2Q95A

E. coli methionine aminopeptidase mn-form with inhibitor a05
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of inhibition of E. coli methionine aminopeptidase: implication of loop flexibility in selective inhibition of bacterial enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2q95A00
5CDLA 2GG0A 3BIQA 4FLJA 1JAWA 2NQ7A 2GG3A 3PKEA 1KQ0A 2ZSGA 1O0XA 2Q92A 1WL6A 1YW7A 4U6EA 5JFRA 4RZZA 1Y1NA 2BWTA 3BIPA 1B6AA 2GTXA 3MX6A 4IU6A 4PV4A 4ZWUA 2EVCA 1QXYA 2DFIA 5D6EA 4FLKA 4RZYA 3CB5A 2Q96A 1CHMA 3TAVA 2BWVA 4IF7A 2EVMA 2P98A 2V3XA 2GGBA 4IKTA 5E5BA 2ADUA 4ZWOA 1C23A 2GG7A 4S01A 2BHAA 1WY2A 2OAZA 4FO7A 2EVOA 1WLRA 1XGOA 4ZNGA 2BWXA 3Q6DA 1WN1A 3IG4A 2V6CA 4IECA 4U75A 4A6WA 1R58A 5CDEA 2IW2A 4U70A 3PKDA 2GG8A 2GU6A 1C22A 1WBQA 3IU7A 1YJ3A 4U6WA 2P9AA 4B28A 2GU4A 1N51A 1WKMA 1BOAA 4U6ZA 3CB6A 2V3YA 4OOKA 4S2RP 5CLSA 5CNXA 3FMQA 4HXXA 1KQ9A 2GU5A 2GG9A 2EA4A 2BWWA 3D27A 4PNCA 4U69A 1XNZA 2BHCA 1XGMA 2Q93A 4FKCA 2B3KA 4S00A 2B3HA 2GG5A 2HOWA 2Q94A 4U6JA 5FCFA 3RORA 4KM3A 1YW8A 4U73A 3TB5A 1R5HA 4JUQA 4IKUA 4A6VA 3L24A 2BWUA 1MATA 2OKNA 2BN7A 4R60A 3L7GA 4S2TP 1WL9A 5FCHA 2BWYA 1PV9A 2G6PA 1B59A 2GG2A 3PKCA 3CTZA 4U76A 2BWSA 1YVMA 4U71A 4EGEA 1QZYA 1C27A 2BHBA 1W2MA 3MATA 1R5GA 1M35A 4RGZ1 4IKRA 4QR8A 2GZ5A 3IU8A 4FLLA 4FLIA 4U1BA 3PKBA 4IKSA 1QXWA 2V3ZA 4IPAA 4Z7MA 2P99A 2Q8KA 3MR1A 3RVAA 2GU7A 1KP0A 2NQ6A 4MATA 5CIKA 2GA2A 1XGNA 4U6CA 2Q95A 1C21A 1BN5A 1YW9A 2BH3A 2EA2A 1W7VA 2GGCA 4FO8A 5JI6A 3FMRA 2B3LA 3PKAA 2BB7A 2BHDA 3IU9A 1C24A 4FUKA 5D6FA 1XGSA 4ZWPA 4IDYA 1A16A 3BITA 5CDVA 1QXZA 5CE6A 3S6BA 5JHUA 3FM3A 2MATA
chains in the Genus database with same CATH superfamily
5CDLA 2GG0A 3BIQA 4FLJA 1JAWA 2NQ7A 2GG3A 3PKEA 1KQ0A 2ZSGA 1O0XA 2Q92A 1WL6A 1YW7A 4U6EA 5JFRA 4RZZA 1Y1NA 2BWTA 3BIPA 1B6AA 2GTXA 3MX6A 4IU6A 4PV4A 4ZWUA 2EVCA 1QXYA 2DFIA 5D6EA 4FLKA 4RZYA 3CB5A 2Q96A 1CHMA 3TAVA 2BWVA 4IF7A 2EVMA 2P98A 2V3XA 2GGBA 4IKTA 5E5BA 2ADUA 4ZWOA 1C23A 2GG7A 4S01A 2BHAA 1WY2A 2OAZA 4FO7A 2EVOA 1WLRA 1XGOA 4ZNGA 2BWXA 3Q6DA 1WN1A 3IG4A 2V6CA 4IECA 4U75A 4A6WA 