2Q95A

E. coli methionine aminopeptidase mn-form with inhibitor a05
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q95A00
3L7GA 2GU7A 3MR1A 5CLSA 1B6AA 4IKTA 2BHAA 3PKEA 5E5BA 3L24A 4S2RP 1C22A 2GGCA 1JAWA 2G6PA 1PV9A 1KQ9A 3CB5A 5JHUA 2MATA 2EVCA 2GU6A 4RZYA 3PKDA 1QXYA 3RVAA 4PV4A 2BWVA 4U1BA 2BWXA 4U6WA 1Y1NA 2NQ7A 5D6EA 1XGNA 4PNCA 4S00A 3FMRA 2BWWA 1QXWA 2P98A 3BITA 3FM3A 3IU8A 1WL9A 1C24A 4B28A 2BHCA 2GG0A 2IW2A 3CB6A 2BWTA 2BWSA 3Q6DA 4A6VA 2BN7A 2GG7A 1BOAA 4OOKA 5CIKA 1O0XA 4FO7A 4IKUA 4FKCA 2GG3A 1XGMA 4A6WA 5D6FA 4ZWOA 2HOWA 4S01A 1M35A 1YJ3A 2B3HA 4MATA 2Q8KA 1WLRA 2BWUA 2V3XA 2EVOA 1R5HA 4RGZ1 1XGOA 5CDVA 1C21A 4U6ZA 1WKMA 4FLLA 1W2MA 2Q93A 1WY2A 4FLIA 2GU4A 5CDEA 2Q94A 1YVMA 3MX6A 2GG8A 3FMQA 4Z7MA 4QR8A 3CTZA 1KP0A 4R60A 4U75A 4ZWUA 1C23A 4RZZA 5FCFA 3S6BA 4U6EA 4IF7A 1WBQA 1XGSA 2BB7A 2GG2A 2V3ZA 1BN5A 1YW9A 2BHDA 2EA4A 4FLJA 1R58A 2BWYA 2P9AA 4FLKA 4IECA 4IDYA 3IU7A 4IPAA 5CE6A 2Q92A 4U73A 4U76A 2GA2A 2DFIA 4FUKA 3TB5A 3MATA 3IG4A 4U70A 2ADUA 2GU5A 3BIPA 4IU6A 4U6JA 4ZNGA 2GG5A 1A16A 2B3KA 3IU9A 3TAVA 5FCHA 3PKCA 1N51A 2GG9A 2OKNA 2Q95A 5JI6A 1YW7A 1C27A 3RORA 2BH3A 4S2TP 2GTXA 4FO8A 5JFRA 2OAZA 3PKBA 1QZYA 4U71A 2P99A 2BHBA 5CNXA 1R5GA 2GZ5A 4HXXA 1WN1A 2EA2A 1WL6A 5CDLA 3PKAA 1YW8A 2V3YA 1MATA 1QXZA 2NQ6A 4KM3A 4IKSA 2EVMA 2V6CA 2GGBA 4EGEA 1KQ0A 2Q96A 3D27A 1B59A 1XNZA 4ZWPA 1CHMA 1W7VA 4IKRA 4JUQA 2ZSGA 3BIQA 4U6CA 2B3LA 4U69A
chains in the Genus database with same CATH superfamily
3L7GA 2GU7A 3MR1A 5CLSA 1B6AA 4IKTA 2BHAA 3PKEA 5E5BA 3L24A 4S2RP 1C22A 2GGCA 1JAWA 2G6PA 1PV9A 1KQ9A 3CB5A 5JHUA 2MATA 2EVCA 2GU6A 4RZYA 3PKDA 1QXYA 3RVAA 4PV4A 2BWVA 4U1BA 2BWXA 4U6WA 1Y1NA 2NQ7A 5D6EA 1XGNA 4PNCA 4S00A 3FMRA 2BWWA 1QXWA 2P98A 3BITA 3FM3A 3IU8A 1WL9A 1C24A 4B28A 2BHCA 2GG0A 2IW2A 3CB6A 2BWTA 2BWSA 3Q6DA 4A6VA 2BN7A 2GG7A 1BOAA 4OOKA 5CIKA 1O0XA 4FO7A 4IKUA 4FKCA 2GG3A 1XGMA 4A6WA 5D6FA 4ZWOA 2HOWA 4S01A 1M35A 1YJ3A 2B3HA 4MATA 2Q8KA 1WLRA 2BWUA 2V3XA 2EVOA 1R5HA 4RGZ1 1XGOA 5CDVA 1C21A 4U6ZA 1WKMA 4FLLA 