4A6VA

X-ray structures of oxazole hydroxamate ecmetap-mn complexes
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
pubmed doi rcsb
molecule tags Hydrolase
total genus 86
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4a6vA00
4FKCA 2GG5A 4U71A 1N51A 2BWUA 1XGNA 2EVMA 2BN7A 3FMQA 1R58A 2OKNA 4U6WA 2GG9A 5CNXA 2GA2A 2Q95A 2V3YA 4PNCA 5E5BA 2Q93A 1BOAA 4RZYA 1W7VA 2NQ7A 2MATA 4ZNGA 3MR1A 1XGOA 5JHUA 4IDYA 2P99A 4Z7MA 2EVOA 1C27A 4RZZA 1B59A 1BN5A 1YVMA 4IKSA 2GTXA 4OOKA 1PV9A 2ADUA 1WN1A 3BIPA 1WY2A 4S2TP 2GZ5A 3MX6A 1QXYA 2ZSGA 1KQ0A 1YW7A 1QXZA 3CB6A 4FLKA 4FO7A 3L24A 4IKUA 1R5GA 3IG4A 2V3ZA 1C21A 4U69A 1WKMA 2GG0A 4R60A 2GU5A 4IKTA 3FMRA 4A6WA 3RORA 4S01A 2NQ6A 4U76A 4FUKA 1O0XA 3PKBA 3L7GA 2P9AA 2BWXA 2IW2A 4U6CA 2V3XA 2P98A 3PKEA 5CLSA 4ZWOA 1C22A 4U70A 2GG7A 1W2MA 1CHMA 5CDVA 2Q8KA 5JFRA 4FO8A 4KM3A 2DFIA 4S2RP 4IU6A 2BHAA 2Q96A 1XGMA 3CB5A 3FM3A 3IU9A 4U1BA 5D6FA 4QR8A 3TAVA 5CDEA 3PKAA 1XGSA 4B28A 2HOWA 2GGBA 3CTZA 3IU8A 4FLJA 3BIQA 4HXXA 2GGCA 2BHDA 4U75A 2Q92A 2BWVA 5D6EA 4U73A 5CIKA 2BWWA 3TB5A 4FLIA 2BHCA 4EGEA 2GU6A 5FCFA 3S6BA 1MATA 1JAWA 4MATA 3BITA 1QZYA 2BWSA 2Q94A 4U6EA 1A16A 4ZWPA 2G6PA 1YW9A 5CDLA 4U6JA 4IF7A 4A6VA 2BWYA 3PKDA 3Q6DA 2EA4A 1WL9A 2GU4A 4IECA 2BWTA 1KQ9A 1R5HA 4ZWUA 5FCHA 4PV4A 1QXWA 1YJ3A 2OAZA 3D27A 3PKCA 2BH3A 4FLLA 2B3HA 2B3LA 3IU7A 2BB7A 2GG3A 4U6ZA 1B6AA 4IKRA 2BHBA 2B3KA 2GU7A 4RGZ1 2EVCA 1KP0A 2V6CA 1C24A 4IPAA 1Y1NA 1XNZA 3RVAA 2EA2A 5JI6A 1C23A 1WL6A 2GG8A 4JUQA 4S00A 1M35A 2GG2A 1WBQA 5CE6A 1YW8A 3MATA 1WLRA
chains in the Genus database with same CATH superfamily
4FKCA 2GG5A 4U71A 1N51A 2BWUA 1XGNA 2EVMA 2BN7A 3FMQA 1R58A 2OKNA 4U6WA 2GG9A 5CNXA 2GA2A 2Q95A 2V3YA 4PNCA 5E5BA 2Q93A 1BOAA 4RZYA 1W7VA 2NQ7A 2MATA 4ZNGA 3MR1A 1XGOA 5JHUA 4IDYA 2P99A 4Z7MA 2EVOA 1C27A 4RZZA 1B59A 1BN5A 1YVMA 4IKSA 2GTXA 4OOKA 1PV9A 2ADUA 1WN1A 3BIPA 1WY2A 4S2TP 2GZ5A 3MX6A 1QXYA 2ZSGA 1KQ0A 1YW7A 1QXZA 3CB6A 4FLKA 4FO7A 3L24A 4IKUA 1R5GA 3IG4A 2V3ZA 1C21A 4U69A 1WKMA 2GG0A 4R60A 2GU5A 4IKTA 3FMRA 4A6WA 3RORA 4S01A 2NQ6A 