHAA 1QZYA 1KP0A 3CB6A 4U6CA 4IECA 1PV9A 4U6WA 5D6FA 1WY2A 2GTXA 2NQ6A 4RZYA 2GG7A 1B59A 2GZ5A 2GU5A 2BH3A 2BWXA 4FLLA 1JAWA 3L24A 4KM3A 1CHMA 2P9AA 5JFRA 1WL9A 3RORA 4A6WA 4IF7A 1Y1NA 2BWWA 5CLSA 5FCFA 4U6EA 1W2MA 2EA4A 4ZNGA 1YVMA 4PNCA 2V3YA 3MX6A 1R5GA 3PKBA 2GG9A 1YW7A 1R58A 2GU7A 2DFIA 1W7VA 2B3HA 2Q8KA 2V3XA 4MATA 5CIKA 1O0XA 3FMQA 4U6JA 2OAZA 1R5HA 3IG4A 1MATA 2P99A 2EA2A 2B3LA 3Q6DA 4S00A 2BHBA 2IW2A 2Q95A 4FLJA 4OOKA 4EGEA 1C27A 3CTZA 1BN5A 2ADUA 3MATA 4ZWOA 3BIPA 5E5BA 1WN1A 2GG3A 2BWVA 3BITA 2GU4A 1B6AA
chains in the Genus database with same CATH superfamily
3BIQA 3FM3A 3TAVA 4U70A 2Q93A 2EVMA 4IKTA 4S01A 5CDEA 1YJ3A 4PV4A 2BWUA 1XGMA 4U1BA 1N51A 4FO7A 4U75A 4U69A 1YW8A 4Z7MA 2GG8A 2Q94A 4FLKA 4JUQA 1YW9A 1C22A 3PKDA 4IKUA 2GG2A 1BOAA 4B28A 1KQ0A 1M35A 1WKMA 2GGBA 3D27A 2BB7A 4IPAA 4IKRA 3MR1A 3PKCA 3TB5A 1C21A 2BWTA 2P98A 5CE6A 3PKAA 2BHDA 4ZWPA 4HXXA 3CB5A 2GA2A 3IU8A 1KQ9A 5D6EA 2BWYA 5FCHA 3RVAA 1QXYA 2Q92A 4U73A 4FO8A 4U76A 2NQ7A 3PKEA 1XNZA 2BHCA 4RGZ1 5CDLA 1XGOA 2V6CA 3IU7A 2B3KA 1QXZA 4S2TP 1WL6A 2BN7A 1WLRA 4S2RP 2V3ZA 4R60A 3S6BA 2BWSA 3IU9A 2G6PA 1XGNA 4U6ZA 2Q96A 3FMRA 1WBQA 2GU6A 3L7GA 4IU6A 1C23A 4IDYA 4IKSA 1A16A 5JI6A 4FLIA 2MATA 2GG5A 2EVOA 4QR8A 4FUKA 4ZWUA 4RZZA 5CNXA 4A6VA 4FKCA 4U71A 1QXWA 2EVCA 2GGCA 5CDVA 2OKNA 2GG0A 1XGSA 1C24A 2HOWA 2ZSGA 5JHUA 2BHAA 1QZYA 1KP0A 3CB6A 4U6CA 4IECA 1PV9A 4U6WA 5D6FA 1WY2A 2GTXA 2NQ6A 4RZYA 2GG7A 1B59A 2GZ5A 2GU5A 2BH3A 2BWXA 4FLLA 1JAWA 3L24A 4KM3A 1CHMA 2P9AA 5JFRA 1WL9A 3RORA 4A6WA 4IF7A 1Y1NA 2BWWA 5CLSA 5FCFA 4U6EA 1W2MA 2EA4A 4ZNGA 1YVMA 4PNCA 2V3YA 3MX6A 1R5GA 3PKBA 2GG9A 1YW7A 1R58A 2GU7A 2DFIA 1W7VA 2B3HA 2Q8KA 2V3XA 4MATA 5CIKA 1O0XA 3FMQA 4U6JA 2OAZA 1R5HA 3IG4A 1MATA 2P99A 2EA2A 2B3LA 3Q6DA 4S00A 2BHBA 2IW2A 2Q95A 4FLJA 4OOKA 4EGEA 1C27A 3CTZA 1BN5A 2ADUA 3MATA 4ZWOA 3BIPA 5E5BA 1WN1A 2GG3A 2BWVA 3BITA 2GU4A 1B6AA
