2Q95A

E. coli methionine aminopeptidase mn-form with inhibitor a05
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q95A00
1Y1NA 1XGSA 3MR1A 1QZYA 5JFRA 2BWTA 4IKUA 1WN1A 2P9AA 3IU9A 4U6JA 3FMRA 3IU8A 2Q8KA 2B3HA 4EGEA 4IPAA 2EA2A 2BWUA 2HOWA 4IF7A 4FLLA 4U6ZA 2EVOA 5CDLA 1YVMA 1WKMA 5FCFA 1WY2A 5JHUA 4Z7MA 2GG3A 1B59A 4IKTA 4RZZA 2DFIA 4U6EA 5CIKA 2GG5A 2Q94A 1MATA 2EA4A 4IKSA 4RZYA 2BHAA 2BWWA 1BN5A 3BITA 4KM3A 5CDEA 2BWSA 4QR8A 3CTZA 4U6CA 4ZNGA 3RVAA 3PKDA 5FCHA 3FMQA 3TAVA 1C24A 2OAZA 1C27A 4FUKA 2BN7A 1C23A 2B3LA 2P98A 1W2MA 3IU7A 1QXZA 2BWXA 4U76A 2V3XA 2G6PA 1YJ3A 2GZ5A 4U71A 4IU6A 3L24A 2GU4A 3PKAA 2Q95A 2BHDA 4HXXA 4PNCA 5E5BA 2ZSGA 3MX6A 4MATA 4FO7A 1M35A 1WL6A 4U1BA 4U70A 4A6VA 2GG8A 2Q96A 4FKCA 2V3YA 5JI6A 1R58A 2ADUA 4R60A 2B3KA 3RORA 2GG9A 3BIQA 2P99A 3S6BA 3L7GA 2GA2A 2GU5A 2GGCA 1W7VA 1A16A 2Q93A 1O0XA 3D27A 1YW8A 4U73A 1QXWA 4IKRA 1YW9A 2NQ7A 2GG7A 1R5GA 1WL9A 2NQ6A 4RGZ1 1KQ9A 3CB6A 4FO8A 1WLRA 3MATA 4U6WA 1N51A 1C21A 1BOAA 2Q92A 4FLIA 1XNZA 2BHBA 5CDVA 4B28A 1XGOA 1PV9A 2EVCA 3FM3A 2BWYA 2V3ZA 4S00A 2GU7A 4FLJA 3PKEA 2EVMA 4ZWOA 2BWVA 2GU6A 4OOKA 1XGNA 1CHMA 4JUQA 5CLSA 4S2RP 1YW7A 3PKCA 1WBQA 3Q6DA 1R5HA 3BIPA 2IW2A 4S2TP 2GG0A 1KQ0A 2BHCA 4ZWPA 2BH3A 4S01A 3TB5A 1KP0A 4U75A 3CB5A 5CE6A 3IG4A 4FLKA 1C22A 1QXYA 4IDYA 4PV4A 1XGMA 2OKNA 2GGBA 1B6AA 2V6CA 5D6FA 2MATA 4ZWUA 1JAWA 4U69A 2GG2A 4A6WA 2GTXA 4IECA 5CNXA 5D6EA 3PKBA 2BB7A
chains in the Genus database with same CATH superfamily
1Y1NA 1XGSA 3MR1A 1QZYA 5JFRA 2BWTA 4IKUA 1WN1A 2P9AA 3IU9A 4U6JA 3FMRA 3IU8A 2Q8KA 2B3HA 4EGEA 4IPAA 2EA2A 2BWUA 2HOWA 4IF7A 4FLLA 4U6ZA 2EVOA 5CDLA 1YVMA 1WKMA 5FCFA 1WY2A 5JHUA 4Z7MA 2GG3A 1B59A 4IKTA 4RZZA 2DFIA 4U6EA 5CIKA 2GG5A 2Q94A 1MATA 2EA4A 4IKSA 4RZYA 2BHAA 2BWWA 1BN5A 3BITA 4KM3A 5CDEA 2BWSA 4QR8A 3CTZA 4U6CA 4ZNGA 3RVAA 3PKDA 5FCHA 3FMQA 3TAVA 1C24A 2OAZA 1C27A 4FUKA 2BN7A 1C23A 2B3LA 2P98A 1W2MA 3IU7A 1QXZA 2BWXA 4U76A 2V3XA 2G6PA 1YJ3A 2GZ5A 4U71A 4IU6A 3L24A 2GU4A 3PKAA 2Q95A 2BHDA 4HXXA 4PNCA 5E5BA 2ZSGA 