4A6VA

X-ray structures of oxazole hydroxamate ecmetap-mn complexes
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
pubmed doi rcsb
molecule tags Hydrolase
total genus 86
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4a6vA00
1XGOA 1R5GA 2BHAA 1QZYA 4U6ZA 2V6CA 4FKCA 5FCHA 2GG5A 4U70A 3CB5A 1BN5A 2EVMA 2GGCA 2NQ7A 2Q92A 1YVMA 2BWYA 1YJ3A 1O0XA 4ZWUA 2NQ6A 3MX6A 3D27A 1W2MA 3IG4A 1PV9A 1WBQA 2BB7A 1WLRA 3S6BA 2BWWA 2OKNA 2P9AA 2BHCA 4FLIA 4IU6A 3L24A 4PV4A 2EVCA 5E5BA 4IKSA 1XNZA 2EA2A 5CDLA 2GTXA 2GU5A 3TB5A 1WN1A 1KQ9A 2DFIA 2P99A 3MR1A 5CLSA 5CIKA 1B6AA 1WL9A 4FLLA 2EVOA 2GU4A 3CTZA 1KP0A 2ZSGA 4IECA 4U6EA 4U6WA 2GG2A 1WY2A 4A6VA 4QR8A 2OAZA 4U75A 2B3LA 3BITA 1YW8A 3PKEA 1C22A 3PKBA 3TAVA 4ZWOA 4KM3A 4FUKA 4IKRA 5D6FA 5CDEA 4ZWPA 1XGMA 2V3ZA 4S00A 4Z7MA 5JHUA 2EA4A 1C27A 5CE6A 3FMRA 2Q94A 4U6CA 1W7VA 2GG0A 4U6JA 2Q95A 4MATA 5D6EA 2IW2A 1A16A 2GGBA 1BOAA 2BN7A 4S2RP 4A6WA 2GG9A 1MATA 2B3HA 2BWSA 2BWVA 4HXXA 3IU9A 2ADUA 4R60A 2P98A 3PKCA 1R58A 4RGZ1 5JI6A 4IDYA 4FO8A 5JFRA 4U73A 2G6PA 2GZ5A 4FLJA 1XGSA 2V3XA 4S01A 2GU7A 5CDVA 4U76A 2Q96A 3L7GA 3PKAA 3RORA 4U1BA 1Y1NA 1WKMA 1C23A 2BWXA 2BH3A 4FLKA 2GU6A 1QXYA 2GG3A 1B59A 2BWUA 4IF7A 4RZZA 1QXWA 3PKDA 3BIQA 3MATA 2Q93A 3RVAA 2V3YA 3IU8A 4U69A 2MATA 3FMQA 4EGEA 1C21A 4RZYA 4FO7A 4IPAA 3CB6A 1JAWA 1C24A 2BHBA 1KQ0A 2GA2A 3Q6DA 3BIPA 1N51A 5FCFA 1QXZA 2B3KA 4PNCA 1YW7A 3FM3A 4IKUA 4B28A 1WL6A 2GG8A 2BWTA 4IKTA 4ZNGA 1XGNA 5CNXA 3IU7A 2GG7A 1YW9A 4U71A 2Q8KA 4JUQA 2HOWA 1M35A 2BHDA 1R5HA 1CHMA 4OOKA 4S2TP
chains in the Genus database with same CATH superfamily
1XGOA 1R5GA 2BHAA 1QZYA 4U6ZA 2V6CA 4FKCA 5FCHA 2GG5A 4U70A 3CB5A 1BN5A 2EVMA 2GGCA 2NQ7A 2Q92A 1YVMA 2BWYA 1YJ3A 1O0XA 4ZWUA 2NQ6A 3MX6A 3D27A 1W2MA 3IG4A 1PV9A 1WBQA 2BB7A 1WLRA 3S6BA 2BWWA 2OKNA 2P9AA 2BHCA 4FLIA 4IU6A 3L24A 4PV4A 2EVCA 5E5BA 4IKSA 1XNZA 2EA2A 5CDLA 2GTXA 2GU5A 3TB5A 1WN1A 1KQ9A 2DFIA 2P99A 3MR1A 5CLSA 5CIKA 1B6AA 1WL9A 4FLLA 2EVOA 2GU4A 3CTZA 1KP0A 2ZSGA 4IECA 4U6EA 4U6WA 2GG2A 1WY2A 4A6VA 4QR8A 2OAZA 4U75A 2B3LA 3BITA 