1R58A 5CDEA 2IW2A 4U70A 3PKDA 2GG8A 2GU6A 1C22A 1WBQA 3IU7A 1YJ3A 4U6WA 2P9AA 4B28A 2GU4A 1N51A 1WKMA 1BOAA 4U6ZA 3CB6A 2V3YA 4OOKA 4S2RP 5CLSA 5CNXA 3FMQA 4HXXA 1KQ9A 2GU5A 2GG9A 2EA4A 2BWWA 3D27A 4PNCA 4U69A 1XNZA 2BHCA 1XGMA 2Q93A 4FKCA 2B3KA 4S00A 2B3HA 2GG5A 2HOWA 2Q94A 4U6JA 5FCFA 3RORA 4KM3A 1YW8A 4U73A 3TB5A 1R5HA 4JUQA 4IKUA 4A6VA 3L24A 2BWUA 1MATA 2OKNA 2BN7A 4R60A 3L7GA 4S2TP 1WL9A 5FCHA 2BWYA 1PV9A 2G6PA 1B59A 2GG2A 3PKCA 3CTZA 4U76A 2BWSA 1YVMA 4U71A 4EGEA 1QZYA 1C27A 2BHBA 1W2MA 3MATA 1R5GA 1M35A 4RGZ1 4IKRA 4QR8A 2GZ5A 3IU8A 4FLLA 4FLIA 4U1BA 3PKBA 4IKSA 1QXWA 2V3ZA 4IPAA 4Z7MA 2P99A 2Q8KA 3MR1A 3RVAA 2GU7A 1KP0A 2NQ6A 4MATA 5CIKA 2GA2A 1XGNA 4U6CA 2Q95A 1C21A 1BN5A 1YW9A 2BH3A 2EA2A 1W7VA 2GGCA 4FO8A 5JI6A 3FMRA 2B3LA 3PKAA 2BB7A 2BHDA 3IU9A 1C24A 4FUKA 5D6FA 1XGSA 4ZWPA 4IDYA 1A16A 3BITA 5CDVA 1QXZA 5CE6A 3S6BA 5JHUA 3FM3A 2MATA
chains in the Genus database with same CATH topology
5CDLA 2GG0A 3BIQA 4FLJA 1JAWA 2NQ7A 2GG3A 3PKEA 1KQ0A 2ZSGA 1O0XA 2Q92A 1WL6A 1YW7A 4U6EA 5JFRA 4RZZA 1Y1NA 2BWTA 3BIPA 1B6AA 2GTXA 3MX6A 4IU6A 4PV4A 4ZWUA 2EVCA 1QXYA 2DFIA 5D6EA 4FLKA 4RZYA 3CB5A 2Q96A 1CHMA 3TAVA 2BWVA 4IF7A 2EVMA 2P98A 2V3XA 2GGBA 4IKTA 5E5BA 2ADUA 4ZWOA 1C23A 2GG7A 4S01A 2BHAA 1WY2A 2OAZA 4FO7A 2EVOA 1WLRA 1XGOA 4ZNGA 2BWXA 3Q6DA 1WN1A 3IG4A 2V6CA 4IECA 4U75A 4A6WA 1R58A 5CDEA 2IW2A 4U70A 3PKDA 2GG8A 2GU6A 1C22A 1WBQA 3IU7A 1YJ3A 4U6WA 2P9AA 4B28A 2GU4A 1N51A 1WKMA 1BOAA 4U6ZA 3CB6A 2V3YA 4OOKA 4S2RP 5CLSA 5CNXA 3FMQA 4HXXA 1KQ9A 2GU5A 2GG9A 2EA4A 2BWWA 3D27A 4PNCA 4U69A 1XNZA 2BHCA 1XGMA 2Q93A 4FKCA 2B3KA 4S00A 2B3HA 2GG5A 2HOWA 2Q94A 4U6JA 5FCFA 3RORA 4KM3A 1YW8A 4U73A 3TB5A 1R5HA 4JUQA 4IKUA 4A6VA 3L24A 2BWUA 1MATA 2OKNA 2BN7A 4R60A 3L7GA 4S2TP 1WL9A 5FCHA 2BWYA 1PV9A 2G6PA 1B59A 2GG2A 3PKCA 3CTZA 4U76A 2BWSA 1YVMA 4U71A 4EGEA 1QZYA 1C27A 2BHBA 1W2MA 3MATA 1R5GA 1M35A 4RGZ1 4IKRA 4QR8A 2GZ5A 3IU8A 4FLLA 4FLIA 4U1BA 3PKBA 4IKSA 1QXWA 2V3ZA 4IPAA 4Z7MA 2P99A 2Q8KA 3MR1A 3RVAA 2GU7A 1KP0A 2NQ6A 4MATA 5CIKA 2GA2A 1XGNA 4U6CA 2Q95A 1C21A 1BN5A 