chains in the Genus database with same CATH topology
3BIQA 3FM3A 3TAVA 4U70A 2Q93A 2EVMA 4IKTA 4S01A 5CDEA 1YJ3A 4PV4A 2BWUA 1XGMA 4U1BA 1N51A 4FO7A 4U75A 4U69A 1YW8A 4Z7MA 2GG8A 2Q94A 4FLKA 4JUQA 1YW9A 1C22A 3PKDA 4IKUA 2GG2A 1BOAA 4B28A 1KQ0A 1M35A 1WKMA 2GGBA 3D27A 2BB7A 4IPAA 4IKRA 3MR1A 3PKCA 3TB5A 1C21A 2BWTA 2P98A 5CE6A 3PKAA 2BHDA 4ZWPA 4HXXA 3CB5A 2GA2A 3IU8A 1KQ9A 5D6EA 2BWYA 5FCHA 3RVAA 1QXYA 2Q92A 4U73A 4FO8A 4U76A 2NQ7A 3PKEA 1XNZA 2BHCA 4RGZ1 5CDLA 1XGOA 2V6CA 3IU7A 2B3KA 1QXZA 4S2TP 1WL6A 2BN7A 1WLRA 4S2RP 2V3ZA 4R60A 3S6BA 2BWSA 3IU9A 2G6PA 1XGNA 4U6ZA 2Q96A 3FMRA 1WBQA 2GU6A 3L7GA 4IU6A 1C23A 4IDYA 4IKSA 1A16A 5JI6A 4FLIA 2MATA 2GG5A 2EVOA 4QR8A 4FUKA 4ZWUA 4RZZA 5CNXA 4A6VA 4FKCA 4U71A 1QXWA 2EVCA 2GGCA 5CDVA 2OKNA 2GG0A 1XGSA 1C24A 2HOWA 2ZSGA 5JHUA 2BHAA 1QZYA 1KP0A 3CB6A 4U6CA 4IECA 1PV9A 4U6WA 5D6FA 1WY2A 2GTXA 2NQ6A 4RZYA 2GG7A 1B59A 2GZ5A 2GU5A 2BH3A 2BWXA 4FLLA 1JAWA 3L24A 4KM3A 1CHMA 2P9AA 5JFRA 1WL9A 3RORA 4A6WA 4IF7A 1Y1NA 2BWWA 5CLSA 5FCFA 4U6EA 1W2MA 2EA4A 4ZNGA 1YVMA 4PNCA 2V3YA 3MX6A 1R5GA 3PKBA 2GG9A 1YW7A 1R58A 2GU7A 2DFIA 1W7VA 2B3HA 2Q8KA 2V3XA 4MATA 5CIKA 1O0XA 3FMQA 4U6JA 2OAZA 1R5HA 3IG4A 1MATA 2P99A 2EA2A 2B3LA 3Q6DA 4S00A 2BHBA 2IW2A 2Q95A 4FLJA 4OOKA 4EGEA 1C27A 3CTZA 1BN5A 2ADUA 3MATA 4ZWOA 3BIPA 5E5BA 1WN1A 2GG3A 2BWVA 3BITA 2GU4A 1B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIQ A;  3FM3 A;  3TAV A;  4U70 A;  2Q93 A;  2EVM A;  4IKT A;  4S01 A;  5CDE A;  1YJ3 A;  4PV4 A;  2BWU A;  1XGM A;  4U1B A;  1N51 A;  4FO7 A;  4U75 A;  4U69 A;  1YW8 A;  4Z7M A;  2GG8 A;  2Q94 A;  4FLK A;  4JUQ A;  1YW9 A;  1C22 A;  3PKD A;  4IKU A;  2GG2 A;  1BOA A;  4B28 A;  1KQ0 A;  1M35 A;  1WKM A;  2GGB A;  3D27 A;  2BB7 A;  4IPA A;  4IKR A;  3MR1 A;  3PKC A;  3TB5 A;  1C21 A;  2BWT A;  2P98 A;  