1W2MA 2Q93A 1WY2A 4FLIA 2GU4A 5CDEA 2Q94A 1YVMA 3MX6A 2GG8A 3FMQA 4Z7MA 4QR8A 3CTZA 1KP0A 4R60A 4U75A 4ZWUA 1C23A 4RZZA 5FCFA 3S6BA 4U6EA 4IF7A 1WBQA 1XGSA 2BB7A 2GG2A 2V3ZA 1BN5A 1YW9A 2BHDA 2EA4A 4FLJA 1R58A 2BWYA 2P9AA 4FLKA 4IECA 4IDYA 3IU7A 4IPAA 5CE6A 2Q92A 4U73A 4U76A 2GA2A 2DFIA 4FUKA 3TB5A 3MATA 3IG4A 4U70A 2ADUA 2GU5A 3BIPA 4IU6A 4U6JA 4ZNGA 2GG5A 1A16A 2B3KA 3IU9A 3TAVA 5FCHA 3PKCA 1N51A 2GG9A 2OKNA 2Q95A 5JI6A 1YW7A 1C27A 3RORA 2BH3A 4S2TP 2GTXA 4FO8A 5JFRA 2OAZA 3PKBA 1QZYA 4U71A 2P99A 2BHBA 5CNXA 1R5GA 2GZ5A 4HXXA 1WN1A 2EA2A 1WL6A 5CDLA 3PKAA 1YW8A 2V3YA 1MATA 1QXZA 2NQ6A 4KM3A 4IKSA 2EVMA 2V6CA 2GGBA 4EGEA 1KQ0A 2Q96A 3D27A 1B59A 1XNZA 4ZWPA 1CHMA 1W7VA 4IKRA 4JUQA 2ZSGA 3BIQA 4U6CA 2B3LA 4U69A
chains in the Genus database with same CATH topology
3L7GA 2GU7A 3MR1A 5CLSA 1B6AA 4IKTA 2BHAA 3PKEA 5E5BA 3L24A 4S2RP 1C22A 2GGCA 1JAWA 2G6PA 1PV9A 1KQ9A 3CB5A 5JHUA 2MATA 2EVCA 2GU6A 4RZYA 3PKDA 1QXYA 3RVAA 4PV4A 2BWVA 4U1BA 2BWXA 4U6WA 1Y1NA 2NQ7A 5D6EA 1XGNA 4PNCA 4S00A 3FMRA 2BWWA 1QXWA 2P98A 3BITA 3FM3A 3IU8A 1WL9A 1C24A 4B28A 2BHCA 2GG0A 2IW2A 3CB6A 2BWTA 2BWSA 3Q6DA 4A6VA 2BN7A 2GG7A 1BOAA 4OOKA 5CIKA 1O0XA 4FO7A 4IKUA 4FKCA 2GG3A 1XGMA 4A6WA 5D6FA 4ZWOA 2HOWA 4S01A 1M35A 1YJ3A 2B3HA 4MATA 2Q8KA 1WLRA 2BWUA 2V3XA 2EVOA 1R5HA 4RGZ1 1XGOA 5CDVA 1C21A 4U6ZA 1WKMA 4FLLA 1W2MA 2Q93A 1WY2A 4FLIA 2GU4A 5CDEA 2Q94A 1YVMA 3MX6A 2GG8A 3FMQA 4Z7MA 4QR8A 3CTZA 1KP0A 4R60A 4U75A 4ZWUA 1C23A 4RZZA 5FCFA 3S6BA 4U6EA 4IF7A 1WBQA 1XGSA 2BB7A 2GG2A 2V3ZA 1BN5A 1YW9A 2BHDA 2EA4A 4FLJA 1R58A 2BWYA 2P9AA 4FLKA 4IECA 4IDYA 3IU7A 4IPAA 5CE6A 2Q92A 4U73A 4U76A 2GA2A 2DFIA 4FUKA 3TB5A 3MATA 3IG4A 4U70A 2ADUA 2GU5A 3BIPA 4IU6A 4U6JA 4ZNGA 2GG5A 1A16A 2B3KA 3IU9A 3TAVA 5FCHA 3PKCA 1N51A 2GG9A 2OKNA 2Q95A 5JI6A 1YW7A 1C27A 3RORA 2BH3A 4S2TP 2GTXA 4FO8A 5JFRA 2OAZA 3PKBA 1QZYA 4U71A 2P99A 2BHBA 5CNXA 1R5GA 2GZ5A 4HXXA 1WN1A 2EA2A 1WL6A 5CDLA 3PKAA 1YW8A 2V3YA 1MATA 1QXZA 2NQ6A 4KM3A 4IKSA 2EVMA 2V6CA 2GGBA 4EGEA 1KQ0A 2Q96A 3D27A 1B59A 1XNZA 