4U76A 4FUKA 1O0XA 3PKBA 3L7GA 2P9AA 2BWXA 2IW2A 4U6CA 2V3XA 2P98A 3PKEA 5CLSA 4ZWOA 1C22A 4U70A 2GG7A 1W2MA 1CHMA 5CDVA 2Q8KA 5JFRA 4FO8A 4KM3A 2DFIA 4S2RP 4IU6A 2BHAA 2Q96A 1XGMA 3CB5A 3FM3A 3IU9A 4U1BA 5D6FA 4QR8A 3TAVA 5CDEA 3PKAA 1XGSA 4B28A 2HOWA 2GGBA 3CTZA 3IU8A 4FLJA 3BIQA 4HXXA 2GGCA 2BHDA 4U75A 2Q92A 2BWVA 5D6EA 4U73A 5CIKA 2BWWA 3TB5A 4FLIA 2BHCA 4EGEA 2GU6A 5FCFA 3S6BA 1MATA 1JAWA 4MATA 3BITA 1QZYA 2BWSA 2Q94A 4U6EA 1A16A 4ZWPA 2G6PA 1YW9A 5CDLA 4U6JA 4IF7A 4A6VA 2BWYA 3PKDA 3Q6DA 2EA4A 1WL9A 2GU4A 4IECA 2BWTA 1KQ9A 1R5HA 4ZWUA 5FCHA 4PV4A 1QXWA 1YJ3A 2OAZA 3D27A 3PKCA 2BH3A 4FLLA 2B3HA 2B3LA 3IU7A 2BB7A 2GG3A 4U6ZA 1B6AA 4IKRA 2BHBA 2B3KA 2GU7A 4RGZ1 2EVCA 1KP0A 2V6CA 1C24A 4IPAA 1Y1NA 1XNZA 3RVAA 2EA2A 5JI6A 1C23A 1WL6A 2GG8A 4JUQA 4S00A 1M35A 2GG2A 1WBQA 5CE6A 1YW8A 3MATA 1WLRA
chains in the Genus database with same CATH topology
4FKCA 2GG5A 4U71A 1N51A 2BWUA 1XGNA 2EVMA 2BN7A 3FMQA 1R58A 2OKNA 4U6WA 2GG9A 5CNXA 2GA2A 2Q95A 2V3YA 4PNCA 5E5BA 2Q93A 1BOAA 4RZYA 1W7VA 2NQ7A 2MATA 4ZNGA 3MR1A 1XGOA 5JHUA 4IDYA 2P99A 4Z7MA 2EVOA 1C27A 4RZZA 1B59A 1BN5A 1YVMA 4IKSA 2GTXA 4OOKA 1PV9A 2ADUA 1WN1A 3BIPA 1WY2A 4S2TP 2GZ5A 3MX6A 1QXYA 2ZSGA 1KQ0A 1YW7A 1QXZA 3CB6A 4FLKA 4FO7A 3L24A 4IKUA 1R5GA 3IG4A 2V3ZA 1C21A 4U69A 1WKMA 2GG0A 4R60A 2GU5A 4IKTA 3FMRA 4A6WA 3RORA 4S01A 2NQ6A 4U76A 4FUKA 1O0XA 3PKBA 3L7GA 2P9AA 2BWXA 2IW2A 4U6CA 2V3XA 2P98A 3PKEA 5CLSA 4ZWOA 1C22A 4U70A 2GG7A 1W2MA 1CHMA 5CDVA 2Q8KA 5JFRA 4FO8A 4KM3A 2DFIA 4S2RP 4IU6A 2BHAA 2Q96A 1XGMA 3CB5A 3FM3A 3IU9A 4U1BA 5D6FA 4QR8A 3TAVA 5CDEA 3PKAA 1XGSA 4B28A 2HOWA 2GGBA 3CTZA 3IU8A 4FLJA 3BIQA 4HXXA 2GGCA 2BHDA 4U75A 2Q92A 2BWVA 5D6EA 4U73A 5CIKA 2BWWA 3TB5A 4FLIA 2BHCA 4EGEA 2GU6A 5FCFA 3S6BA 1MATA 1JAWA 4MATA 3BITA 1QZYA 2BWSA 2Q94A 4U6EA 1A16A 4ZWPA 2G6PA 1YW9A 5CDLA 4U6JA 4IF7A 4A6VA 2BWYA 3PKDA 3Q6DA 2EA4A 1WL9A 2GU4A 4IECA 2BWTA 1KQ9A 1R5HA 4ZWUA 5FCHA 4PV4A 1QXWA 1YJ3A 2OAZA 3D27A 3PKCA 2BH3A 4FLLA 2B3HA 2B3LA 3IU7A 2BB7A 2GG3A 4U6ZA 1B6AA 4IKRA 2BHBA 2B3KA 2GU7A 4RGZ1 2EVCA 