5CE6 A;  3PKA A;  2BHD A;  4ZWP A;  4HXX A;  3CB5 A;  2GA2 A;  3IU8 A;  1KQ9 A;  5D6E A;  2BWY A;  5FCH A;  3RVA A;  1QXY A;  2Q92 A;  4U73 A;  4FO8 A;  4U76 A;  2NQ7 A;  3PKE A;  1XNZ A;  2BHC A;  4RGZ 1;  5CDL A;  1XGO A;  2V6C A;  3IU7 A;  2B3K A;  1QXZ A;  4S2T P;  1WL6 A;  2BN7 A;  1WLR A;  4S2R P;  2V3Z A;  4R60 A;  3S6B A;  2BWS A;  3IU9 A;  2G6P A;  1XGN A;  4U6Z A;  2Q96 A;  3FMR A;  1WBQ A;  2GU6 A;  3L7G A;  4IU6 A;  1C23 A;  4IDY A;  4IKS A;  1A16 A;  5JI6 A;  4FLI A;  2MAT A;  2GG5 A;  2EVO A;  4QR8 A;  4FUK A;  4ZWU A;  4RZZ A;  5CNX A;  4A6V A;  4FKC A;  4U71 A;  1QXW A;  2EVC A;  2GGC A;  5CDV A;  2OKN A;  2GG0 A;  1XGS A;  1C24 A;  2HOW A;  2ZSG A;  5JHU A;  2BHA A;  1QZY A;  1KP0 A;  3CB6 A;  4U6C A;  4IEC A;  1PV9 A;  4U6W A;  5D6F A;  1WY2 A;  2GTX A;  2NQ6 A;  4RZY A;  2GG7 A;  1B59 A;  2GZ5 A;  2GU5 A;  2BH3 A;  2BWX A;  4FLL A;  1JAW A;  3L24 A;  4KM3 A;  1CHM A;  2P9A A;  5JFR A;  1WL9 A;  3ROR A;  4A6W A;  4IF7 A;  1Y1N A;  2BWW A;  5CLS A;  5FCF A;  4U6E A;  1W2M A;  2EA4 A;  4ZNG A;  1YVM A;  4PNC A;  2V3Y A;  3MX6 A;  1R5G A;  3PKB A;  2GG9 A;  1YW7 A;  1R58 A;  2GU7 A;  2DFI A;  1W7V A;  2B3H A;  2Q8K A;  2V3X A;  4MAT A;  5CIK A;  1O0X A;  3FMQ A;  4U6J A;  2OAZ A;  1R5H A;  3IG4 A;  1MAT A;  2P99 A;  2EA2 A;  2B3L A;  3Q6D A;  4S00 A;  2BHB A;  2IW2 A;  2Q95 A;  4FLJ A;  4OOK A;  4EGE A;  1C27 A;  3CTZ A;  1BN5 A;  2ADU A;  3MAT A;  4ZWO A;  3BIP A;  5E5B A;  1WN1 A;  2GG3 A;  2BWV A;  3BIT A;  2GU4 A;  1B6A A; 
#chains in the Genus database with same CATH topology
 3BIQ A;  3FM3 A;  3TAV A;  4U70 A;  2Q93 A;  2EVM A;  4IKT A;  4S01 A;  5CDE A;  1YJ3 A;  4PV4 A;  2BWU A;  1XGM A;  4U1B A;  1N51 A;  4FO7 A;  4U75 A;  4U69 A;  1YW8 A;  4Z7M A;  2GG8 A;  2Q94 A;  4FLK A;  4JUQ A;  1YW9 A;  1C22 A;  3PKD A;  4IKU A;  2GG2 A;  1BOA A;  