4ZWPA 1CHMA 1W7VA 4IKRA 4JUQA 2ZSGA 3BIQA 4U6CA 2B3LA 4U69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7G A;  2GU7 A;  3MR1 A;  5CLS A;  1B6A A;  4IKT A;  2BHA A;  3PKE A;  5E5B A;  3L24 A;  4S2R P;  1C22 A;  2GGC A;  1JAW A;  2G6P A;  1PV9 A;  1KQ9 A;  3CB5 A;  5JHU A;  2MAT A;  2EVC A;  2GU6 A;  4RZY A;  3PKD A;  1QXY A;  3RVA A;  4PV4 A;  2BWV A;  4U1B A;  2BWX A;  4U6W A;  1Y1N A;  2NQ7 A;  5D6E A;  1XGN A;  4PNC A;  4S00 A;  3FMR A;  2BWW A;  1QXW A;  2P98 A;  3BIT A;  3FM3 A;  3IU8 A;  1WL9 A;  1C24 A;  4B28 A;  2BHC A;  2GG0 A;  2IW2 A;  3CB6 A;  2BWT A;  2BWS A;  3Q6D A;  4A6V A;  2BN7 A;  2GG7 A;  1BOA A;  4OOK A;  5CIK A;  1O0X A;  4FO7 A;  4IKU A;  4FKC A;  2GG3 A;  1XGM A;  4A6W A;  5D6F A;  4ZWO A;  2HOW A;  4S01 A;  1M35 A;  1YJ3 A;  2B3H A;  4MAT A;  2Q8K A;  1WLR A;  2BWU A;  2V3X A;  2EVO A;  1R5H A;  4RGZ 1;  1XGO A;  5CDV A;  1C21 A;  4U6Z A;  1WKM A;  4FLL A;  1W2M A;  2Q93 A;  1WY2 A;  4FLI A;  2GU4 A;  5CDE A;  2Q94 A;  1YVM A;  3MX6 A;  2GG8 A;  3FMQ A;  4Z7M A;  4QR8 A;  3CTZ A;  1KP0 A;  4R60 A;  4U75 A;  4ZWU A;  1C23 A;  4RZZ A;  5FCF A;  3S6B A;  4U6E A;  4IF7 A;  1WBQ A;  1XGS A;  2BB7 A;  2GG2 A;  2V3Z A;  1BN5 A;  1YW9 A;  2BHD A;  2EA4 A;  4FLJ A;  1R58 A;  2BWY A;  2P9A A;  4FLK A;  4IEC A;  4IDY A;  3IU7 A;  4IPA A;  5CE6 A;  2Q92 A;  4U73 A;  4U76 A;  2GA2 A;  2DFI A;  4FUK A;  3TB5 A;  3MAT A;  3IG4 A;  4U70 A;  2ADU A;  2GU5 A;  3BIP A;  4IU6 A;  4U6J A;  4ZNG A;  2GG5 A;  1A16 A;  2B3K A;  3IU9 A;  3TAV A;  5FCH A;  3PKC A;  1N51 A;  2GG9 A;  2OKN A;  2Q95 A;  5JI6 A;  1YW7 A;  1C27 A;  3ROR A;  2BH3 A;  4S2T P;  2GTX A;  4FO8 A;  5JFR A;  2OAZ A;  3PKB A;  1QZY A;  4U71 A;  2P99 A;  2BHB A;  5CNX A;  1R5G A;  2GZ5 A;  4HXX A;  1WN1 A;  2EA2 A;  1WL6 A;  5CDL A;  3PKA A;  1YW8 A;  2V3Y A;  1MAT A;  1QXZ A;  2NQ6 A;  4KM3 A;  4IKS A;  2EVM A;  2V6C A;  2GGB A;  4EGE A;  1KQ0 A;  2Q96 A;  3D27 A;  1B59 A;  1XNZ A;  4ZWP A;  1CHM A;  1W7V A;  4IKR A;  4JUQ A;  2ZSG A;  3BIQ A;  4U6C A;  2B3L A;  4U69 A; 
