2Q95A

E. coli methionine aminopeptidase mn-form with inhibitor a05
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q95A00
5CLSA 2Q8KA 2EA2A 2DFIA 5FCHA 4U6ZA 1M35A 1QXZA 2BB7A 1MATA 4U70A 5CE6A 1XNZA 4RZYA 2V3ZA 2BWUA 2BWXA 3PKCA 1O0XA 1QXYA 2V6CA 3RORA 4S2RP 3FM3A 1C23A 1B59A 2GU5A 2EA4A 2V3XA 3Q6DA 2GG5A 2Q92A 2BHBA 4S01A 1YW9A 1Y1NA 2GG7A 4U6CA 1YW7A 5CIKA 1C22A 1WBQA 4U6WA 1XGMA 2NQ7A 2OKNA 2V3YA 3BITA 2GU7A 4IPAA 2BH3A 5CNXA 2BHDA 4HXXA 4Z7MA 1KQ9A 4IKSA 3CB5A 5JFRA 4PNCA 4IU6A 1KQ0A 3S6BA 2BHCA 4QR8A 4B28A 4JUQA 4S00A 2GGBA 4FKCA 4FLLA 1C21A 3BIPA 3CTZA 3IU7A 1WL9A 4U71A 5CDEA 4FLKA 4A6WA 2EVCA 3PKBA 1YJ3A 4IKUA 1W2MA 2Q95A 3FMQA 4U6EA 2Q94A 4ZWOA 2P99A 4OOKA 5D6EA 1R58A 4PV4A 4A6VA 3L24A 3PKAA 3IU9A 4U76A 4U69A 3FMRA 5E5BA 1WKMA 1WN1A 5FCFA 2GG9A 5D6FA 4IF7A 4FO7A 4RGZ1 1XGOA 3TAVA 2ADUA 4IKTA 4S2TP 1C24A 4IDYA 3MR1A 4KM3A 2BN7A 2BWSA 1QZYA 2BWWA 1CHMA 2Q96A 4R60A 2GGCA 3BIQA 2GG2A 2ZSGA 3RVAA 2GG8A 3MATA 4IKRA 3L7GA 3CB6A 1WY2A 1R5GA 4ZWPA 1W7VA 2GA2A 2GZ5A 2P98A 2MATA 5CDLA 5JI6A 2GU6A 1XGNA 2GG0A 2NQ6A 1KP0A 3TB5A 2IW2A 4IECA 2Q93A 2B3KA 2P9AA 4U1BA 4U73A 1XGSA 3PKDA 3MX6A 2GU4A 2B3HA 4MATA 2HOWA 2GTXA 5JHUA 1JAWA 1B6AA 1YW8A 2GG3A 4FLIA 4FLJA 1PV9A 4U6JA 4ZNGA 1WLRA 1QXWA 2BWYA 1A16A 1BOAA 2G6PA 1BN5A 4FUKA 2BWTA 4FO8A 4U75A 3PKEA 1YVMA 2B3LA 2BHAA 2EVMA 3D27A 3IG4A 2EVOA 1N51A 4EGEA 5CDVA 1C27A 3IU8A 2OAZA 1R5HA 4RZZA 4ZWUA 2BWVA 1WL6A
chains in the Genus database with same CATH superfamily
5CLSA 2Q8KA 2EA2A 2DFIA 5FCHA 4U6ZA 1M35A 1QXZA 2BB7A 1MATA 4U70A 5CE6A 1XNZA 4RZYA 2V3ZA 2BWUA 2BWXA 3PKCA 1O0XA 1QXYA 2V6CA 3RORA 4S2RP 3FM3A 1C23A 1B59A 2GU5A 2EA4A 2V3XA 3Q6DA 2GG5A 2Q92A 2BHBA 4S01A 1YW9A 1Y1NA 2GG7A 4U6CA 1YW7A 5CIKA 1C22A 1WBQA 4U6WA 1XGMA 2NQ7A 2OKNA 2V3YA 3BITA 2GU7A 4IPAA 2BH3A 5CNXA 2BHDA 4HXXA 4Z7MA 1KQ9A 4IKSA 3CB5A 5JFRA 4PNCA 4IU6A 1KQ0A 3S6BA 2BHCA 4QR8A 4B28A 4JUQA 4S00A 2GGBA 4FKCA 4FLLA 1C21A 3BIPA 3CTZA 3IU7A 1WL9A 4U71A 5CDEA 4FLKA 4A6WA 2EVCA 3PKBA 1YJ3A 4IKUA 1W2MA 2Q95A 3FMQA 4U6EA 