4B28 A;  1KQ0 A;  1M35 A;  1WKM A;  2GGB A;  3D27 A;  2BB7 A;  4IPA A;  4IKR A;  3MR1 A;  3PKC A;  3TB5 A;  1C21 A;  2BWT A;  2P98 A;  5CE6 A;  3PKA A;  2BHD A;  4ZWP A;  4HXX A;  3CB5 A;  2GA2 A;  3IU8 A;  1KQ9 A;  5D6E A;  2BWY A;  5FCH A;  3RVA A;  1QXY A;  2Q92 A;  4U73 A;  4FO8 A;  4U76 A;  2NQ7 A;  3PKE A;  1XNZ A;  2BHC A;  4RGZ 1;  5CDL A;  1XGO A;  2V6C A;  3IU7 A;  2B3K A;  1QXZ A;  4S2T P;  1WL6 A;  2BN7 A;  1WLR A;  4S2R P;  2V3Z A;  4R60 A;  3S6B A;  2BWS A;  3IU9 A;  2G6P A;  1XGN A;  4U6Z A;  2Q96 A;  3FMR A;  1WBQ A;  2GU6 A;  3L7G A;  4IU6 A;  1C23 A;  4IDY A;  4IKS A;  1A16 A;  5JI6 A;  4FLI A;  2MAT A;  2GG5 A;  2EVO A;  4QR8 A;  4FUK A;  4ZWU A;  4RZZ A;  5CNX A;  4A6V A;  4FKC A;  4U71 A;  1QXW A;  2EVC A;  2GGC A;  5CDV A;  2OKN A;  2GG0 A;  1XGS A;  1C24 A;  2HOW A;  2ZSG A;  5JHU A;  2BHA A;  1QZY A;  1KP0 A;  3CB6 A;  4U6C A;  4IEC A;  1PV9 A;  4U6W A;  5D6F A;  1WY2 A;  2GTX A;  2NQ6 A;  4RZY A;  2GG7 A;  1B59 A;  2GZ5 A;  2GU5 A;  2BH3 A;  2BWX A;  4FLL A;  1JAW A;  3L24 A;  4KM3 A;  1CHM A;  2P9A A;  5JFR A;  1WL9 A;  3ROR A;  4A6W A;  4IF7 A;  1Y1N A;  2BWW A;  5CLS A;  5FCF A;  4U6E A;  1W2M A;  2EA4 A;  4ZNG A;  1YVM A;  4PNC A;  2V3Y A;  3MX6 A;  1R5G A;  3PKB A;  2GG9 A;  1YW7 A;  1R58 A;  2GU7 A;  2DFI A;  1W7V A;  2B3H A;  2Q8K A;  2V3X A;  4MAT A;  5CIK A;  1O0X A;  3FMQ A;  4U6J A;  2OAZ A;  1R5H A;  3IG4 A;  1MAT A;  2P99 A;  2EA2 A;  2B3L A;  3Q6D A;  4S00 A;  2BHB A;  2IW2 A;  2Q95 A;  4FLJ A;  4OOK A;  4EGE A;  1C27 A;  3CTZ A;  1BN5 A;  2ADU A;  3MAT A;  4ZWO A;  3BIP A;  5E5B A;  1WN1 A;  2GG3 A;  2BWV A;  3BIT A;  2GU4 A;  1B6A A; 
#chains in the Genus database with same CATH homology