1YW9A 2BH3A 2EA2A 1W7VA 2GGCA 4FO8A 5JI6A 3FMRA 2B3LA 3PKAA 2BB7A 2BHDA 3IU9A 1C24A 4FUKA 5D6FA 1XGSA 4ZWPA 4IDYA 1A16A 3BITA 5CDVA 1QXZA 5CE6A 3S6BA 5JHUA 3FM3A 2MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CDL A;  2GG0 A;  3BIQ A;  4FLJ A;  1JAW A;  2NQ7 A;  2GG3 A;  3PKE A;  1KQ0 A;  2ZSG A;  1O0X A;  2Q92 A;  1WL6 A;  1YW7 A;  4U6E A;  5JFR A;  4RZZ A;  1Y1N A;  2BWT A;  3BIP A;  1B6A A;  2GTX A;  3MX6 A;  4IU6 A;  4PV4 A;  4ZWU A;  2EVC A;  1QXY A;  2DFI A;  5D6E A;  4FLK A;  4RZY A;  3CB5 A;  2Q96 A;  1CHM A;  3TAV A;  2BWV A;  4IF7 A;  2EVM A;  2P98 A;  2V3X A;  2GGB A;  4IKT A;  5E5B A;  2ADU A;  4ZWO A;  1C23 A;  2GG7 A;  4S01 A;  2BHA A;  1WY2 A;  2OAZ A;  4FO7 A;  2EVO A;  1WLR A;  1XGO A;  4ZNG A;  2BWX A;  3Q6D A;  1WN1 A;  3IG4 A;  2V6C A;  4IEC A;  4U75 A;  4A6W A;  1R58 A;  5CDE A;  2IW2 A;  4U70 A;  3PKD A;  2GG8 A;  2GU6 A;  1C22 A;  1WBQ A;  3IU7 A;  1YJ3 A;  4U6W A;  2P9A A;  4B28 A;  2GU4 A;  1N51 A;  1WKM A;  1BOA A;  4U6Z A;  3CB6 A;  2V3Y A;  4OOK A;  4S2R P;  5CLS A;  5CNX A;  3FMQ A;  4HXX A;  1KQ9 A;  2GU5 A;  2GG9 A;  2EA4 A;  2BWW A;  3D27 A;  4PNC A;  4U69 A;  1XNZ A;  2BHC A;  1XGM A;  2Q93 A;  4FKC A;  2B3K A;  4S00 A;  2B3H A;  2GG5 A;  2HOW A;  2Q94 A;  4U6J A;  5FCF A;  3ROR A;  4KM3 A;  1YW8 A;  4U73 A;  3TB5 A;  1R5H A;  4JUQ A;  4IKU A;  4A6V A;  3L24 A;  2BWU A;  1MAT A;  2OKN A;  2BN7 A;  4R60 A;  3L7G A;  4S2T P;  1WL9 A;  5FCH A;  2BWY A;  1PV9 A;  2G6P A;  1B59 A;  2GG2 A;  3PKC A;  3CTZ A;  4U76 A;  2BWS A;  1YVM A;  4U71 A;  4EGE A;  1QZY A;  1C27 A;  2BHB A;  1W2M A;  3MAT A;  1R5G A;  1M35 A;  4RGZ 1;  4IKR A;  4QR8 A;  2GZ5 A;  3IU8 A;  4FLL A;  4FLI A;  4U1B A;  3PKB A;  4IKS A;  1QXW A;  2V3Z A;  4IPA A;  4Z7M A;  2P99 A;  2Q8K A;  3MR1 A;  3RVA A;  2GU7 A;  1KP0 A;  2NQ6 A;  4MAT A;  5CIK A;  2GA2 A;  1XGN A;  4U6C A;  2Q95 A;  1C21 A;  1BN5 A;  1YW9 A;  2BH3 A;  2EA2 A;  1W7V A;  2GGC A;  4FO8 A;  5JI6 A;  3FMR A;  2B3L A;  3PKA A;  2BB7 A;  2BHD A;  3IU9 A;  1C24 A;  4FUK A;  5D6F A;  1XGS A;  4ZWP A;  4IDY A;  1A16 A;  3BIT A;  5CDV A;  1QXZ A;  5CE6 A;  3S6B A;  5JHU A;  3FM3 A;  2MAT A; 
