2Q95A

E. coli methionine aminopeptidase mn-form with inhibitor a05
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q95A00
3CTZA 2BWVA 5D6EA 1C23A 2BHAA 2P98A 2EA2A 1R5HA 2BWWA 2GA2A 4HXXA 2EA4A 4IDYA 2GG5A 2Q93A 4U73A 1MATA 3Q6DA 1C27A 2GG9A 5D6FA 2BWXA 4FKCA 1A16A 4Z7MA 4U70A 2BWSA 3PKAA 4RZYA 1C22A 1W7VA 3MR1A 3D27A 1C24A 1XGMA 1R5GA 2NQ7A 2Q94A 4IU6A 5FCFA 4JUQA 2G6PA 2ADUA 2MATA 1QZYA 1XGNA 2BWTA 2OAZA 3L7GA 1XGSA 4QR8A 3RVAA 2V6CA 3IU7A 2BHCA 1W2MA 1KQ9A 2BHDA 3PKBA 1WLRA 2BWUA 4U6EA 2GU5A 2OKNA 2EVMA 4IKRA 5CIKA 2V3XA 5CLSA 1O0XA 4OOKA 5CNXA 2IW2A 3PKDA 4FLJA 1BN5A 4U6ZA 2P9AA 3L24A 4FLLA 2GG8A 1M35A 5JHUA 2DFIA 4IPAA 3FM3A 4A6VA 1QXYA 1JAWA 1YVMA 4U6CA 1WY2A 2BWYA 2GGCA 4R60A 3TAVA 1WL6A 1YW9A 4FO8A 2B3HA 3PKCA 4RZZA 4S2RP 2B3KA 3FMRA 2GG0A 3IU9A 2Q8KA 2Q95A 2EVOA 4IKSA 5CDEA 4U1BA 2BH3A 4ZWOA 4U69A 3BIQA 1PV9A 1BOAA 5FCHA 3MATA 2ZSGA 3FMQA 4IECA 3PKEA 1XGOA 5JI6A 4S01A 1B59A 2V3YA 4B28A 1YW8A 2GTXA 1B6AA 4U6WA 4ZWUA 3BITA 3CB5A 2BB7A 4ZNGA 2GU4A 5CDLA 4KM3A 2V3ZA 4IF7A 1KQ0A 4FUKA 1WN1A 2NQ6A 4A6WA 1YW7A 4MATA 1YJ3A 1WKMA 3CB6A 4FLIA 1R58A 4FO7A 2HOWA 4EGEA 2Q96A 3TB5A 4IKUA 1Y1NA 4S00A 5JFRA 4S2TP 4RGZ1 2Q92A 1KP0A 2GU7A 1QXZA 1CHMA 2GG7A 2GG3A 1WL9A 4FLKA 3IU8A 3RORA 3IG4A 4U76A 5CDVA 5CE6A 4U71A 4U6JA 1XNZA 4PNCA 3MX6A 2GU6A 1N51A 4ZWPA 4U75A 1QXWA 2GGBA 5E5BA 2EVCA 1C21A 4IKTA 2B3LA 2GZ5A 3BIPA 1WBQA 2BHBA 2BN7A 4PV4A 2P99A 3S6BA 2GG2A
chains in the Genus database with same CATH superfamily
3CTZA 2BWVA 5D6EA 1C23A 2BHAA 2P98A 2EA2A 1R5HA 2BWWA 2GA2A 4HXXA 2EA4A 4IDYA 2GG5A 2Q93A 4U73A 1MATA 3Q6DA 1C27A 2GG9A 5D6FA 2BWXA 4FKCA 1A16A 4Z7MA 4U70A 2BWSA 3PKAA 4RZYA 1C22A 1W7VA 3MR1A 3D27A 1C24A 1XGMA 1R5GA 2NQ7A 2Q94A 4IU6A 5FCFA 4JUQA 2G6PA 2ADUA 2MATA 1QZYA 1XGNA 2BWTA 2OAZA 3L7GA 1XGSA 4QR8A 3RVAA 2V6CA 3IU7A 2BHCA 1W2MA 1KQ9A 2BHDA 3PKBA 1WLRA 2BWUA 4U6EA 2GU5A 2OKNA 2EVMA 4IKRA 5CIKA 2V3XA 5CLSA 1O0XA 4OOKA 5CNXA 2IW2A 3PKDA 4FLJA 1BN5A 4U6ZA 2P9AA 3L24A 4FLLA 2GG8A 1M35A 5JHUA 2DFIA 4IPAA 3FM3A 4A6VA 1QXYA 