4A6VA

X-ray structures of oxazole hydroxamate ecmetap-mn complexes
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 86
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4a6vA00
2GG7A 1C21A 2B3LA 3RVAA 2BWVA 4A6WA 4FLKA 2GG3A 1PV9A 2GZ5A 2BWSA 3BIQA 4U1BA 4U69A 4ZWOA 2GG9A 3L7GA 3MATA 1Y1NA 2BHBA 3BITA 1R58A 3PKAA 1M35A 3PKDA 4IKUA 4U70A 2V3YA 1QXYA 2GU6A 3FM3A 3PKEA 3Q6DA 2GG0A 5FCHA 1JAWA 2BWTA 5CIKA 1YVMA 2EVOA 3FMQA 5CDEA 4U6EA 2GG5A 1WY2A 4U6ZA 1BOAA 5CDLA 4KM3A 2BN7A 1KQ9A 2Q8KA 1KQ0A 2DFIA 2ADUA 3IU7A 5JFRA 2BHCA 2GGCA 1XGOA 1A16A 4FUKA 2V3XA 2GU4A 2P99A 1WBQA 4IU6A 2EVMA 4IF7A 4RZYA 2HOWA 5FCFA 2ZSGA 4S01A 2OKNA 4IPAA 1QXWA 3FMRA 5JHUA 1WN1A 1WL9A 1N51A 2GA2A 4ZNGA 4RGZ1 3L24A 4U6WA 2GG2A 3CB6A 3TB5A 2Q95A 4QR8A 1XGNA 4Z7MA 1KP0A 3CTZA 2BH3A 3S6BA 4IDYA 2BHAA 4FLJA 4IKSA 3IG4A 2BWWA 1QXZA 2NQ7A 1WLRA 4B28A 1B6AA 2B3KA 1BN5A 4A6VA 3IU8A 4U71A 2Q94A 2EVCA 2BHDA 3MR1A 1XGSA 2IW2A 1O0XA 2BB7A 3IU9A 4FO7A 4R60A 4FO8A 4U75A 4U76A 4EGEA 5JI6A 1W7VA 1WKMA 4OOKA 1R5GA 2Q93A 4U73A 1C27A 5E5BA 2EA4A 2GU5A 2V6CA 1YW8A 4HXXA 5CLSA 4ZWPA 3D27A 2MATA 2Q92A 5CNXA 4JUQA 4IKTA 4ZWUA 1CHMA 5D6EA 4U6JA 2NQ6A 4MATA 5D6FA 2BWXA 4FLLA 4FKCA 1MATA 4IECA 1YW9A 1W2MA 2B3HA 4S2TP 1XNZA 1R5HA 2EA2A 2P98A 1WL6A 4PV4A 4PNCA 1XGMA 1B59A 2GGBA 4U6CA 2G6PA 3MX6A 3PKCA 2V3ZA 2P9AA 1YW7A 2GG8A 2OAZA 3BIPA 2BWYA 3CB5A 4IKRA 3RORA 5CE6A 1C24A 4S2RP 4S00A 1C23A 1C22A 1QZYA 2BWUA 3PKBA 2GU7A 2Q96A 4RZZA 5CDVA 3TAVA 1YJ3A 4FLIA 2GTXA
chains in the Genus database with same CATH superfamily
2GG7A 1C21A 2B3LA 3RVAA 2BWVA 4A6WA 4FLKA 2GG3A 1PV9A 2GZ5A 2BWSA 3BIQA 4U1BA 4U69A 4ZWOA 2GG9A 3L7GA 3MATA 1Y1NA 2BHBA 3BITA 1R58A 3PKAA 1M35A 3PKDA 4IKUA 4U70A 2V3YA 1QXYA 2GU6A 3FM3A 3PKEA 3Q6DA 2GG0A 5FCHA 1JAWA 2BWTA 5CIKA 1YVMA 2EVOA 3FMQA 5CDEA 4U6EA 2GG5A 1WY2A 4U6ZA 1BOAA 5CDLA 4KM3A 2BN7A 1KQ9A 2Q8KA 1KQ0A 2DFIA 2ADUA 3IU7A 5JFRA 2BHCA 2GGCA 1XGOA 1A16A 4FUKA 2V3XA 2GU4A 2P99A 1WBQA 4IU6A 2EVMA 4IF7A 4RZYA 2HOWA 5FCFA 2ZSGA 4S01A 2OKNA 4IPAA 1QXWA 3FMRA 5JHUA 1WN1A 