#chains in the Genus database with same CATH topology
 5CDL A;  2GG0 A;  3BIQ A;  4FLJ A;  1JAW A;  2NQ7 A;  2GG3 A;  3PKE A;  1KQ0 A;  2ZSG A;  1O0X A;  2Q92 A;  1WL6 A;  1YW7 A;  4U6E A;  5JFR A;  4RZZ A;  1Y1N A;  2BWT A;  3BIP A;  1B6A A;  2GTX A;  3MX6 A;  4IU6 A;  4PV4 A;  4ZWU A;  2EVC A;  1QXY A;  2DFI A;  5D6E A;  4FLK A;  4RZY A;  3CB5 A;  2Q96 A;  1CHM A;  3TAV A;  2BWV A;  4IF7 A;  2EVM A;  2P98 A;  2V3X A;  2GGB A;  4IKT A;  5E5B A;  2ADU A;  4ZWO A;  1C23 A;  2GG7 A;  4S01 A;  2BHA A;  1WY2 A;  2OAZ A;  4FO7 A;  2EVO A;  1WLR A;  1XGO A;  4ZNG A;  2BWX A;  3Q6D A;  1WN1 A;  3IG4 A;  2V6C A;  4IEC A;  4U75 A;  4A6W A;  1R58 A;  5CDE A;  2IW2 A;  4U70 A;  3PKD A;  2GG8 A;  2GU6 A;  1C22 A;  1WBQ A;  3IU7 A;  1YJ3 A;  4U6W A;  2P9A A;  4B28 A;  2GU4 A;  1N51 A;  1WKM A;  1BOA A;  4U6Z A;  3CB6 A;  2V3Y A;  4OOK A;  4S2R P;  5CLS A;  5CNX A;  3FMQ A;  4HXX A;  1KQ9 A;  2GU5 A;  2GG9 A;  2EA4 A;  2BWW A;  3D27 A;  4PNC A;  4U69 A;  1XNZ A;  2BHC A;  1XGM A;  2Q93 A;  4FKC A;  2B3K A;  4S00 A;  2B3H A;  2GG5 A;  2HOW A;  2Q94 A;  4U6J A;  5FCF A;  3ROR A;  4KM3 A;  1YW8 A;  4U73 A;  3TB5 A;  1R5H A;  4JUQ A;  4IKU A;  4A6V A;  3L24 A;  2BWU A;  1MAT A;  2OKN A;  2BN7 A;  4R60 A;  3L7G A;  4S2T P;  1WL9 A;  5FCH A;  2BWY A;  1PV9 A;  2G6P A;  1B59 A;  2GG2 A;  3PKC A;  3CTZ A;  4U76 A;  2BWS A;  1YVM A;  4U71 A;  4EGE A;  1QZY A;  1C27 A;  2BHB A;  1W2M A;  3MAT A;  1R5G A;  1M35 A;  4RGZ 1;  4IKR A;  4QR8 A;  2GZ5 A;  3IU8 A;  4FLL A;  4FLI A;  4U1B A;  3PKB A;  4IKS A;  1QXW A;  2V3Z A;  4IPA A;  4Z7M A;  2P99 A;  2Q8K A;  3MR1 A;  3RVA A;  2GU7 A;  1KP0 A;  2NQ6 A;  4MAT A;  5CIK A;  2GA2 A;  1XGN A;  4U6C A;  2Q95 A;  1C21 A;  1BN5 A;  1YW9 A;  2BH3 A;  2EA2 A;  1W7V A;  2GGC A;  4FO8 A;  5JI6 A;  3FMR A;  2B3L A;  3PKA A;  2BB7 A;  2BHD A;  3IU9 A;  1C24 A;  4FUK A;  5D6F A;  1XGS A;  4ZWP A;  4IDY A;  1A16 A;  3BIT A;  5CDV A;  1QXZ A;  5CE6 A;  3S6B A;  5JHU A;  3FM3 A;  2MAT A; 