1YW8A 3PKEA 1C22A 3PKBA 3TAVA 4ZWOA 4KM3A 4FUKA 4IKRA 5D6FA 5CDEA 4ZWPA 1XGMA 2V3ZA 4S00A 4Z7MA 5JHUA 2EA4A 1C27A 5CE6A 3FMRA 2Q94A 4U6CA 1W7VA 2GG0A 4U6JA 2Q95A 4MATA 5D6EA 2IW2A 1A16A 2GGBA 1BOAA 2BN7A 4S2RP 4A6WA 2GG9A 1MATA 2B3HA 2BWSA 2BWVA 4HXXA 3IU9A 2ADUA 4R60A 2P98A 3PKCA 1R58A 4RGZ1 5JI6A 4IDYA 4FO8A 5JFRA 4U73A 2G6PA 2GZ5A 4FLJA 1XGSA 2V3XA 4S01A 2GU7A 5CDVA 4U76A 2Q96A 3L7GA 3PKAA 3RORA 4U1BA 1Y1NA 1WKMA 1C23A 2BWXA 2BH3A 4FLKA 2GU6A 1QXYA 2GG3A 1B59A 2BWUA 4IF7A 4RZZA 1QXWA 3PKDA 3BIQA 3MATA 2Q93A 3RVAA 2V3YA 3IU8A 4U69A 2MATA 3FMQA 4EGEA 1C21A 4RZYA 4FO7A 4IPAA 3CB6A 1JAWA 1C24A 2BHBA 1KQ0A 2GA2A 3Q6DA 3BIPA 1N51A 5FCFA 1QXZA 2B3KA 4PNCA 1YW7A 3FM3A 4IKUA 4B28A 1WL6A 2GG8A 2BWTA 4IKTA 4ZNGA 1XGNA 5CNXA 3IU7A 2GG7A 1YW9A 4U71A 2Q8KA 4JUQA 2HOWA 1M35A 2BHDA 1R5HA 1CHMA 4OOKA 4S2TP
chains in the Genus database with same CATH topology
1XGOA 1R5GA 2BHAA 1QZYA 4U6ZA 2V6CA 4FKCA 5FCHA 2GG5A 4U70A 3CB5A 1BN5A 2EVMA 2GGCA 2NQ7A 2Q92A 1YVMA 2BWYA 1YJ3A 1O0XA 4ZWUA 2NQ6A 3MX6A 3D27A 1W2MA 3IG4A 1PV9A 1WBQA 2BB7A 1WLRA 3S6BA 2BWWA 2OKNA 2P9AA 2BHCA 4FLIA 4IU6A 3L24A 4PV4A 2EVCA 5E5BA 4IKSA 1XNZA 2EA2A 5CDLA 2GTXA 2GU5A 3TB5A 1WN1A 1KQ9A 2DFIA 2P99A 3MR1A 5CLSA 5CIKA 1B6AA 1WL9A 4FLLA 2EVOA 2GU4A 3CTZA 1KP0A 2ZSGA 4IECA 4U6EA 4U6WA 2GG2A 1WY2A 4A6VA 4QR8A 2OAZA 4U75A 2B3LA 3BITA 1YW8A 3PKEA 1C22A 3PKBA 3TAVA 4ZWOA 4KM3A 4FUKA 4IKRA 5D6FA 5CDEA 4ZWPA 1XGMA 2V3ZA 4S00A 4Z7MA 5JHUA 2EA4A 1C27A 5CE6A 3FMRA 2Q94A 4U6CA 1W7VA 2GG0A 4U6JA 2Q95A 4MATA 5D6EA 2IW2A 1A16A 2GGBA 1BOAA 2BN7A 4S2RP 4A6WA 2GG9A 1MATA 2B3HA 2BWSA 2BWVA 4HXXA 3IU9A 2ADUA 4R60A 2P98A 3PKCA 1R58A 4RGZ1 5JI6A 4IDYA 4FO8A 5JFRA 4U73A 2G6PA 2GZ5A 4FLJA 1XGSA 2V3XA 4S01A 2GU7A 5CDVA 4U76A 2Q96A 3L7GA 3PKAA 3RORA 4U1BA 1Y1NA 1WKMA 1C23A 2BWXA 2BH3A 4FLKA 2GU6A 1QXYA 2GG3A 1B59A 2BWUA 4IF7A 4RZZA 1QXWA 3PKDA 3BIQA 3MATA 2Q93A 3RVAA 2V3YA 3IU8A 4U69A 2MATA 3FMQA 4EGEA 1C21A 4RZYA 4FO7A 4IPAA 3CB6A 1JAWA 1C24A 2BHBA 1KQ0A 2GA2A 3Q6DA 3BIPA 1N51A 5FCFA 1QXZA 2B3KA 4PNCA 1YW7A 3FM3A 4IKUA 