1WL9A 1N51A 2GA2A 4ZNGA 4RGZ1 3L24A 4U6WA 2GG2A 3CB6A 3TB5A 2Q95A 4QR8A 1XGNA 4Z7MA 1KP0A 3CTZA 2BH3A 3S6BA 4IDYA 2BHAA 4FLJA 4IKSA 3IG4A 2BWWA 1QXZA 2NQ7A 1WLRA 4B28A 1B6AA 2B3KA 1BN5A 4A6VA 3IU8A 4U71A 2Q94A 2EVCA 2BHDA 3MR1A 1XGSA 2IW2A 1O0XA 2BB7A 3IU9A 4FO7A 4R60A 4FO8A 4U75A 4U76A 4EGEA 5JI6A 1W7VA 1WKMA 4OOKA 1R5GA 2Q93A 4U73A 1C27A 5E5BA 2EA4A 2GU5A 2V6CA 1YW8A 4HXXA 5CLSA 4ZWPA 3D27A 2MATA 2Q92A 5CNXA 4JUQA 4IKTA 4ZWUA 1CHMA 5D6EA 4U6JA 2NQ6A 4MATA 5D6FA 2BWXA 4FLLA 4FKCA 1MATA 4IECA 1YW9A 1W2MA 2B3HA 4S2TP 1XNZA 1R5HA 2EA2A 2P98A 1WL6A 4PV4A 4PNCA 1XGMA 1B59A 2GGBA 4U6CA 2G6PA 3MX6A 3PKCA 2V3ZA 2P9AA 1YW7A 2GG8A 2OAZA 3BIPA 2BWYA 3CB5A 4IKRA 3RORA 5CE6A 1C24A 4S2RP 4S00A 1C23A 1C22A 1QZYA 2BWUA 3PKBA 2GU7A 2Q96A 4RZZA 5CDVA 3TAVA 1YJ3A 4FLIA 2GTXA
chains in the Genus database with same CATH topology
2GG7A 1C21A 2B3LA 3RVAA 2BWVA 4A6WA 4FLKA 2GG3A 1PV9A 2GZ5A 2BWSA 3BIQA 4U1BA 4U69A 4ZWOA 2GG9A 3L7GA 3MATA 1Y1NA 2BHBA 3BITA 1R58A 3PKAA 1M35A 3PKDA 4IKUA 4U70A 2V3YA 1QXYA 2GU6A 3FM3A 3PKEA 3Q6DA 2GG0A 5FCHA 1JAWA 2BWTA 5CIKA 1YVMA 2EVOA 3FMQA 5CDEA 4U6EA 2GG5A 1WY2A 4U6ZA 1BOAA 5CDLA 4KM3A 2BN7A 1KQ9A 2Q8KA 1KQ0A 2DFIA 2ADUA 3IU7A 5JFRA 2BHCA 2GGCA 1XGOA 1A16A 4FUKA 2V3XA 2GU4A 2P99A 1WBQA 4IU6A 2EVMA 4IF7A 4RZYA 2HOWA 5FCFA 2ZSGA 4S01A 2OKNA 4IPAA 1QXWA 3FMRA 5JHUA 1WN1A 1WL9A 1N51A 2GA2A 4ZNGA 4RGZ1 3L24A 4U6WA 2GG2A 3CB6A 3TB5A 2Q95A 4QR8A 1XGNA 4Z7MA 1KP0A 3CTZA 2BH3A 3S6BA 4IDYA 2BHAA 4FLJA 4IKSA 3IG4A 2BWWA 1QXZA 2NQ7A 1WLRA 4B28A 1B6AA 2B3KA 1BN5A 4A6VA 3IU8A 4U71A 2Q94A 2EVCA 2BHDA 3MR1A 1XGSA 2IW2A 1O0XA 2BB7A 3IU9A 4FO7A 4R60A 4FO8A 4U75A 4U76A 4EGEA 5JI6A 1W7VA 1WKMA 4OOKA 1R5GA 2Q93A 4U73A 1C27A 5E5BA 2EA4A 2GU5A 2V6CA 1YW8A 4HXXA 5CLSA 4ZWPA 3D27A 2MATA 2Q92A 5CNXA 4JUQA 4IKTA 4ZWUA 1CHMA 5D6EA 4U6JA 2NQ6A 4MATA 5D6FA 2BWXA 4FLLA 4FKCA 1MATA 4IECA 1YW9A 1W2MA 2B3HA 4S2TP 1XNZA 1R5HA 2EA2A 2P98A 1WL6A 4PV4A 4PNCA 1XGMA 1B59A 2GGBA 4U6CA 2G6PA 3MX6A 3PKCA 2V3ZA 2P9AA 1YW7A 2GG8A 2OAZA 3BIPA 2BWYA 3CB5A 4IKRA 3RORA 5CE6A 