3MX6A 4MATA 4FO7A 1M35A 1WL6A 4U1BA 4U70A 4A6VA 2GG8A 2Q96A 4FKCA 2V3YA 5JI6A 1R58A 2ADUA 4R60A 2B3KA 3RORA 2GG9A 3BIQA 2P99A 3S6BA 3L7GA 2GA2A 2GU5A 2GGCA 1W7VA 1A16A 2Q93A 1O0XA 3D27A 1YW8A 4U73A 1QXWA 4IKRA 1YW9A 2NQ7A 2GG7A 1R5GA 1WL9A 2NQ6A 4RGZ1 1KQ9A 3CB6A 4FO8A 1WLRA 3MATA 4U6WA 1N51A 1C21A 1BOAA 2Q92A 4FLIA 1XNZA 2BHBA 5CDVA 4B28A 1XGOA 1PV9A 2EVCA 3FM3A 2BWYA 2V3ZA 4S00A 2GU7A 4FLJA 3PKEA 2EVMA 4ZWOA 2BWVA 2GU6A 4OOKA 1XGNA 1CHMA 4JUQA 5CLSA 4S2RP 1YW7A 3PKCA 1WBQA 3Q6DA 1R5HA 3BIPA 2IW2A 4S2TP 2GG0A 1KQ0A 2BHCA 4ZWPA 2BH3A 4S01A 3TB5A 1KP0A 4U75A 3CB5A 5CE6A 3IG4A 4FLKA 1C22A 1QXYA 4IDYA 4PV4A 1XGMA 2OKNA 2GGBA 1B6AA 2V6CA 5D6FA 2MATA 4ZWUA 1JAWA 4U69A 2GG2A 4A6WA 2GTXA 4IECA 5CNXA 5D6EA 3PKBA 2BB7A
chains in the Genus database with same CATH topology
1Y1NA 1XGSA 3MR1A 1QZYA 5JFRA 2BWTA 4IKUA 1WN1A 2P9AA 3IU9A 4U6JA 3FMRA 3IU8A 2Q8KA 2B3HA 4EGEA 4IPAA 2EA2A 2BWUA 2HOWA 4IF7A 4FLLA 4U6ZA 2EVOA 5CDLA 1YVMA 1WKMA 5FCFA 1WY2A 5JHUA 4Z7MA 2GG3A 1B59A 4IKTA 4RZZA 2DFIA 4U6EA 5CIKA 2GG5A 2Q94A 1MATA 2EA4A 4IKSA 4RZYA 2BHAA 2BWWA 1BN5A 3BITA 4KM3A 5CDEA 2BWSA 4QR8A 3CTZA 4U6CA 4ZNGA 3RVAA 3PKDA 5FCHA 3FMQA 3TAVA 1C24A 2OAZA 1C27A 4FUKA 2BN7A 1C23A 2B3LA 2P98A 1W2MA 3IU7A 1QXZA 2BWXA 4U76A 2V3XA 2G6PA 1YJ3A 2GZ5A 4U71A 4IU6A 3L24A 2GU4A 3PKAA 2Q95A 2BHDA 4HXXA 4PNCA 5E5BA 2ZSGA 3MX6A 4MATA 4FO7A 1M35A 1WL6A 4U1BA 4U70A 4A6VA 2GG8A 2Q96A 4FKCA 2V3YA 5JI6A 1R58A 2ADUA 4R60A 2B3KA 3RORA 2GG9A 3BIQA 2P99A 3S6BA 3L7GA 2GA2A 2GU5A 2GGCA 1W7VA 1A16A 2Q93A 1O0XA 3D27A 1YW8A 4U73A 1QXWA 4IKRA 1YW9A 2NQ7A 2GG7A 1R5GA 1WL9A 2NQ6A 4RGZ1 1KQ9A 3CB6A 4FO8A 1WLRA 3MATA 4U6WA 1N51A 1C21A 1BOAA 2Q92A 4FLIA 1XNZA 2BHBA 5CDVA 4B28A 1XGOA 1PV9A 2EVCA 3FM3A 2BWYA 2V3ZA 4S00A 2GU7A 4FLJA 3PKEA 2EVMA 4ZWOA 2BWVA 2GU6A 4OOKA 1XGNA 1CHMA 4JUQA 5CLSA 4S2RP 1YW7A 3PKCA 1WBQA 3Q6DA 1R5HA 3BIPA 2IW2A 4S2TP 2GG0A 1KQ0A 2BHCA 4ZWPA 2BH3A 4S01A 3TB5A 1KP0A 4U75A 3CB5A 5CE6A 3IG4A 4FLKA 1C22A 1QXYA 4IDYA 4PV4A 1XGMA 2OKNA 2GGBA 1B6AA 2V6CA 5D6FA 2MATA 4ZWUA 