#chains in the Genus database with same CATH homology
 5CDL A;  2GG0 A;  3BIQ A;  4FLJ A;  1JAW A;  2NQ7 A;  2GG3 A;  3PKE A;  1KQ0 A;  2ZSG A;  1O0X A;  2Q92 A;  1WL6 A;  1YW7 A;  4U6E A;  5JFR A;  4RZZ A;  1Y1N A;  2BWT A;  3BIP A;  1B6A A;  2GTX A;  3MX6 A;  4IU6 A;  4PV4 A;  4ZWU A;  2EVC A;  1QXY A;  2DFI A;  5D6E A;  4FLK A;  4RZY A;  3CB5 A;  2Q96 A;  1CHM A;  3TAV A;  2BWV A;  4IF7 A;  2EVM A;  2P98 A;  2V3X A;  2GGB A;  4IKT A;  5E5B A;  2ADU A;  4ZWO A;  1C23 A;  2GG7 A;  4S01 A;  2BHA A;  1WY2 A;  2OAZ A;  4FO7 A;  2EVO A;  1WLR A;  1XGO A;  4ZNG A;  2BWX A;  3Q6D A;  1WN1 A;  3IG4 A;  2V6C A;  4IEC A;  4U75 A;  4A6W A;  1R58 A;  5CDE A;  2IW2 A;  4U70 A;  3PKD A;  2GG8 A;  2GU6 A;  1C22 A;  1WBQ A;  3IU7 A;  1YJ3 A;  4U6W A;  2P9A A;  4B28 A;  2GU4 A;  1N51 A;  1WKM A;  1BOA A;  4U6Z A;  3CB6 A;  2V3Y A;  4OOK A;  4S2R P;  5CLS A;  5CNX A;  3FMQ A;  4HXX A;  1KQ9 A;  2GU5 A;  2GG9 A;  2EA4 A;  2BWW A;  3D27 A;  4PNC A;  4U69 A;  1XNZ A;  2BHC A;  1XGM A;  2Q93 A;  4FKC A;  2B3K A;  4S00 A;  2B3H A;  2GG5 A;  2HOW A;  2Q94 A;  4U6J A;  5FCF A;  3ROR A;  4KM3 A;  1YW8 A;  4U73 A;  3TB5 A;  1R5H A;  4JUQ A;  4IKU A;  4A6V A;  3L24 A;  2BWU A;  1MAT A;  2OKN A;  2BN7 A;  4R60 A;  3L7G A;  4S2T P;  1WL9 A;  5FCH A;  2BWY A;  1PV9 A;  2G6P A;  1B59 A;  2GG2 A;  3PKC A;  3CTZ A;  4U76 A;  2BWS A;  1YVM A;  4U71 A;  4EGE A;  1QZY A;  1C27 A;  2BHB A;  1W2M A;  3MAT A;  1R5G A;  1M35 A;  4RGZ 1;  4IKR A;  4QR8 A;  2GZ5 A;  3IU8 A;  4FLL A;  4FLI A;  4U1B A;  3PKB A;  4IKS A;  1QXW A;  2V3Z A;  4IPA A;  4Z7M A;  2P99 A;  2Q8K A;  3MR1 A;  3RVA A;  2GU7 A;  1KP0 A;  2NQ6 A;  4MAT A;  5CIK A;  2GA2 A;  1XGN A;  4U6C A;  2Q95 A;  1C21 A;  1BN5 A;  1YW9 A;  2BH3 A;  2EA2 A;  1W7V A;  2GGC A;  4FO8 A;  5JI6 A;  3FMR A;  2B3L A;  3PKA A;  2BB7 A;  2BHD A;  3IU9 A;  1C24 A;  4FUK A;  5D6F A;  1XGS A;  4ZWP A;  4IDY A;  1A16 A;  3BIT A;  5CDV A;  1QXZ A;  5CE6 A;  3S6B A;  5JHU A;  3FM3 A;  2MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...