1C24A 4S2RP 4S00A 1C23A 1C22A 1QZYA 2BWUA 3PKBA 2GU7A 2Q96A 4RZZA 5CDVA 3TAVA 1YJ3A 4FLIA 2GTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG7 A;  1C21 A;  2B3L A;  3RVA A;  2BWV A;  4A6W A;  4FLK A;  2GG3 A;  1PV9 A;  2GZ5 A;  2BWS A;  3BIQ A;  4U1B A;  4U69 A;  4ZWO A;  2GG9 A;  3L7G A;  3MAT A;  1Y1N A;  2BHB A;  3BIT A;  1R58 A;  3PKA A;  1M35 A;  3PKD A;  4IKU A;  4U70 A;  2V3Y A;  1QXY A;  2GU6 A;  3FM3 A;  3PKE A;  3Q6D A;  2GG0 A;  5FCH A;  1JAW A;  2BWT A;  5CIK A;  1YVM A;  2EVO A;  3FMQ A;  5CDE A;  4U6E A;  2GG5 A;  1WY2 A;  4U6Z A;  1BOA A;  5CDL A;  4KM3 A;  2BN7 A;  1KQ9 A;  2Q8K A;  1KQ0 A;  2DFI A;  2ADU A;  3IU7 A;  5JFR A;  2BHC A;  2GGC A;  1XGO A;  1A16 A;  4FUK A;  2V3X A;  2GU4 A;  2P99 A;  1WBQ A;  4IU6 A;  2EVM A;  4IF7 A;  4RZY A;  2HOW A;  5FCF A;  2ZSG A;  4S01 A;  2OKN A;  4IPA A;  1QXW A;  3FMR A;  5JHU A;  1WN1 A;  1WL9 A;  1N51 A;  2GA2 A;  4ZNG A;  4RGZ 1;  3L24 A;  4U6W A;  2GG2 A;  3CB6 A;  3TB5 A;  2Q95 A;  4QR8 A;  1XGN A;  4Z7M A;  1KP0 A;  3CTZ A;  2BH3 A;  3S6B A;  4IDY A;  2BHA A;  4FLJ A;  4IKS A;  3IG4 A;  2BWW A;  1QXZ A;  2NQ7 A;  1WLR A;  4B28 A;  1B6A A;  2B3K A;  1BN5 A;  4A6V A;  3IU8 A;  4U71 A;  2Q94 A;  2EVC A;  2BHD A;  3MR1 A;  1XGS A;  2IW2 A;  1O0X A;  2BB7 A;  3IU9 A;  4FO7 A;  4R60 A;  4FO8 A;  4U75 A;  4U76 A;  4EGE A;  5JI6 A;  1W7V A;  1WKM A;  4OOK A;  1R5G A;  2Q93 A;  4U73 A;  1C27 A;  5E5B A;  2EA4 A;  2GU5 A;  2V6C A;  1YW8 A;  4HXX A;  5CLS A;  4ZWP A;  3D27 A;  2MAT A;  2Q92 A;  5CNX A;  4JUQ A;  4IKT A;  4ZWU A;  1CHM A;  5D6E A;  4U6J A;  2NQ6 A;  4MAT A;  5D6F A;  2BWX A;  4FLL A;  4FKC A;  1MAT A;  4IEC A;  1YW9 A;  1W2M A;  2B3H A;  4S2T P;  1XNZ A;  1R5H A;  2EA2 A;  2P98 A;  1WL6 A;  4PV4 A;  4PNC A;  1XGM A;  1B59 A;  2GGB A;  4U6C A;  2G6P A;  3MX6 A;  3PKC A;  2V3Z A;  2P9A A;  1YW7 A;  2GG8 A;  2OAZ A;  3BIP A;  2BWY A;  3CB5 A;  4IKR A;  3ROR A;  5CE6 A;  1C24 A;  4S2R P;  4S00 A;  1C23 A;  1C22 A;  1QZY A;  2BWU A;  3PKB A;  2GU7 A;  2Q96 A;  4RZZ A;  5CDV A;  3TAV A;  1YJ3 A;  4FLI A;  2GTX A; 