1JAWA 4U69A 2GG2A 4A6WA 2GTXA 4IECA 5CNXA 5D6EA 3PKBA 2BB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1N A;  1XGS A;  3MR1 A;  1QZY A;  5JFR A;  2BWT A;  4IKU A;  1WN1 A;  2P9A A;  3IU9 A;  4U6J A;  3FMR A;  3IU8 A;  2Q8K A;  2B3H A;  4EGE A;  4IPA A;  2EA2 A;  2BWU A;  2HOW A;  4IF7 A;  4FLL A;  4U6Z A;  2EVO A;  5CDL A;  1YVM A;  1WKM A;  5FCF A;  1WY2 A;  5JHU A;  4Z7M A;  2GG3 A;  1B59 A;  4IKT A;  4RZZ A;  2DFI A;  4U6E A;  5CIK A;  2GG5 A;  2Q94 A;  1MAT A;  2EA4 A;  4IKS A;  4RZY A;  2BHA A;  2BWW A;  1BN5 A;  3BIT A;  4KM3 A;  5CDE A;  2BWS A;  4QR8 A;  3CTZ A;  4U6C A;  4ZNG A;  3RVA A;  3PKD A;  5FCH A;  3FMQ A;  3TAV A;  1C24 A;  2OAZ A;  1C27 A;  4FUK A;  2BN7 A;  1C23 A;  2B3L A;  2P98 A;  1W2M A;  3IU7 A;  1QXZ A;  2BWX A;  4U76 A;  2V3X A;  2G6P A;  1YJ3 A;  2GZ5 A;  4U71 A;  4IU6 A;  3L24 A;  2GU4 A;  3PKA A;  2Q95 A;  2BHD A;  4HXX A;  4PNC A;  5E5B A;  2ZSG A;  3MX6 A;  4MAT A;  4FO7 A;  1M35 A;  1WL6 A;  4U1B A;  4U70 A;  4A6V A;  2GG8 A;  2Q96 A;  4FKC A;  2V3Y A;  5JI6 A;  1R58 A;  2ADU A;  4R60 A;  2B3K A;  3ROR A;  2GG9 A;  3BIQ A;  2P99 A;  3S6B A;  3L7G A;  2GA2 A;  2GU5 A;  2GGC A;  1W7V A;  1A16 A;  2Q93 A;  1O0X A;  3D27 A;  1YW8 A;  4U73 A;  1QXW A;  4IKR A;  1YW9 A;  2NQ7 A;  2GG7 A;  1R5G A;  1WL9 A;  2NQ6 A;  4RGZ 1;  1KQ9 A;  3CB6 A;  4FO8 A;  1WLR A;  3MAT A;  4U6W A;  1N51 A;  1C21 A;  1BOA A;  2Q92 A;  4FLI A;  1XNZ A;  2BHB A;  5CDV A;  4B28 A;  1XGO A;  1PV9 A;  2EVC A;  3FM3 A;  2BWY A;  2V3Z A;  4S00 A;  2GU7 A;  4FLJ A;  3PKE A;  2EVM A;  4ZWO A;  2BWV A;  2GU6 A;  4OOK A;  1XGN A;  1CHM A;  4JUQ A;  5CLS A;  4S2R P;  1YW7 A;  3PKC A;  1WBQ A;  3Q6D A;  1R5H A;  3BIP A;  2IW2 A;  4S2T P;  2GG0 A;  1KQ0 A;  2BHC A;  4ZWP A;  2BH3 A;  4S01 A;  3TB5 A;  1KP0 A;  4U75 A;  3CB5 A;  5CE6 A;  3IG4 A;  4FLK A;  1C22 A;  1QXY A;  4IDY A;  4PV4 A;  1XGM A;  2OKN A;  2GGB A;  1B6A A;  2V6C A;  5D6F A;  2MAT A;  4ZWU A;  1JAW A;  4U69 A;  2GG2 A;  4A6W A;  2GTX A;  4IEC A;  5CNX A;  5D6E A;  3PKB A;  2BB7 A; 