4B28A 1WL6A 2GG8A 2BWTA 4IKTA 4ZNGA 1XGNA 5CNXA 3IU7A 2GG7A 1YW9A 4U71A 2Q8KA 4JUQA 2HOWA 1M35A 2BHDA 1R5HA 1CHMA 4OOKA 4S2TP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGO A;  1R5G A;  2BHA A;  1QZY A;  4U6Z A;  2V6C A;  4FKC A;  5FCH A;  2GG5 A;  4U70 A;  3CB5 A;  1BN5 A;  2EVM A;  2GGC A;  2NQ7 A;  2Q92 A;  1YVM A;  2BWY A;  1YJ3 A;  1O0X A;  4ZWU A;  2NQ6 A;  3MX6 A;  3D27 A;  1W2M A;  3IG4 A;  1PV9 A;  1WBQ A;  2BB7 A;  1WLR A;  3S6B A;  2BWW A;  2OKN A;  2P9A A;  2BHC A;  4FLI A;  4IU6 A;  3L24 A;  4PV4 A;  2EVC A;  5E5B A;  4IKS A;  1XNZ A;  2EA2 A;  5CDL A;  2GTX A;  2GU5 A;  3TB5 A;  1WN1 A;  1KQ9 A;  2DFI A;  2P99 A;  3MR1 A;  5CLS A;  5CIK A;  1B6A A;  1WL9 A;  4FLL A;  2EVO A;  2GU4 A;  3CTZ A;  1KP0 A;  2ZSG A;  4IEC A;  4U6E A;  4U6W A;  2GG2 A;  1WY2 A;  4A6V A;  4QR8 A;  2OAZ A;  4U75 A;  2B3L A;  3BIT A;  1YW8 A;  3PKE A;  1C22 A;  3PKB A;  3TAV A;  4ZWO A;  4KM3 A;  4FUK A;  4IKR A;  5D6F A;  5CDE A;  4ZWP A;  1XGM A;  2V3Z A;  4S00 A;  4Z7M A;  5JHU A;  2EA4 A;  1C27 A;  5CE6 A;  3FMR A;  2Q94 A;  4U6C A;  1W7V A;  2GG0 A;  4U6J A;  2Q95 A;  4MAT A;  5D6E A;  2IW2 A;  1A16 A;  2GGB A;  1BOA A;  2BN7 A;  4S2R P;  4A6W A;  2GG9 A;  1MAT A;  2B3H A;  2BWS A;  2BWV A;  4HXX A;  3IU9 A;  2ADU A;  4R60 A;  2P98 A;  3PKC A;  1R58 A;  4RGZ 1;  5JI6 A;  4IDY A;  4FO8 A;  5JFR A;  4U73 A;  2G6P A;  2GZ5 A;  4FLJ A;  1XGS A;  2V3X A;  4S01 A;  2GU7 A;  5CDV A;  4U76 A;  2Q96 A;  3L7G A;  3PKA A;  3ROR A;  4U1B A;  1Y1N A;  1WKM A;  1C23 A;  2BWX A;  2BH3 A;  4FLK A;  2GU6 A;  1QXY A;  2GG3 A;  1B59 A;  2BWU A;  4IF7 A;  4RZZ A;  1QXW A;  3PKD A;  3BIQ A;  3MAT A;  2Q93 A;  3RVA A;  2V3Y A;  3IU8 A;  4U69 A;  2MAT A;  3FMQ A;  4EGE A;  1C21 A;  4RZY A;  4FO7 A;  4IPA A;  3CB6 A;  1JAW A;  1C24 A;  2BHB A;  1KQ0 A;  2GA2 A;  3Q6D A;  3BIP A;  1N51 A;  5FCF A;  1QXZ A;  2B3K A;  4PNC A;  1YW7 A;  3FM3 A;  4IKU A;  4B28 A;  1WL6 A;  2GG8 A;  2BWT A;  4IKT A;  4ZNG A;  1XGN A;  5CNX A;  3IU7 A;  2GG7 A;  1YW9 A;  4U71 A;  2Q8K A;  4JUQ A;  2HOW A;  1M35 A;  2BHD A;  1R5H A;  1CHM A;  4OOK A;  4S2T P; 