1JAWA 1YVMA 4U6CA 1WY2A 2BWYA 2GGCA 4R60A 3TAVA 1WL6A 1YW9A 4FO8A 2B3HA 3PKCA 4RZZA 4S2RP 2B3KA 3FMRA 2GG0A 3IU9A 2Q8KA 2Q95A 2EVOA 4IKSA 5CDEA 4U1BA 2BH3A 4ZWOA 4U69A 3BIQA 1PV9A 1BOAA 5FCHA 3MATA 2ZSGA 3FMQA 4IECA 3PKEA 1XGOA 5JI6A 4S01A 1B59A 2V3YA 4B28A 1YW8A 2GTXA 1B6AA 4U6WA 4ZWUA 3BITA 3CB5A 2BB7A 4ZNGA 2GU4A 5CDLA 4KM3A 2V3ZA 4IF7A 1KQ0A 4FUKA 1WN1A 2NQ6A 4A6WA 1YW7A 4MATA 1YJ3A 1WKMA 3CB6A 4FLIA 1R58A 4FO7A 2HOWA 4EGEA 2Q96A 3TB5A 4IKUA 1Y1NA 4S00A 5JFRA 4S2TP 4RGZ1 2Q92A 1KP0A 2GU7A 1QXZA 1CHMA 2GG7A 2GG3A 1WL9A 4FLKA 3IU8A 3RORA 3IG4A 4U76A 5CDVA 5CE6A 4U71A 4U6JA 1XNZA 4PNCA 3MX6A 2GU6A 1N51A 4ZWPA 4U75A 1QXWA 2GGBA 5E5BA 2EVCA 1C21A 4IKTA 2B3LA 2GZ5A 3BIPA 1WBQA 2BHBA 2BN7A 4PV4A 2P99A 3S6BA 2GG2A
chains in the Genus database with same CATH topology
3CTZA 2BWVA 5D6EA 1C23A 2BHAA 2P98A 2EA2A 1R5HA 2BWWA 2GA2A 4HXXA 2EA4A 4IDYA 2GG5A 2Q93A 4U73A 1MATA 3Q6DA 1C27A 2GG9A 5D6FA 2BWXA 4FKCA 1A16A 4Z7MA 4U70A 2BWSA 3PKAA 4RZYA 1C22A 1W7VA 3MR1A 3D27A 1C24A 1XGMA 1R5GA 2NQ7A 2Q94A 4IU6A 5FCFA 4JUQA 2G6PA 2ADUA 2MATA 1QZYA 1XGNA 2BWTA 2OAZA 3L7GA 1XGSA 4QR8A 3RVAA 2V6CA 3IU7A 2BHCA 1W2MA 1KQ9A 2BHDA 3PKBA 1WLRA 2BWUA 4U6EA 2GU5A 2OKNA 2EVMA 4IKRA 5CIKA 2V3XA 5CLSA 1O0XA 4OOKA 5CNXA 2IW2A 3PKDA 4FLJA 1BN5A 4U6ZA 2P9AA 3L24A 4FLLA 2GG8A 1M35A 5JHUA 2DFIA 4IPAA 3FM3A 4A6VA 1QXYA 1JAWA 1YVMA 4U6CA 1WY2A 2BWYA 2GGCA 4R60A 3TAVA 1WL6A 1YW9A 4FO8A 2B3HA 3PKCA 4RZZA 4S2RP 2B3KA 3FMRA 2GG0A 3IU9A 2Q8KA 2Q95A 2EVOA 4IKSA 5CDEA 4U1BA 2BH3A 4ZWOA 4U69A 3BIQA 1PV9A 1BOAA 5FCHA 3MATA 2ZSGA 3FMQA 4IECA 3PKEA 1XGOA 5JI6A 4S01A 1B59A 2V3YA 4B28A 1YW8A 2GTXA 1B6AA 4U6WA 4ZWUA 3BITA 3CB5A 2BB7A 4ZNGA 2GU4A 5CDLA 4KM3A 2V3ZA 4IF7A 1KQ0A 4FUKA 1WN1A 2NQ6A 4A6WA 1YW7A 4MATA 1YJ3A 1WKMA 3CB6A 4FLIA 1R58A 4FO7A 2HOWA 4EGEA 2Q96A 3TB5A 4IKUA 1Y1NA 4S00A 5JFRA 4S2TP 4RGZ1 2Q92A 1KP0A 2GU7A 1QXZA 1CHMA 2GG7A 2GG3A 1WL9A 4FLKA 3IU8A 3RORA 3IG4A 4U76A 5CDVA 5CE6A 4U71A 4U6JA 1XNZA 4PNCA 3MX6A 2GU6A 1N51A 4ZWPA 4U75A 1QXWA 2GGBA 5E5BA 2EVCA 1C21A 4IKTA 