#chains in the Genus database with same CATH topology
 1Y1N A;  1XGS A;  3MR1 A;  1QZY A;  5JFR A;  2BWT A;  4IKU A;  1WN1 A;  2P9A A;  3IU9 A;  4U6J A;  3FMR A;  3IU8 A;  2Q8K A;  2B3H A;  4EGE A;  4IPA A;  2EA2 A;  2BWU A;  2HOW A;  4IF7 A;  4FLL A;  4U6Z A;  2EVO A;  5CDL A;  1YVM A;  1WKM A;  5FCF A;  1WY2 A;  5JHU A;  4Z7M A;  2GG3 A;  1B59 A;  4IKT A;  4RZZ A;  2DFI A;  4U6E A;  5CIK A;  2GG5 A;  2Q94 A;  1MAT A;  2EA4 A;  4IKS A;  4RZY A;  2BHA A;  2BWW A;  1BN5 A;  3BIT A;  4KM3 A;  5CDE A;  2BWS A;  4QR8 A;  3CTZ A;  4U6C A;  4ZNG A;  3RVA A;  3PKD A;  5FCH A;  3FMQ A;  3TAV A;  1C24 A;  2OAZ A;  1C27 A;  4FUK A;  2BN7 A;  1C23 A;  2B3L A;  2P98 A;  1W2M A;  3IU7 A;  1QXZ A;  2BWX A;  4U76 A;  2V3X A;  2G6P A;  1YJ3 A;  2GZ5 A;  4U71 A;  4IU6 A;  3L24 A;  2GU4 A;  3PKA A;  2Q95 A;  2BHD A;  4HXX A;  4PNC A;  5E5B A;  2ZSG A;  3MX6 A;  4MAT A;  4FO7 A;  1M35 A;  1WL6 A;  4U1B A;  4U70 A;  4A6V A;  2GG8 A;  2Q96 A;  4FKC A;  2V3Y A;  5JI6 A;  1R58 A;  2ADU A;  4R60 A;  2B3K A;  3ROR A;  2GG9 A;  3BIQ A;  2P99 A;  3S6B A;  3L7G A;  2GA2 A;  2GU5 A;  2GGC A;  1W7V A;  1A16 A;  2Q93 A;  1O0X A;  3D27 A;  1YW8 A;  4U73 A;  1QXW A;  4IKR A;  1YW9 A;  2NQ7 A;  2GG7 A;  1R5G A;  1WL9 A;  2NQ6 A;  4RGZ 1;  1KQ9 A;  3CB6 A;  4FO8 A;  1WLR A;  3MAT A;  4U6W A;  1N51 A;  1C21 A;  1BOA A;  2Q92 A;  4FLI A;  1XNZ A;  2BHB A;  5CDV A;  4B28 A;  1XGO A;  1PV9 A;  2EVC A;  3FM3 A;  2BWY A;  2V3Z A;  4S00 A;  2GU7 A;  4FLJ A;  3PKE A;  2EVM A;  4ZWO A;  2BWV A;  2GU6 A;  4OOK A;  1XGN A;  1CHM A;  4JUQ A;  5CLS A;  4S2R P;  1YW7 A;  3PKC A;  1WBQ A;  3Q6D A;  1R5H A;  3BIP A;  2IW2 A;  4S2T P;  2GG0 A;  1KQ0 A;  2BHC A;  4ZWP A;  2BH3 A;  4S01 A;  3TB5 A;  1KP0 A;  4U75 A;  3CB5 A;  5CE6 A;  3IG4 A;  4FLK A;  1C22 A;  1QXY A;  4IDY A;  4PV4 A;  1XGM A;  2OKN A;  2GGB A;  1B6A A;  2V6C A;  5D6F A;  2MAT A;  4ZWU A;  1JAW A;  4U69 A;  2GG2 A;  4A6W A;  2GTX A;  4IEC A;  5CNX A;  5D6E A;  3PKB A;  2BB7 A; 