1KP0A 2V6CA 1C24A 4IPAA 1Y1NA 1XNZA 3RVAA 2EA2A 5JI6A 1C23A 1WL6A 2GG8A 4JUQA 4S00A 1M35A 2GG2A 1WBQA 5CE6A 1YW8A 3MATA 1WLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FKC A;  2GG5 A;  4U71 A;  1N51 A;  2BWU A;  1XGN A;  2EVM A;  2BN7 A;  3FMQ A;  1R58 A;  2OKN A;  4U6W A;  2GG9 A;  5CNX A;  2GA2 A;  2Q95 A;  2V3Y A;  4PNC A;  5E5B A;  2Q93 A;  1BOA A;  4RZY A;  1W7V A;  2NQ7 A;  2MAT A;  4ZNG A;  3MR1 A;  1XGO A;  5JHU A;  4IDY A;  2P99 A;  4Z7M A;  2EVO A;  1C27 A;  4RZZ A;  1B59 A;  1BN5 A;  1YVM A;  4IKS A;  2GTX A;  4OOK A;  1PV9 A;  2ADU A;  1WN1 A;  3BIP A;  1WY2 A;  4S2T P;  2GZ5 A;  3MX6 A;  1QXY A;  2ZSG A;  1KQ0 A;  1YW7 A;  1QXZ A;  3CB6 A;  4FLK A;  4FO7 A;  3L24 A;  4IKU A;  1R5G A;  3IG4 A;  2V3Z A;  1C21 A;  4U69 A;  1WKM A;  2GG0 A;  4R60 A;  2GU5 A;  4IKT A;  3FMR A;  4A6W A;  3ROR A;  4S01 A;  2NQ6 A;  4U76 A;  4FUK A;  1O0X A;  3PKB A;  3L7G A;  2P9A A;  2BWX A;  2IW2 A;  4U6C A;  2V3X A;  2P98 A;  3PKE A;  5CLS A;  4ZWO A;  1C22 A;  4U70 A;  2GG7 A;  1W2M A;  1CHM A;  5CDV A;  2Q8K A;  5JFR A;  4FO8 A;  4KM3 A;  2DFI A;  4S2R P;  4IU6 A;  2BHA A;  2Q96 A;  1XGM A;  3CB5 A;  3FM3 A;  3IU9 A;  4U1B A;  5D6F A;  4QR8 A;  3TAV A;  5CDE A;  3PKA A;  1XGS A;  4B28 A;  2HOW A;  2GGB A;  3CTZ A;  3IU8 A;  4FLJ A;  3BIQ A;  4HXX A;  2GGC A;  2BHD A;  4U75 A;  2Q92 A;  2BWV A;  5D6E A;  4U73 A;  5CIK A;  2BWW A;  3TB5 A;  4FLI A;  2BHC A;  4EGE A;  2GU6 A;  5FCF A;  3S6B A;  1MAT A;  1JAW A;  4MAT A;  3BIT A;  1QZY A;  2BWS A;  2Q94 A;  4U6E A;  1A16 A;  4ZWP A;  2G6P A;  1YW9 A;  5CDL A;  4U6J A;  4IF7 A;  4A6V A;  2BWY A;  3PKD A;  3Q6D A;  2EA4 A;  1WL9 A;  2GU4 A;  4IEC A;  2BWT A;  1KQ9 A;  1R5H A;  4ZWU A;  5FCH A;  4PV4 A;  1QXW A;  1YJ3 A;  2OAZ A;  3D27 A;  3PKC A;  2BH3 A;  4FLL A;  2B3H A;  2B3L A;  3IU7 A;  2BB7 A;  2GG3 A;  4U6Z A;  1B6A A;  4IKR A;  2BHB A;  2B3K A;  2GU7 A;  4RGZ 1;  2EVC A;  1KP0 A;  2V6C A;  1C24 A;  4IPA A;  1Y1N A;  1XNZ A;  3RVA A;  2EA2 A;  5JI6 A;  1C23 A;  1WL6 A;  2GG8 A;  4JUQ A;  4S00 A;  1M35 A;  2GG2 A;  1WBQ A;  5CE6 A;  1YW8 A;  3MAT A;  1WLR A; 