2Q94A 4ZWOA 2P99A 4OOKA 5D6EA 1R58A 4PV4A 4A6VA 3L24A 3PKAA 3IU9A 4U76A 4U69A 3FMRA 5E5BA 1WKMA 1WN1A 5FCFA 2GG9A 5D6FA 4IF7A 4FO7A 4RGZ1 1XGOA 3TAVA 2ADUA 4IKTA 4S2TP 1C24A 4IDYA 3MR1A 4KM3A 2BN7A 2BWSA 1QZYA 2BWWA 1CHMA 2Q96A 4R60A 2GGCA 3BIQA 2GG2A 2ZSGA 3RVAA 2GG8A 3MATA 4IKRA 3L7GA 3CB6A 1WY2A 1R5GA 4ZWPA 1W7VA 2GA2A 2GZ5A 2P98A 2MATA 5CDLA 5JI6A 2GU6A 1XGNA 2GG0A 2NQ6A 1KP0A 3TB5A 2IW2A 4IECA 2Q93A 2B3KA 2P9AA 4U1BA 4U73A 1XGSA 3PKDA 3MX6A 2GU4A 2B3HA 4MATA 2HOWA 2GTXA 5JHUA 1JAWA 1B6AA 1YW8A 2GG3A 4FLIA 4FLJA 1PV9A 4U6JA 4ZNGA 1WLRA 1QXWA 2BWYA 1A16A 1BOAA 2G6PA 1BN5A 4FUKA 2BWTA 4FO8A 4U75A 3PKEA 1YVMA 2B3LA 2BHAA 2EVMA 3D27A 3IG4A 2EVOA 1N51A 4EGEA 5CDVA 1C27A 3IU8A 2OAZA 1R5HA 4RZZA 4ZWUA 2BWVA 1WL6A
chains in the Genus database with same CATH topology
5CLSA 2Q8KA 2EA2A 2DFIA 5FCHA 4U6ZA 1M35A 1QXZA 2BB7A 1MATA 4U70A 5CE6A 1XNZA 4RZYA 2V3ZA 2BWUA 2BWXA 3PKCA 1O0XA 1QXYA 2V6CA 3RORA 4S2RP 3FM3A 1C23A 1B59A 2GU5A 2EA4A 2V3XA 3Q6DA 2GG5A 2Q92A 2BHBA 4S01A 1YW9A 1Y1NA 2GG7A 4U6CA 1YW7A 5CIKA 1C22A 1WBQA 4U6WA 1XGMA 2NQ7A 2OKNA 2V3YA 3BITA 2GU7A 4IPAA 2BH3A 5CNXA 2BHDA 4HXXA 4Z7MA 1KQ9A 4IKSA 3CB5A 5JFRA 4PNCA 4IU6A 1KQ0A 3S6BA 2BHCA 4QR8A 4B28A 4JUQA 4S00A 2GGBA 4FKCA 4FLLA 1C21A 3BIPA 3CTZA 3IU7A 1WL9A 4U71A 5CDEA 4FLKA 4A6WA 2EVCA 3PKBA 1YJ3A 4IKUA 1W2MA 2Q95A 3FMQA 4U6EA 2Q94A 4ZWOA 2P99A 4OOKA 5D6EA 1R58A 4PV4A 4A6VA 3L24A 3PKAA 3IU9A 4U76A 4U69A 3FMRA 5E5BA 1WKMA 1WN1A 5FCFA 2GG9A 5D6FA 4IF7A 4FO7A 4RGZ1 1XGOA 3TAVA 2ADUA 4IKTA 4S2TP 1C24A 4IDYA 3MR1A 4KM3A 2BN7A 2BWSA 1QZYA 2BWWA 1CHMA 2Q96A 4R60A 2GGCA 3BIQA 2GG2A 2ZSGA 3RVAA 2GG8A 3MATA 4IKRA 3L7GA 3CB6A 1WY2A 1R5GA 4ZWPA 1W7VA 2GA2A 2GZ5A 2P98A 2MATA 5CDLA 5JI6A 2GU6A 1XGNA 2GG0A 2NQ6A 1KP0A 3TB5A 2IW2A 4IECA 2Q93A 2B3KA 2P9AA 4U1BA 4U73A 1XGSA 3PKDA 3MX6A 2GU4A 2B3HA 4MATA 2HOWA 2GTXA 5JHUA 1JAWA 1B6AA 1YW8A 2GG3A 4FLIA 4FLJA 1PV9A 4U6JA 4ZNGA 1WLRA 1QXWA 2BWYA 1A16A 1BOAA 2G6PA 1BN5A 4FUKA 2BWTA 4FO8A 4U75A 3PKEA 1YVMA 2B3LA 2BHAA 2EVMA 3D27A 3IG4A 2EVOA 1N51A 