#chains in the Genus database with same CATH topology
 3L7G A;  2GU7 A;  3MR1 A;  5CLS A;  1B6A A;  4IKT A;  2BHA A;  3PKE A;  5E5B A;  3L24 A;  4S2R P;  1C22 A;  2GGC A;  1JAW A;  2G6P A;  1PV9 A;  1KQ9 A;  3CB5 A;  5JHU A;  2MAT A;  2EVC A;  2GU6 A;  4RZY A;  3PKD A;  1QXY A;  3RVA A;  4PV4 A;  2BWV A;  4U1B A;  2BWX A;  4U6W A;  1Y1N A;  2NQ7 A;  5D6E A;  1XGN A;  4PNC A;  4S00 A;  3FMR A;  2BWW A;  1QXW A;  2P98 A;  3BIT A;  3FM3 A;  3IU8 A;  1WL9 A;  1C24 A;  4B28 A;  2BHC A;  2GG0 A;  2IW2 A;  3CB6 A;  2BWT A;  2BWS A;  3Q6D A;  4A6V A;  2BN7 A;  2GG7 A;  1BOA A;  4OOK A;  5CIK A;  1O0X A;  4FO7 A;  4IKU A;  4FKC A;  2GG3 A;  1XGM A;  4A6W A;  5D6F A;  4ZWO A;  2HOW A;  4S01 A;  1M35 A;  1YJ3 A;  2B3H A;  4MAT A;  2Q8K A;  1WLR A;  2BWU A;  2V3X A;  2EVO A;  1R5H A;  4RGZ 1;  1XGO A;  5CDV A;  1C21 A;  4U6Z A;  1WKM A;  4FLL A;  1W2M A;  2Q93 A;  1WY2 A;  4FLI A;  2GU4 A;  5CDE A;  2Q94 A;  1YVM A;  3MX6 A;  2GG8 A;  3FMQ A;  4Z7M A;  4QR8 A;  3CTZ A;  1KP0 A;  4R60 A;  4U75 A;  4ZWU A;  1C23 A;  4RZZ A;  5FCF A;  3S6B A;  4U6E A;  4IF7 A;  1WBQ A;  1XGS A;  2BB7 A;  2GG2 A;  2V3Z A;  1BN5 A;  1YW9 A;  2BHD A;  2EA4 A;  4FLJ A;  1R58 A;  2BWY A;  2P9A A;  4FLK A;  4IEC A;  4IDY A;  3IU7 A;  4IPA A;  5CE6 A;  2Q92 A;  4U73 A;  4U76 A;  2GA2 A;  2DFI A;  4FUK A;  3TB5 A;  3MAT A;  3IG4 A;  4U70 A;  2ADU A;  2GU5 A;  3BIP A;  4IU6 A;  4U6J A;  4ZNG A;  2GG5 A;  1A16 A;  2B3K A;  3IU9 A;  3TAV A;  5FCH A;  3PKC A;  1N51 A;  2GG9 A;  2OKN A;  2Q95 A;  5JI6 A;  1YW7 A;  1C27 A;  3ROR A;  2BH3 A;  4S2T P;  2GTX A;  4FO8 A;  5JFR A;  2OAZ A;  3PKB A;  1QZY A;  4U71 A;  2P99 A;  2BHB A;  5CNX A;  1R5G A;  2GZ5 A;  4HXX A;  1WN1 A;  2EA2 A;  1WL6 A;  5CDL A;  3PKA A;  1YW8 A;  2V3Y A;  1MAT A;  1QXZ A;  2NQ6 A;  4KM3 A;  4IKS A;  2EVM A;  2V6C A;  2GGB A;  4EGE A;  1KQ0 A;  2Q96 A;  3D27 A;  1B59 A;  1XNZ A;  4ZWP A;  1CHM A;  1W7V A;  4IKR A;  4JUQ A;  2ZSG A;  3BIQ A;  4U6C A;  2B3L A;  4U69 A; 