#chains in the Genus database with same CATH topology
 4FKC A;  2GG5 A;  4U71 A;  1N51 A;  2BWU A;  1XGN A;  2EVM A;  2BN7 A;  3FMQ A;  1R58 A;  2OKN A;  4U6W A;  2GG9 A;  5CNX A;  2GA2 A;  2Q95 A;  2V3Y A;  4PNC A;  5E5B A;  2Q93 A;  1BOA A;  4RZY A;  1W7V A;  2NQ7 A;  2MAT A;  4ZNG A;  3MR1 A;  1XGO A;  5JHU A;  4IDY A;  2P99 A;  4Z7M A;  2EVO A;  1C27 A;  4RZZ A;  1B59 A;  1BN5 A;  1YVM A;  4IKS A;  2GTX A;  4OOK A;  1PV9 A;  2ADU A;  1WN1 A;  3BIP A;  1WY2 A;  4S2T P;  2GZ5 A;  3MX6 A;  1QXY A;  2ZSG A;  1KQ0 A;  1YW7 A;  1QXZ A;  3CB6 A;  4FLK A;  4FO7 A;  3L24 A;  4IKU A;  1R5G A;  3IG4 A;  2V3Z A;  1C21 A;  4U69 A;  1WKM A;  2GG0 A;  4R60 A;  2GU5 A;  4IKT A;  3FMR A;  4A6W A;  3ROR A;  4S01 A;  2NQ6 A;  4U76 A;  4FUK A;  1O0X A;  3PKB A;  3L7G A;  2P9A A;  2BWX A;  2IW2 A;  4U6C A;  2V3X A;  2P98 A;  3PKE A;  5CLS A;  4ZWO A;  1C22 A;  4U70 A;  2GG7 A;  1W2M A;  1CHM A;  5CDV A;  2Q8K A;  5JFR A;  4FO8 A;  4KM3 A;  2DFI A;  4S2R P;  4IU6 A;  2BHA A;  2Q96 A;  1XGM A;  3CB5 A;  3FM3 A;  3IU9 A;  4U1B A;  5D6F A;  4QR8 A;  3TAV A;  5CDE A;  3PKA A;  1XGS A;  4B28 A;  2HOW A;  2GGB A;  3CTZ A;  3IU8 A;  4FLJ A;  3BIQ A;  4HXX A;  2GGC A;  2BHD A;  4U75 A;  2Q92 A;  2BWV A;  5D6E A;  4U73 A;  5CIK A;  2BWW A;  3TB5 A;  4FLI A;  2BHC A;  4EGE A;  2GU6 A;  5FCF A;  3S6B A;  1MAT A;  1JAW A;  4MAT A;  3BIT A;  1QZY A;  2BWS A;  2Q94 A;  4U6E A;  1A16 A;  4ZWP A;  2G6P A;  1YW9 A;  5CDL A;  4U6J A;  4IF7 A;  4A6V A;  2BWY A;  3PKD A;  3Q6D A;  2EA4 A;  1WL9 A;  2GU4 A;  4IEC A;  2BWT A;  1KQ9 A;  1R5H A;  4ZWU A;  5FCH A;  4PV4 A;  1QXW A;  1YJ3 A;  2OAZ A;  3D27 A;  3PKC A;  2BH3 A;  4FLL A;  2B3H A;  2B3L A;  3IU7 A;  2BB7 A;  2GG3 A;  4U6Z A;  1B6A A;  4IKR A;  2BHB A;  2B3K A;  2GU7 A;  4RGZ 1;  2EVC A;  1KP0 A;  2V6C A;  1C24 A;  4IPA A;  1Y1N A;  1XNZ A;  3RVA A;  2EA2 A;  5JI6 A;  1C23 A;  1WL6 A;  2GG8 A;  4JUQ A;  4S00 A;  1M35 A;  2GG2 A;  1WBQ A;  5CE6 A;  1YW8 A;  3MAT A;  1WLR A; 