4EGEA 5CDVA 1C27A 3IU8A 2OAZA 1R5HA 4RZZA 4ZWUA 2BWVA 1WL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLS A;  2Q8K A;  2EA2 A;  2DFI A;  5FCH A;  4U6Z A;  1M35 A;  1QXZ A;  2BB7 A;  1MAT A;  4U70 A;  5CE6 A;  1XNZ A;  4RZY A;  2V3Z A;  2BWU A;  2BWX A;  3PKC A;  1O0X A;  1QXY A;  2V6C A;  3ROR A;  4S2R P;  3FM3 A;  1C23 A;  1B59 A;  2GU5 A;  2EA4 A;  2V3X A;  3Q6D A;  2GG5 A;  2Q92 A;  2BHB A;  4S01 A;  1YW9 A;  1Y1N A;  2GG7 A;  4U6C A;  1YW7 A;  5CIK A;  1C22 A;  1WBQ A;  4U6W A;  1XGM A;  2NQ7 A;  2OKN A;  2V3Y A;  3BIT A;  2GU7 A;  4IPA A;  2BH3 A;  5CNX A;  2BHD A;  4HXX A;  4Z7M A;  1KQ9 A;  4IKS A;  3CB5 A;  5JFR A;  4PNC A;  4IU6 A;  1KQ0 A;  3S6B A;  2BHC A;  4QR8 A;  4B28 A;  4JUQ A;  4S00 A;  2GGB A;  4FKC A;  4FLL A;  1C21 A;  3BIP A;  3CTZ A;  3IU7 A;  1WL9 A;  4U71 A;  5CDE A;  4FLK A;  4A6W A;  2EVC A;  3PKB A;  1YJ3 A;  4IKU A;  1W2M A;  2Q95 A;  3FMQ A;  4U6E A;  2Q94 A;  4ZWO A;  2P99 A;  4OOK A;  5D6E A;  1R58 A;  4PV4 A;  4A6V A;  3L24 A;  3PKA A;  3IU9 A;  4U76 A;  4U69 A;  3FMR A;  5E5B A;  1WKM A;  1WN1 A;  5FCF A;  2GG9 A;  5D6F A;  4IF7 A;  4FO7 A;  4RGZ 1;  1XGO A;  3TAV A;  2ADU A;  4IKT A;  4S2T P;  1C24 A;  4IDY A;  3MR1 A;  4KM3 A;  2BN7 A;  2BWS A;  1QZY A;  2BWW A;  1CHM A;  2Q96 A;  4R60 A;  2GGC A;  3BIQ A;  2GG2 A;  2ZSG A;  3RVA A;  2GG8 A;  3MAT A;  4IKR A;  3L7G A;  3CB6 A;  1WY2 A;  1R5G A;  4ZWP A;  1W7V A;  2GA2 A;  2GZ5 A;  2P98 A;  2MAT A;  5CDL A;  5JI6 A;  2GU6 A;  1XGN A;  2GG0 A;  2NQ6 A;  1KP0 A;  3TB5 A;  2IW2 A;  4IEC A;  2Q93 A;  2B3K A;  2P9A A;  4U1B A;  4U73 A;  1XGS A;  3PKD A;  3MX6 A;  2GU4 A;  2B3H A;  4MAT A;  2HOW A;  2GTX A;  5JHU A;  1JAW A;  1B6A A;  1YW8 A;  2GG3 A;  4FLI A;  4FLJ A;  1PV9 A;  4U6J A;  4ZNG A;  1WLR A;  1QXW A;  2BWY A;  1A16 A;  1BOA A;  2G6P A;  1BN5 A;  4FUK A;  2BWT A;  4FO8 A;  4U75 A;  3PKE A;  1YVM A;  2B3L A;  2BHA A;  2EVM A;  3D27 A;  3IG4 A;  2EVO A;  1N51 A;  4EGE A;  5CDV A;  1C27 A;  3IU8 A;  2OAZ A;  1R5H A;  4RZZ A;  4ZWU A;  2BWV A;  1WL6 A; 