#chains in the Genus database with same CATH topology
 1XGO A;  1R5G A;  2BHA A;  1QZY A;  4U6Z A;  2V6C A;  4FKC A;  5FCH A;  2GG5 A;  4U70 A;  3CB5 A;  1BN5 A;  2EVM A;  2GGC A;  2NQ7 A;  2Q92 A;  1YVM A;  2BWY A;  1YJ3 A;  1O0X A;  4ZWU A;  2NQ6 A;  3MX6 A;  3D27 A;  1W2M A;  3IG4 A;  1PV9 A;  1WBQ A;  2BB7 A;  1WLR A;  3S6B A;  2BWW A;  2OKN A;  2P9A A;  2BHC A;  4FLI A;  4IU6 A;  3L24 A;  4PV4 A;  2EVC A;  5E5B A;  4IKS A;  1XNZ A;  2EA2 A;  5CDL A;  2GTX A;  2GU5 A;  3TB5 A;  1WN1 A;  1KQ9 A;  2DFI A;  2P99 A;  3MR1 A;  5CLS A;  5CIK A;  1B6A A;  1WL9 A;  4FLL A;  2EVO A;  2GU4 A;  3CTZ A;  1KP0 A;  2ZSG A;  4IEC A;  4U6E A;  4U6W A;  2GG2 A;  1WY2 A;  4A6V A;  4QR8 A;  2OAZ A;  4U75 A;  2B3L A;  3BIT A;  1YW8 A;  3PKE A;  1C22 A;  3PKB A;  3TAV A;  4ZWO A;  4KM3 A;  4FUK A;  4IKR A;  5D6F A;  5CDE A;  4ZWP A;  1XGM A;  2V3Z A;  4S00 A;  4Z7M A;  5JHU A;  2EA4 A;  1C27 A;  5CE6 A;  3FMR A;  2Q94 A;  4U6C A;  1W7V A;  2GG0 A;  4U6J A;  2Q95 A;  4MAT A;  5D6E A;  2IW2 A;  1A16 A;  2GGB A;  1BOA A;  2BN7 A;  4S2R P;  4A6W A;  2GG9 A;  1MAT A;  2B3H A;  2BWS A;  2BWV A;  4HXX A;  3IU9 A;  2ADU A;  4R60 A;  2P98 A;  3PKC A;  1R58 A;  4RGZ 1;  5JI6 A;  4IDY A;  4FO8 A;  5JFR A;  4U73 A;  2G6P A;  2GZ5 A;  4FLJ A;  1XGS A;  2V3X A;  4S01 A;  2GU7 A;  5CDV A;  4U76 A;  2Q96 A;  3L7G A;  3PKA A;  3ROR A;  4U1B A;  1Y1N A;  1WKM A;  1C23 A;  2BWX A;  2BH3 A;  4FLK A;  2GU6 A;  1QXY A;  2GG3 A;  1B59 A;  2BWU A;  4IF7 A;  4RZZ A;  1QXW A;  3PKD A;  3BIQ A;  3MAT A;  2Q93 A;  3RVA A;  2V3Y A;  3IU8 A;  4U69 A;  2MAT A;  3FMQ A;  4EGE A;  1C21 A;  4RZY A;  4FO7 A;  4IPA A;  3CB6 A;  1JAW A;  1C24 A;  2BHB A;  1KQ0 A;  2GA2 A;  3Q6D A;  3BIP A;  1N51 A;  5FCF A;  1QXZ A;  2B3K A;  4PNC A;  1YW7 A;  3FM3 A;  4IKU A;  4B28 A;  1WL6 A;  2GG8 A;  2BWT A;  4IKT A;  4ZNG A;  1XGN A;  5CNX A;  3IU7 A;  2GG7 A;  1YW9 A;  4U71 A;  2Q8K A;  4JUQ A;  2HOW A;  1M35 A;  2BHD A;  1R5H A;  1CHM A;  4OOK A;  4S2T P; 