#chains in the Genus database with same CATH homology
 3L7G A;  2GU7 A;  3MR1 A;  5CLS A;  1B6A A;  4IKT A;  2BHA A;  3PKE A;  5E5B A;  3L24 A;  4S2R P;  1C22 A;  2GGC A;  1JAW A;  2G6P A;  1PV9 A;  1KQ9 A;  3CB5 A;  5JHU A;  2MAT A;  2EVC A;  2GU6 A;  4RZY A;  3PKD A;  1QXY A;  3RVA A;  4PV4 A;  2BWV A;  4U1B A;  2BWX A;  4U6W A;  1Y1N A;  2NQ7 A;  5D6E A;  1XGN A;  4PNC A;  4S00 A;  3FMR A;  2BWW A;  1QXW A;  2P98 A;  3BIT A;  3FM3 A;  3IU8 A;  1WL9 A;  1C24 A;  4B28 A;  2BHC A;  2GG0 A;  2IW2 A;  3CB6 A;  2BWT A;  2BWS A;  3Q6D A;  4A6V A;  2BN7 A;  2GG7 A;  1BOA A;  4OOK A;  5CIK A;  1O0X A;  4FO7 A;  4IKU A;  4FKC A;  2GG3 A;  1XGM A;  4A6W A;  5D6F A;  4ZWO A;  2HOW A;  4S01 A;  1M35 A;  1YJ3 A;  2B3H A;  4MAT A;  2Q8K A;  1WLR A;  2BWU A;  2V3X A;  2EVO A;  1R5H A;  4RGZ 1;  1XGO A;  5CDV A;  1C21 A;  4U6Z A;  1WKM A;  4FLL A;  1W2M A;  2Q93 A;  1WY2 A;  4FLI A;  2GU4 A;  5CDE A;  2Q94 A;  1YVM A;  3MX6 A;  2GG8 A;  3FMQ A;  4Z7M A;  4QR8 A;  3CTZ A;  1KP0 A;  4R60 A;  4U75 A;  4ZWU A;  1C23 A;  4RZZ A;  5FCF A;  3S6B A;  4U6E A;  4IF7 A;  1WBQ A;  1XGS A;  2BB7 A;  2GG2 A;  2V3Z A;  1BN5 A;  1YW9 A;  2BHD A;  2EA4 A;  4FLJ A;  1R58 A;  2BWY A;  2P9A A;  4FLK A;  4IEC A;  4IDY A;  3IU7 A;  4IPA A;  5CE6 A;  2Q92 A;  4U73 A;  4U76 A;  2GA2 A;  2DFI A;  4FUK A;  3TB5 A;  3MAT A;  3IG4 A;  4U70 A;  2ADU A;  2GU5 A;  3BIP A;  4IU6 A;  4U6J A;  4ZNG A;  2GG5 A;  1A16 A;  2B3K A;  3IU9 A;  3TAV A;  5FCH A;  3PKC A;  1N51 A;  2GG9 A;  2OKN A;  2Q95 A;  5JI6 A;  1YW7 A;  1C27 A;  3ROR A;  2BH3 A;  4S2T P;  2GTX A;  4FO8 A;  5JFR A;  2OAZ A;  3PKB A;  1QZY A;  4U71 A;  2P99 A;  2BHB A;  5CNX A;  1R5G A;  2GZ5 A;  4HXX A;  1WN1 A;  2EA2 A;  1WL6 A;  5CDL A;  3PKA A;  1YW8 A;  2V3Y A;  1MAT A;  1QXZ A;  2NQ6 A;  4KM3 A;  4IKS A;  2EVM A;  2V6C A;  2GGB A;  4EGE A;  1KQ0 A;  2Q96 A;  3D27 A;  1B59 A;  1XNZ A;  4ZWP A;  1CHM A;  1W7V A;  4IKR A;  4JUQ A;  2ZSG A;  3BIQ A;  4U6C A;  2B3L A;  4U69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...