#chains in the Genus database with same CATH topology
 2GG7 A;  1C21 A;  2B3L A;  3RVA A;  2BWV A;  4A6W A;  4FLK A;  2GG3 A;  1PV9 A;  2GZ5 A;  2BWS A;  3BIQ A;  4U1B A;  4U69 A;  4ZWO A;  2GG9 A;  3L7G A;  3MAT A;  1Y1N A;  2BHB A;  3BIT A;  1R58 A;  3PKA A;  1M35 A;  3PKD A;  4IKU A;  4U70 A;  2V3Y A;  1QXY A;  2GU6 A;  3FM3 A;  3PKE A;  3Q6D A;  2GG0 A;  5FCH A;  1JAW A;  2BWT A;  5CIK A;  1YVM A;  2EVO A;  3FMQ A;  5CDE A;  4U6E A;  2GG5 A;  1WY2 A;  4U6Z A;  1BOA A;  5CDL A;  4KM3 A;  2BN7 A;  1KQ9 A;  2Q8K A;  1KQ0 A;  2DFI A;  2ADU A;  3IU7 A;  5JFR A;  2BHC A;  2GGC A;  1XGO A;  1A16 A;  4FUK A;  2V3X A;  2GU4 A;  2P99 A;  1WBQ A;  4IU6 A;  2EVM A;  4IF7 A;  4RZY A;  2HOW A;  5FCF A;  2ZSG A;  4S01 A;  2OKN A;  4IPA A;  1QXW A;  3FMR A;  5JHU A;  1WN1 A;  1WL9 A;  1N51 A;  2GA2 A;  4ZNG A;  4RGZ 1;  3L24 A;  4U6W A;  2GG2 A;  3CB6 A;  3TB5 A;  2Q95 A;  4QR8 A;  1XGN A;  4Z7M A;  1KP0 A;  3CTZ A;  2BH3 A;  3S6B A;  4IDY A;  2BHA A;  4FLJ A;  4IKS A;  3IG4 A;  2BWW A;  1QXZ A;  2NQ7 A;  1WLR A;  4B28 A;  1B6A A;  2B3K A;  1BN5 A;  4A6V A;  3IU8 A;  4U71 A;  2Q94 A;  2EVC A;  2BHD A;  3MR1 A;  1XGS A;  2IW2 A;  1O0X A;  2BB7 A;  3IU9 A;  4FO7 A;  4R60 A;  4FO8 A;  4U75 A;  4U76 A;  4EGE A;  5JI6 A;  1W7V A;  1WKM A;  4OOK A;  1R5G A;  2Q93 A;  4U73 A;  1C27 A;  5E5B A;  2EA4 A;  2GU5 A;  2V6C A;  1YW8 A;  4HXX A;  5CLS A;  4ZWP A;  3D27 A;  2MAT A;  2Q92 A;  5CNX A;  4JUQ A;  4IKT A;  4ZWU A;  1CHM A;  5D6E A;  4U6J A;  2NQ6 A;  4MAT A;  5D6F A;  2BWX A;  4FLL A;  4FKC A;  1MAT A;  4IEC A;  1YW9 A;  1W2M A;  2B3H A;  4S2T P;  1XNZ A;  1R5H A;  2EA2 A;  2P98 A;  1WL6 A;  4PV4 A;  4PNC A;  1XGM A;  1B59 A;  2GGB A;  4U6C A;  2G6P A;  3MX6 A;  3PKC A;  2V3Z A;  2P9A A;  1YW7 A;  2GG8 A;  2OAZ A;  3BIP A;  2BWY A;  3CB5 A;  4IKR A;  3ROR A;  5CE6 A;  1C24 A;  4S2R P;  4S00 A;  1C23 A;  1C22 A;  1QZY A;  2BWU A;  3PKB A;  2GU7 A;  2Q96 A;  4RZZ A;  5CDV A;  3TAV A;  1YJ3 A;  4FLI A;  2GTX A; 