#chains in the Genus database with same CATH homology
 4FKC A;  2GG5 A;  4U71 A;  1N51 A;  2BWU A;  1XGN A;  2EVM A;  2BN7 A;  3FMQ A;  1R58 A;  2OKN A;  4U6W A;  2GG9 A;  5CNX A;  2GA2 A;  2Q95 A;  2V3Y A;  4PNC A;  5E5B A;  2Q93 A;  1BOA A;  4RZY A;  1W7V A;  2NQ7 A;  2MAT A;  4ZNG A;  3MR1 A;  1XGO A;  5JHU A;  4IDY A;  2P99 A;  4Z7M A;  2EVO A;  1C27 A;  4RZZ A;  1B59 A;  1BN5 A;  1YVM A;  4IKS A;  2GTX A;  4OOK A;  1PV9 A;  2ADU A;  1WN1 A;  3BIP A;  1WY2 A;  4S2T P;  2GZ5 A;  3MX6 A;  1QXY A;  2ZSG A;  1KQ0 A;  1YW7 A;  1QXZ A;  3CB6 A;  4FLK A;  4FO7 A;  3L24 A;  4IKU A;  1R5G A;  3IG4 A;  2V3Z A;  1C21 A;  4U69 A;  1WKM A;  2GG0 A;  4R60 A;  2GU5 A;  4IKT A;  3FMR A;  4A6W A;  3ROR A;  4S01 A;  2NQ6 A;  4U76 A;  4FUK A;  1O0X A;  3PKB A;  3L7G A;  2P9A A;  2BWX A;  2IW2 A;  4U6C A;  2V3X A;  2P98 A;  3PKE A;  5CLS A;  4ZWO A;  1C22 A;  4U70 A;  2GG7 A;  1W2M A;  1CHM A;  5CDV A;  2Q8K A;  5JFR A;  4FO8 A;  4KM3 A;  2DFI A;  4S2R P;  4IU6 A;  2BHA A;  2Q96 A;  1XGM A;  3CB5 A;  3FM3 A;  3IU9 A;  4U1B A;  5D6F A;  4QR8 A;  3TAV A;  5CDE A;  3PKA A;  1XGS A;  4B28 A;  2HOW A;  2GGB A;  3CTZ A;  3IU8 A;  4FLJ A;  3BIQ A;  4HXX A;  2GGC A;  2BHD A;  4U75 A;  2Q92 A;  2BWV A;  5D6E A;  4U73 A;  5CIK A;  2BWW A;  3TB5 A;  4FLI A;  2BHC A;  4EGE A;  2GU6 A;  5FCF A;  3S6B A;  1MAT A;  1JAW A;  4MAT A;  3BIT A;  1QZY A;  2BWS A;  2Q94 A;  4U6E A;  1A16 A;  4ZWP A;  2G6P A;  1YW9 A;  5CDL A;  4U6J A;  4IF7 A;  4A6V A;  2BWY A;  3PKD A;  3Q6D A;  2EA4 A;  1WL9 A;  2GU4 A;  4IEC A;  2BWT A;  1KQ9 A;  1R5H A;  4ZWU A;  5FCH A;  4PV4 A;  1QXW A;  1YJ3 A;  2OAZ A;  3D27 A;  3PKC A;  2BH3 A;  4FLL A;  2B3H A;  2B3L A;  3IU7 A;  2BB7 A;  2GG3 A;  4U6Z A;  1B6A A;  4IKR A;  2BHB A;  2B3K A;  2GU7 A;  4RGZ 1;  2EVC A;  1KP0 A;  2V6C A;  1C24 A;  4IPA A;  1Y1N A;  1XNZ A;  3RVA A;  2EA2 A;  5JI6 A;  1C23 A;  1WL6 A;  2GG8 A;  4JUQ A;  4S00 A;  1M35 A;  2GG2 A;  1WBQ A;  5CE6 A;  1YW8 A;  3MAT A;  1WLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...