2B3LA 2GZ5A 3BIPA 1WBQA 2BHBA 2BN7A 4PV4A 2P99A 3S6BA 2GG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTZ A;  2BWV A;  5D6E A;  1C23 A;  2BHA A;  2P98 A;  2EA2 A;  1R5H A;  2BWW A;  2GA2 A;  4HXX A;  2EA4 A;  4IDY A;  2GG5 A;  2Q93 A;  4U73 A;  1MAT A;  3Q6D A;  1C27 A;  2GG9 A;  5D6F A;  2BWX A;  4FKC A;  1A16 A;  4Z7M A;  4U70 A;  2BWS A;  3PKA A;  4RZY A;  1C22 A;  1W7V A;  3MR1 A;  3D27 A;  1C24 A;  1XGM A;  1R5G A;  2NQ7 A;  2Q94 A;  4IU6 A;  5FCF A;  4JUQ A;  2G6P A;  2ADU A;  2MAT A;  1QZY A;  1XGN A;  2BWT A;  2OAZ A;  3L7G A;  1XGS A;  4QR8 A;  3RVA A;  2V6C A;  3IU7 A;  2BHC A;  1W2M A;  1KQ9 A;  2BHD A;  3PKB A;  1WLR A;  2BWU A;  4U6E A;  2GU5 A;  2OKN A;  2EVM A;  4IKR A;  5CIK A;  2V3X A;  5CLS A;  1O0X A;  4OOK A;  5CNX A;  2IW2 A;  3PKD A;  4FLJ A;  1BN5 A;  4U6Z A;  2P9A A;  3L24 A;  4FLL A;  2GG8 A;  1M35 A;  5JHU A;  2DFI A;  4IPA A;  3FM3 A;  4A6V A;  1QXY A;  1JAW A;  1YVM A;  4U6C A;  1WY2 A;  2BWY A;  2GGC A;  4R60 A;  3TAV A;  1WL6 A;  1YW9 A;  4FO8 A;  2B3H A;  3PKC A;  4RZZ A;  4S2R P;  2B3K A;  3FMR A;  2GG0 A;  3IU9 A;  2Q8K A;  2Q95 A;  2EVO A;  4IKS A;  5CDE A;  4U1B A;  2BH3 A;  4ZWO A;  4U69 A;  3BIQ A;  1PV9 A;  1BOA A;  5FCH A;  3MAT A;  2ZSG A;  3FMQ A;  4IEC A;  3PKE A;  1XGO A;  5JI6 A;  4S01 A;  1B59 A;  2V3Y A;  4B28 A;  1YW8 A;  2GTX A;  1B6A A;  4U6W A;  4ZWU A;  3BIT A;  3CB5 A;  2BB7 A;  4ZNG A;  2GU4 A;  5CDL A;  4KM3 A;  2V3Z A;  4IF7 A;  1KQ0 A;  4FUK A;  1WN1 A;  2NQ6 A;  4A6W A;  1YW7 A;  4MAT A;  1YJ3 A;  1WKM A;  3CB6 A;  4FLI A;  1R58 A;  4FO7 A;  2HOW A;  4EGE A;  2Q96 A;  3TB5 A;  4IKU A;  1Y1N A;  4S00 A;  5JFR A;  4S2T P;  4RGZ 1;  2Q92 A;  1KP0 A;  2GU7 A;  1QXZ A;  1CHM A;  2GG7 A;  2GG3 A;  1WL9 A;  4FLK A;  3IU8 A;  3ROR A;  3IG4 A;  4U76 A;  5CDV A;  5CE6 A;  4U71 A;  4U6J A;  1XNZ A;  4PNC A;  3MX6 A;  2GU6 A;  1N51 A;  4ZWP A;  4U75 A;  1QXW A;  2GGB A;  5E5B A;  2EVC A;  1C21 A;  4IKT A;  2B3L A;  2GZ5 A;  3BIP A;  1WBQ A;  2BHB A;  2BN7 A;  4PV4 A;  2P99 A;  3S6B A;  2GG2 A; 