 3BIQ A;  3FM3 A;  3TAV A;  4U70 A;  2Q93 A;  2EVM A;  4IKT A;  4S01 A;  5CDE A;  1YJ3 A;  4PV4 A;  2BWU A;  1XGM A;  4U1B A;  1N51 A;  4FO7 A;  4U75 A;  4U69 A;  1YW8 A;  4Z7M A;  2GG8 A;  2Q94 A;  4FLK A;  4JUQ A;  1YW9 A;  1C22 A;  3PKD A;  4IKU A;  2GG2 A;  1BOA A;  4B28 A;  1KQ0 A;  1M35 A;  1WKM A;  2GGB A;  3D27 A;  2BB7 A;  4IPA A;  4IKR A;  3MR1 A;  3PKC A;  3TB5 A;  1C21 A;  2BWT A;  2P98 A;  5CE6 A;  3PKA A;  2BHD A;  4ZWP A;  4HXX A;  3CB5 A;  2GA2 A;  3IU8 A;  1KQ9 A;  5D6E A;  2BWY A;  5FCH A;  3RVA A;  1QXY A;  2Q92 A;  4U73 A;  4FO8 A;  4U76 A;  2NQ7 A;  3PKE A;  1XNZ A;  2BHC A;  4RGZ 1;  5CDL A;  1XGO A;  2V6C A;  3IU7 A;  2B3K A;  1QXZ A;  4S2T P;  1WL6 A;  2BN7 A;  1WLR A;  4S2R P;  2V3Z A;  4R60 A;  3S6B A;  2BWS A;  3IU9 A;  2G6P A;  1XGN A;  4U6Z A;  2Q96 A;  3FMR A;  1WBQ A;  2GU6 A;  3L7G A;  4IU6 A;  1C23 A;  4IDY A;  4IKS A;  1A16 A;  5JI6 A;  4FLI A;  2MAT A;  2GG5 A;  2EVO A;  4QR8 A;  4FUK A;  4ZWU A;  4RZZ A;  5CNX A;  4A6V A;  4FKC A;  4U71 A;  1QXW A;  2EVC A;  2GGC A;  5CDV A;  2OKN A;  2GG0 A;  1XGS A;  1C24 A;  2HOW A;  2ZSG A;  5JHU A;  2BHA A;  1QZY A;  1KP0 A;  3CB6 A;  4U6C A;  4IEC A;  1PV9 A;  4U6W A;  5D6F A;  1WY2 A;  2GTX A;  2NQ6 A;  4RZY A;  2GG7 A;  1B59 A;  2GZ5 A;  2GU5 A;  2BH3 A;  2BWX A;  4FLL A;  1JAW A;  3L24 A;  4KM3 A;  1CHM A;  2P9A A;  5JFR A;  1WL9 A;  3ROR A;  4A6W A;  4IF7 A;  1Y1N A;  2BWW A;  5CLS A;  5FCF A;  4U6E A;  1W2M A;  2EA4 A;  4ZNG A;  1YVM A;  4PNC A;  2V3Y A;  3MX6 A;  1R5G A;  3PKB A;  2GG9 A;  1YW7 A;  1R58 A;  2GU7 A;  2DFI A;  1W7V A;  2B3H A;  2Q8K A;  2V3X A;  4MAT A;  5CIK A;  1O0X A;  3FMQ A;  4U6J A;  2OAZ A;  1R5H A;  3IG4 A;  1MAT A;  2P99 A;  2EA2 A;  2B3L A;  3Q6D A;  4S00 A;  2BHB A;  2IW2 A;  2Q95 A;  4FLJ A;  4OOK A;  4EGE A;  1C27 A;  3CTZ A;  1BN5 A;  2ADU A;  3MAT A;  4ZWO A;  3BIP A;  5E5B A;  1WN1 A;  2GG3 A;  2BWV A;  3BIT A;  2GU4 A;  1B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...