#chains in the Genus database with same CATH homology
 2GG7 A;  1C21 A;  2B3L A;  3RVA A;  2BWV A;  4A6W A;  4FLK A;  2GG3 A;  1PV9 A;  2GZ5 A;  2BWS A;  3BIQ A;  4U1B A;  4U69 A;  4ZWO A;  2GG9 A;  3L7G A;  3MAT A;  1Y1N A;  2BHB A;  3BIT A;  1R58 A;  3PKA A;  1M35 A;  3PKD A;  4IKU A;  4U70 A;  2V3Y A;  1QXY A;  2GU6 A;  3FM3 A;  3PKE A;  3Q6D A;  2GG0 A;  5FCH A;  1JAW A;  2BWT A;  5CIK A;  1YVM A;  2EVO A;  3FMQ A;  5CDE A;  4U6E A;  2GG5 A;  1WY2 A;  4U6Z A;  1BOA A;  5CDL A;  4KM3 A;  2BN7 A;  1KQ9 A;  2Q8K A;  1KQ0 A;  2DFI A;  2ADU A;  3IU7 A;  5JFR A;  2BHC A;  2GGC A;  1XGO A;  1A16 A;  4FUK A;  2V3X A;  2GU4 A;  2P99 A;  1WBQ A;  4IU6 A;  2EVM A;  4IF7 A;  4RZY A;  2HOW A;  5FCF A;  2ZSG A;  4S01 A;  2OKN A;  4IPA A;  1QXW A;  3FMR A;  5JHU A;  1WN1 A;  1WL9 A;  1N51 A;  2GA2 A;  4ZNG A;  4RGZ 1;  3L24 A;  4U6W A;  2GG2 A;  3CB6 A;  3TB5 A;  2Q95 A;  4QR8 A;  1XGN A;  4Z7M A;  1KP0 A;  3CTZ A;  2BH3 A;  3S6B A;  4IDY A;  2BHA A;  4FLJ A;  4IKS A;  3IG4 A;  2BWW A;  1QXZ A;  2NQ7 A;  1WLR A;  4B28 A;  1B6A A;  2B3K A;  1BN5 A;  4A6V A;  3IU8 A;  4U71 A;  2Q94 A;  2EVC A;  2BHD A;  3MR1 A;  1XGS A;  2IW2 A;  1O0X A;  2BB7 A;  3IU9 A;  4FO7 A;  4R60 A;  4FO8 A;  4U75 A;  4U76 A;  4EGE A;  5JI6 A;  1W7V A;  1WKM A;  4OOK A;  1R5G A;  2Q93 A;  4U73 A;  1C27 A;  5E5B A;  2EA4 A;  2GU5 A;  2V6C A;  1YW8 A;  4HXX A;  5CLS A;  4ZWP A;  3D27 A;  2MAT A;  2Q92 A;  5CNX A;  4JUQ A;  4IKT A;  4ZWU A;  1CHM A;  5D6E A;  4U6J A;  2NQ6 A;  4MAT A;  5D6F A;  2BWX A;  4FLL A;  4FKC A;  1MAT A;  4IEC A;  1YW9 A;  1W2M A;  2B3H A;  4S2T P;  1XNZ A;  1R5H A;  2EA2 A;  2P98 A;  1WL6 A;  4PV4 A;  4PNC A;  1XGM A;  1B59 A;  2GGB A;  4U6C A;  2G6P A;  3MX6 A;  3PKC A;  2V3Z A;  2P9A A;  1YW7 A;  2GG8 A;  2OAZ A;  3BIP A;  2BWY A;  3CB5 A;  4IKR A;  3ROR A;  5CE6 A;  1C24 A;  4S2R P;  4S00 A;  1C23 A;  1C22 A;  1QZY A;  2BWU A;  3PKB A;  2GU7 A;  2Q96 A;  4RZZ A;  5CDV A;  3TAV A;  1YJ3 A;  4FLI A;  2GTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...