#chains in the Genus database with same CATH topology
 5CLS A;  2Q8K A;  2EA2 A;  2DFI A;  5FCH A;  4U6Z A;  1M35 A;  1QXZ A;  2BB7 A;  1MAT A;  4U70 A;  5CE6 A;  1XNZ A;  4RZY A;  2V3Z A;  2BWU A;  2BWX A;  3PKC A;  1O0X A;  1QXY A;  2V6C A;  3ROR A;  4S2R P;  3FM3 A;  1C23 A;  1B59 A;  2GU5 A;  2EA4 A;  2V3X A;  3Q6D A;  2GG5 A;  2Q92 A;  2BHB A;  4S01 A;  1YW9 A;  1Y1N A;  2GG7 A;  4U6C A;  1YW7 A;  5CIK A;  1C22 A;  1WBQ A;  4U6W A;  1XGM A;  2NQ7 A;  2OKN A;  2V3Y A;  3BIT A;  2GU7 A;  4IPA A;  2BH3 A;  5CNX A;  2BHD A;  4HXX A;  4Z7M A;  1KQ9 A;  4IKS A;  3CB5 A;  5JFR A;  4PNC A;  4IU6 A;  1KQ0 A;  3S6B A;  2BHC A;  4QR8 A;  4B28 A;  4JUQ A;  4S00 A;  2GGB A;  4FKC A;  4FLL A;  1C21 A;  3BIP A;  3CTZ A;  3IU7 A;  1WL9 A;  4U71 A;  5CDE A;  4FLK A;  4A6W A;  2EVC A;  3PKB A;  1YJ3 A;  4IKU A;  1W2M A;  2Q95 A;  3FMQ A;  4U6E A;  2Q94 A;  4ZWO A;  2P99 A;  4OOK A;  5D6E A;  1R58 A;  4PV4 A;  4A6V A;  3L24 A;  3PKA A;  3IU9 A;  4U76 A;  4U69 A;  3FMR A;  5E5B A;  1WKM A;  1WN1 A;  5FCF A;  2GG9 A;  5D6F A;  4IF7 A;  4FO7 A;  4RGZ 1;  1XGO A;  3TAV A;  2ADU A;  4IKT A;  4S2T P;  1C24 A;  4IDY A;  3MR1 A;  4KM3 A;  2BN7 A;  2BWS A;  1QZY A;  2BWW A;  1CHM A;  2Q96 A;  4R60 A;  2GGC A;  3BIQ A;  2GG2 A;  2ZSG A;  3RVA A;  2GG8 A;  3MAT A;  4IKR A;  3L7G A;  3CB6 A;  1WY2 A;  1R5G A;  4ZWP A;  1W7V A;  2GA2 A;  2GZ5 A;  2P98 A;  2MAT A;  5CDL A;  5JI6 A;  2GU6 A;  1XGN A;  2GG0 A;  2NQ6 A;  1KP0 A;  3TB5 A;  2IW2 A;  4IEC A;  2Q93 A;  2B3K A;  2P9A A;  4U1B A;  4U73 A;  1XGS A;  3PKD A;  3MX6 A;  2GU4 A;  2B3H A;  4MAT A;  2HOW A;  2GTX A;  5JHU A;  1JAW A;  1B6A A;  1YW8 A;  2GG3 A;  4FLI A;  4FLJ A;  1PV9 A;  4U6J A;  4ZNG A;  1WLR A;  1QXW A;  2BWY A;  1A16 A;  1BOA A;  2G6P A;  1BN5 A;  4FUK A;  2BWT A;  4FO8 A;  4U75 A;  3PKE A;  1YVM A;  2B3L A;  2BHA A;  2EVM A;  3D27 A;  3IG4 A;  2EVO A;  1N51 A;  4EGE A;  5CDV A;  1C27 A;  3IU8 A;  2OAZ A;  1R5H A;  4RZZ A;  4ZWU A;  2BWV A;  1WL6 A; 