#chains in the Genus database with same CATH topology
 3CTZ A;  2BWV A;  5D6E A;  1C23 A;  2BHA A;  2P98 A;  2EA2 A;  1R5H A;  2BWW A;  2GA2 A;  4HXX A;  2EA4 A;  4IDY A;  2GG5 A;  2Q93 A;  4U73 A;  1MAT A;  3Q6D A;  1C27 A;  2GG9 A;  5D6F A;  2BWX A;  4FKC A;  1A16 A;  4Z7M A;  4U70 A;  2BWS A;  3PKA A;  4RZY A;  1C22 A;  1W7V A;  3MR1 A;  3D27 A;  1C24 A;  1XGM A;  1R5G A;  2NQ7 A;  2Q94 A;  4IU6 A;  5FCF A;  4JUQ A;  2G6P A;  2ADU A;  2MAT A;  1QZY A;  1XGN A;  2BWT A;  2OAZ A;  3L7G A;  1XGS A;  4QR8 A;  3RVA A;  2V6C A;  3IU7 A;  2BHC A;  1W2M A;  1KQ9 A;  2BHD A;  3PKB A;  1WLR A;  2BWU A;  4U6E A;  2GU5 A;  2OKN A;  2EVM A;  4IKR A;  5CIK A;  2V3X A;  5CLS A;  1O0X A;  4OOK A;  5CNX A;  2IW2 A;  3PKD A;  4FLJ A;  1BN5 A;  4U6Z A;  2P9A A;  3L24 A;  4FLL A;  2GG8 A;  1M35 A;  5JHU A;  2DFI A;  4IPA A;  3FM3 A;  4A6V A;  1QXY A;  1JAW A;  1YVM A;  4U6C A;  1WY2 A;  2BWY A;  2GGC A;  4R60 A;  3TAV A;  1WL6 A;  1YW9 A;  4FO8 A;  2B3H A;  3PKC A;  4RZZ A;  4S2R P;  2B3K A;  3FMR A;  2GG0 A;  3IU9 A;  2Q8K A;  2Q95 A;  2EVO A;  4IKS A;  5CDE A;  4U1B A;  2BH3 A;  4ZWO A;  4U69 A;  3BIQ A;  1PV9 A;  1BOA A;  5FCH A;  3MAT A;  2ZSG A;  3FMQ A;  4IEC A;  3PKE A;  1XGO A;  5JI6 A;  4S01 A;  1B59 A;  2V3Y A;  4B28 A;  1YW8 A;  2GTX A;  1B6A A;  4U6W A;  4ZWU A;  3BIT A;  3CB5 A;  2BB7 A;  4ZNG A;  2GU4 A;  5CDL A;  4KM3 A;  2V3Z A;  4IF7 A;  1KQ0 A;  4FUK A;  1WN1 A;  2NQ6 A;  4A6W A;  1YW7 A;  4MAT A;  1YJ3 A;  1WKM A;  3CB6 A;  4FLI A;  1R58 A;  4FO7 A;  2HOW A;  4EGE A;  2Q96 A;  3TB5 A;  4IKU A;  1Y1N A;  4S00 A;  5JFR A;  4S2T P;  4RGZ 1;  2Q92 A;  1KP0 A;  2GU7 A;  1QXZ A;  1CHM A;  2GG7 A;  2GG3 A;  1WL9 A;  4FLK A;  3IU8 A;  3ROR A;  3IG4 A;  4U76 A;  5CDV A;  5CE6 A;  4U71 A;  4U6J A;  1XNZ A;  4PNC A;  3MX6 A;  2GU6 A;  1N51 A;  4ZWP A;  4U75 A;  1QXW A;  2GGB A;  5E5B A;  2EVC A;  1C21 A;  4IKT A;  2B3L A;  2GZ5 A;  3BIP A;  1WBQ A;  2BHB A;  2BN7 A;  4PV4 A;  2P99 A;  3S6B A;  2GG2 A; 