#chains in the Genus database with same CATH homology
 1Y1N A;  1XGS A;  3MR1 A;  1QZY A;  5JFR A;  2BWT A;  4IKU A;  1WN1 A;  2P9A A;  3IU9 A;  4U6J A;  3FMR A;  3IU8 A;  2Q8K A;  2B3H A;  4EGE A;  4IPA A;  2EA2 A;  2BWU A;  2HOW A;  4IF7 A;  4FLL A;  4U6Z A;  2EVO A;  5CDL A;  1YVM A;  1WKM A;  5FCF A;  1WY2 A;  5JHU A;  4Z7M A;  2GG3 A;  1B59 A;  4IKT A;  4RZZ A;  2DFI A;  4U6E A;  5CIK A;  2GG5 A;  2Q94 A;  1MAT A;  2EA4 A;  4IKS A;  4RZY A;  2BHA A;  2BWW A;  1BN5 A;  3BIT A;  4KM3 A;  5CDE A;  2BWS A;  4QR8 A;  3CTZ A;  4U6C A;  4ZNG A;  3RVA A;  3PKD A;  5FCH A;  3FMQ A;  3TAV A;  1C24 A;  2OAZ A;  1C27 A;  4FUK A;  2BN7 A;  1C23 A;  2B3L A;  2P98 A;  1W2M A;  3IU7 A;  1QXZ A;  2BWX A;  4U76 A;  2V3X A;  2G6P A;  1YJ3 A;  2GZ5 A;  4U71 A;  4IU6 A;  3L24 A;  2GU4 A;  3PKA A;  2Q95 A;  2BHD A;  4HXX A;  4PNC A;  5E5B A;  2ZSG A;  3MX6 A;  4MAT A;  4FO7 A;  1M35 A;  1WL6 A;  4U1B A;  4U70 A;  4A6V A;  2GG8 A;  2Q96 A;  4FKC A;  2V3Y A;  5JI6 A;  1R58 A;  2ADU A;  4R60 A;  2B3K A;  3ROR A;  2GG9 A;  3BIQ A;  2P99 A;  3S6B A;  3L7G A;  2GA2 A;  2GU5 A;  2GGC A;  1W7V A;  1A16 A;  2Q93 A;  1O0X A;  3D27 A;  1YW8 A;  4U73 A;  1QXW A;  4IKR A;  1YW9 A;  2NQ7 A;  2GG7 A;  1R5G A;  1WL9 A;  2NQ6 A;  4RGZ 1;  1KQ9 A;  3CB6 A;  4FO8 A;  1WLR A;  3MAT A;  4U6W A;  1N51 A;  1C21 A;  1BOA A;  2Q92 A;  4FLI A;  1XNZ A;  2BHB A;  5CDV A;  4B28 A;  1XGO A;  1PV9 A;  2EVC A;  3FM3 A;  2BWY A;  2V3Z A;  4S00 A;  2GU7 A;  4FLJ A;  3PKE A;  2EVM A;  4ZWO A;  2BWV A;  2GU6 A;  4OOK A;  1XGN A;  1CHM A;  4JUQ A;  5CLS A;  4S2R P;  1YW7 A;  3PKC A;  1WBQ A;  3Q6D A;  1R5H A;  3BIP A;  2IW2 A;  4S2T P;  2GG0 A;  1KQ0 A;  2BHC A;  4ZWP A;  2BH3 A;  4S01 A;  3TB5 A;  1KP0 A;  4U75 A;  3CB5 A;  5CE6 A;  3IG4 A;  4FLK A;  1C22 A;  1QXY A;  4IDY A;  4PV4 A;  1XGM A;  2OKN A;  2GGB A;  1B6A A;  2V6C A;  5D6F A;  2MAT A;  4ZWU A;  1JAW A;  4U69 A;  2GG2 A;  4A6W A;  2GTX A;  4IEC A;  5CNX A;  5D6E A;  3PKB A;  2BB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...