#chains in the Genus database with same CATH homology
 5CLS A;  2Q8K A;  2EA2 A;  2DFI A;  5FCH A;  4U6Z A;  1M35 A;  1QXZ A;  2BB7 A;  1MAT A;  4U70 A;  5CE6 A;  1XNZ A;  4RZY A;  2V3Z A;  2BWU A;  2BWX A;  3PKC A;  1O0X A;  1QXY A;  2V6C A;  3ROR A;  4S2R P;  3FM3 A;  1C23 A;  1B59 A;  2GU5 A;  2EA4 A;  2V3X A;  3Q6D A;  2GG5 A;  2Q92 A;  2BHB A;  4S01 A;  1YW9 A;  1Y1N A;  2GG7 A;  4U6C A;  1YW7 A;  5CIK A;  1C22 A;  1WBQ A;  4U6W A;  1XGM A;  2NQ7 A;  2OKN A;  2V3Y A;  3BIT A;  2GU7 A;  4IPA A;  2BH3 A;  5CNX A;  2BHD A;  4HXX A;  4Z7M A;  1KQ9 A;  4IKS A;  3CB5 A;  5JFR A;  4PNC A;  4IU6 A;  1KQ0 A;  3S6B A;  2BHC A;  4QR8 A;  4B28 A;  4JUQ A;  4S00 A;  2GGB A;  4FKC A;  4FLL A;  1C21 A;  3BIP A;  3CTZ A;  3IU7 A;  1WL9 A;  4U71 A;  5CDE A;  4FLK A;  4A6W A;  2EVC A;  3PKB A;  1YJ3 A;  4IKU A;  1W2M A;  2Q95 A;  3FMQ A;  4U6E A;  2Q94 A;  4ZWO A;  2P99 A;  4OOK A;  5D6E A;  1R58 A;  4PV4 A;  4A6V A;  3L24 A;  3PKA A;  3IU9 A;  4U76 A;  4U69 A;  3FMR A;  5E5B A;  1WKM A;  1WN1 A;  5FCF A;  2GG9 A;  5D6F A;  4IF7 A;  4FO7 A;  4RGZ 1;  1XGO A;  3TAV A;  2ADU A;  4IKT A;  4S2T P;  1C24 A;  4IDY A;  3MR1 A;  4KM3 A;  2BN7 A;  2BWS A;  1QZY A;  2BWW A;  1CHM A;  2Q96 A;  4R60 A;  2GGC A;  3BIQ A;  2GG2 A;  2ZSG A;  3RVA A;  2GG8 A;  3MAT A;  4IKR A;  3L7G A;  3CB6 A;  1WY2 A;  1R5G A;  4ZWP A;  1W7V A;  2GA2 A;  2GZ5 A;  2P98 A;  2MAT A;  5CDL A;  5JI6 A;  2GU6 A;  1XGN A;  2GG0 A;  2NQ6 A;  1KP0 A;  3TB5 A;  2IW2 A;  4IEC A;  2Q93 A;  2B3K A;  2P9A A;  4U1B A;  4U73 A;  1XGS A;  3PKD A;  3MX6 A;  2GU4 A;  2B3H A;  4MAT A;  2HOW A;  2GTX A;  5JHU A;  1JAW A;  1B6A A;  1YW8 A;  2GG3 A;  4FLI A;  4FLJ A;  1PV9 A;  4U6J A;  4ZNG A;  1WLR A;  1QXW A;  2BWY A;  1A16 A;  1BOA A;  2G6P A;  1BN5 A;  4FUK A;  2BWT A;  4FO8 A;  4U75 A;  3PKE A;  1YVM A;  2B3L A;  2BHA A;  2EVM A;  3D27 A;  3IG4 A;  2EVO A;  1N51 A;  4EGE A;  5CDV A;  1C27 A;  3IU8 A;  2OAZ A;  1R5H A;  4RZZ A;  4ZWU A;  2BWV A;  1WL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...