#chains in the Genus database with same CATH homology
 3CTZ A;  2BWV A;  5D6E A;  1C23 A;  2BHA A;  2P98 A;  2EA2 A;  1R5H A;  2BWW A;  2GA2 A;  4HXX A;  2EA4 A;  4IDY A;  2GG5 A;  2Q93 A;  4U73 A;  1MAT A;  3Q6D A;  1C27 A;  2GG9 A;  5D6F A;  2BWX A;  4FKC A;  1A16 A;  4Z7M A;  4U70 A;  2BWS A;  3PKA A;  4RZY A;  1C22 A;  1W7V A;  3MR1 A;  3D27 A;  1C24 A;  1XGM A;  1R5G A;  2NQ7 A;  2Q94 A;  4IU6 A;  5FCF A;  4JUQ A;  2G6P A;  2ADU A;  2MAT A;  1QZY A;  1XGN A;  2BWT A;  2OAZ A;  3L7G A;  1XGS A;  4QR8 A;  3RVA A;  2V6C A;  3IU7 A;  2BHC A;  1W2M A;  1KQ9 A;  2BHD A;  3PKB A;  1WLR A;  2BWU A;  4U6E A;  2GU5 A;  2OKN A;  2EVM A;  4IKR A;  5CIK A;  2V3X A;  5CLS A;  1O0X A;  4OOK A;  5CNX A;  2IW2 A;  3PKD A;  4FLJ A;  1BN5 A;  4U6Z A;  2P9A A;  3L24 A;  4FLL A;  2GG8 A;  1M35 A;  5JHU A;  2DFI A;  4IPA A;  3FM3 A;  4A6V A;  1QXY A;  1JAW A;  1YVM A;  4U6C A;  1WY2 A;  2BWY A;  2GGC A;  4R60 A;  3TAV A;  1WL6 A;  1YW9 A;  4FO8 A;  2B3H A;  3PKC A;  4RZZ A;  4S2R P;  2B3K A;  3FMR A;  2GG0 A;  3IU9 A;  2Q8K A;  2Q95 A;  2EVO A;  4IKS A;  5CDE A;  4U1B A;  2BH3 A;  4ZWO A;  4U69 A;  3BIQ A;  1PV9 A;  1BOA A;  5FCH A;  3MAT A;  2ZSG A;  3FMQ A;  4IEC A;  3PKE A;  1XGO A;  5JI6 A;  4S01 A;  1B59 A;  2V3Y A;  4B28 A;  1YW8 A;  2GTX A;  1B6A A;  4U6W A;  4ZWU A;  3BIT A;  3CB5 A;  2BB7 A;  4ZNG A;  2GU4 A;  5CDL A;  4KM3 A;  2V3Z A;  4IF7 A;  1KQ0 A;  4FUK A;  1WN1 A;  2NQ6 A;  4A6W A;  1YW7 A;  4MAT A;  1YJ3 A;  1WKM A;  3CB6 A;  4FLI A;  1R58 A;  4FO7 A;  2HOW A;  4EGE A;  2Q96 A;  3TB5 A;  4IKU A;  1Y1N A;  4S00 A;  5JFR A;  4S2T P;  4RGZ 1;  2Q92 A;  1KP0 A;  2GU7 A;  1QXZ A;  1CHM A;  2GG7 A;  2GG3 A;  1WL9 A;  4FLK A;  3IU8 A;  3ROR A;  3IG4 A;  4U76 A;  5CDV A;  5CE6 A;  4U71 A;  4U6J A;  1XNZ A;  4PNC A;  3MX6 A;  2GU6 A;  1N51 A;  4ZWP A;  4U75 A;  1QXW A;  2GGB A;  5E5B A;  2EVC A;  1C21 A;  4IKT A;  2B3L A;  2GZ5 A;  3BIP A;  1WBQ A;  2BHB A;  2BN7 A;  4PV4 A;  2P99 A;  3S6B A;  2GG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...