#chains in the Genus database with same CATH homology
 1XGO A;  1R5G A;  2BHA A;  1QZY A;  4U6Z A;  2V6C A;  4FKC A;  5FCH A;  2GG5 A;  4U70 A;  3CB5 A;  1BN5 A;  2EVM A;  2GGC A;  2NQ7 A;  2Q92 A;  1YVM A;  2BWY A;  1YJ3 A;  1O0X A;  4ZWU A;  2NQ6 A;  3MX6 A;  3D27 A;  1W2M A;  3IG4 A;  1PV9 A;  1WBQ A;  2BB7 A;  1WLR A;  3S6B A;  2BWW A;  2OKN A;  2P9A A;  2BHC A;  4FLI A;  4IU6 A;  3L24 A;  4PV4 A;  2EVC A;  5E5B A;  4IKS A;  1XNZ A;  2EA2 A;  5CDL A;  2GTX A;  2GU5 A;  3TB5 A;  1WN1 A;  1KQ9 A;  2DFI A;  2P99 A;  3MR1 A;  5CLS A;  5CIK A;  1B6A A;  1WL9 A;  4FLL A;  2EVO A;  2GU4 A;  3CTZ A;  1KP0 A;  2ZSG A;  4IEC A;  4U6E A;  4U6W A;  2GG2 A;  1WY2 A;  4A6V A;  4QR8 A;  2OAZ A;  4U75 A;  2B3L A;  3BIT A;  1YW8 A;  3PKE A;  1C22 A;  3PKB A;  3TAV A;  4ZWO A;  4KM3 A;  4FUK A;  4IKR A;  5D6F A;  5CDE A;  4ZWP A;  1XGM A;  2V3Z A;  4S00 A;  4Z7M A;  5JHU A;  2EA4 A;  1C27 A;  5CE6 A;  3FMR A;  2Q94 A;  4U6C A;  1W7V A;  2GG0 A;  4U6J A;  2Q95 A;  4MAT A;  5D6E A;  2IW2 A;  1A16 A;  2GGB A;  1BOA A;  2BN7 A;  4S2R P;  4A6W A;  2GG9 A;  1MAT A;  2B3H A;  2BWS A;  2BWV A;  4HXX A;  3IU9 A;  2ADU A;  4R60 A;  2P98 A;  3PKC A;  1R58 A;  4RGZ 1;  5JI6 A;  4IDY A;  4FO8 A;  5JFR A;  4U73 A;  2G6P A;  2GZ5 A;  4FLJ A;  1XGS A;  2V3X A;  4S01 A;  2GU7 A;  5CDV A;  4U76 A;  2Q96 A;  3L7G A;  3PKA A;  3ROR A;  4U1B A;  1Y1N A;  1WKM A;  1C23 A;  2BWX A;  2BH3 A;  4FLK A;  2GU6 A;  1QXY A;  2GG3 A;  1B59 A;  2BWU A;  4IF7 A;  4RZZ A;  1QXW A;  3PKD A;  3BIQ A;  3MAT A;  2Q93 A;  3RVA A;  2V3Y A;  3IU8 A;  4U69 A;  2MAT A;  3FMQ A;  4EGE A;  1C21 A;  4RZY A;  4FO7 A;  4IPA A;  3CB6 A;  1JAW A;  1C24 A;  2BHB A;  1KQ0 A;  2GA2 A;  3Q6D A;  3BIP A;  1N51 A;  5FCF A;  1QXZ A;  2B3K A;  4PNC A;  1YW7 A;  3FM3 A;  4IKU A;  4B28 A;  1WL6 A;  2GG8 A;  2BWT A;  4IKT A;  4ZNG A;  1XGN A;  5CNX A;  3IU7 A;  2GG7 A;  1YW9 A;  4U71 A;  2Q8K A;  4JUQ A;  2HOW A;  1M35 A;  2BHD A;  1R5H A;  1CHM A;  4OOK A;  4S2T P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...