1QXYA

Crystal structure of s. aureus methionine aminopeptidase in complex with a ketoheterocycle 618
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methionyl aminopeptidase
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 81
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxyA00
2GG2A 1N51A 1YW9A 2BB7A 2GTXA 3MR1A 2GG7A 1XNZA 1PV9A 1R5GA 4U76A 5CDLA 4IDYA 5JFRA 1YW8A 5CDEA 1W2MA 2B3LA 2OKNA 4FO7A 1BN5A 3CB5A 1A16A 4IECA 4IKRA 4ZNGA 5JHUA 1M35A 4U1BA 2IW2A 2EVOA 2Q92A 4FLIA 2EA2A 4R60A 1KQ0A 1JAWA 2BWVA 2OAZA 4HXXA 2NQ7A 2BHDA 3FMQA 3BIPA 4MATA 2GU7A 2ZSGA 2V6CA 4RZYA 1C27A 1CHMA 4RGZ1 4U6WA 2ADUA 4U6EA 4A6VA 2BWSA 2BH3A 2V3ZA 5D6EA 4OOKA 4QR8A 2BWTA 2BHBA 4FUKA 1YW7A 3MX6A 5FCFA 2Q94A 4ZWPA 2BWYA 3TB5A 3PKCA 1YJ3A 1KQ9A 1C22A 3RORA 2P98A 2V3XA 3BITA 3IU9A 4S01A 2BWUA 4ZWOA 1QXZA 2GG8A 3IU7A 4U6JA 2GU4A 5FCHA 2EVCA 2GU5A 4IF7A 2BN7A 4FLKA 2DFIA 2B3KA 1QZYA 2GU6A 4FLJA 1WY2A 1QXWA 2GG9A 1B6AA 3TAVA 2P99A 4U6CA 2BHCA 1XGSA 4S00A 4IKUA 3MATA 4JUQA 4IU6A 4U73A 4U75A 1R58A 2EVMA 3IG4A 1R5HA 2V3YA 1XGNA 1Y1NA 4IKSA 5JI6A 3BIQA 4U71A 2GA2A 3L7GA 4EGEA 2GG5A 3CB6A 3PKAA 2GZ5A 4U6ZA 5CNXA 3L24A 5CDVA 4A6WA 2Q95A 3PKDA 4S2TP 1WKMA 1WL9A 4PNCA 1BOAA 1O0XA 1WBQA 3Q6DA 1WLRA 5CIKA 2GG3A 3D27A 5CE6A 2HOWA 2Q96A 3FMRA 4Z7MA 1C23A 1QXYA 3PKBA 4RZZA 2Q8KA 1WN1A 3RVAA 2GGBA 2P9AA 1MATA 4U70A 5CLSA 1W7VA 2GGCA 4ZWUA 4S2RP 5E5BA 2B3HA 5D6FA 3IU8A 2BHAA 1XGOA 3S6BA 2BWWA 1KP0A 3CTZA 4PV4A 2Q93A 3PKEA 1YVMA 4KM3A 4FO8A 2EA4A 4FLLA 1WL6A 1XGMA 4FKCA 4U69A 2MATA 1C21A 2BWXA 2GG0A 1B59A 4IPAA 4IKTA 2NQ6A 3FM3A 1C24A 2G6PA 4B28A
chains in the Genus database with same CATH superfamily
2GG2A 1N51A 1YW9A 2BB7A 2GTXA 3MR1A 2GG7A 1XNZA 1PV9A 1R5GA 4U76A 5CDLA 4IDYA 5JFRA 1YW8A 5CDEA 1W2MA 2B3LA 2OKNA 4FO7A 1BN5A 3CB5A 1A16A 4IECA 4IKRA 4ZNGA 5JHUA 1M35A 4U1BA 2IW2A 2EVOA 2Q92A 4FLIA 2EA2A 4R60A 1KQ0A 1JAWA 2BWVA 2OAZA 4HXXA 2NQ7A 2BHDA 3FMQA 3BIPA 4MATA 2GU7A 2ZSGA 2V6CA 4RZYA 1C27A 1CHMA 4RGZ1 4U6WA 2ADUA 4U6EA 4A6VA 2BWSA 2BH3A 2V3ZA 5D6EA 4OOKA 4QR8A 2BWTA 2BHBA 4FUKA 1YW7A 3MX6A 5FCFA 2Q94A 4ZWPA 2BWYA 3TB5A 3PKCA 1YJ3A 1KQ9A 1C22A 3RORA 2P98A 2V3XA 3BITA 3IU9A 4S01A 2BWUA 4ZWOA 1QXZA 2GG8A 3IU7A 4U6JA 2GU4A 5FCHA 2EVCA 2GU5A 4IF7A 2BN7A 4FLKA 2DFIA 2B3KA 1QZYA 2GU6A 4FLJA 1WY2A 1QXWA 2GG9A 1B6AA 3TAVA 2P99A 4U6CA 2BHCA 1XGSA 4S00A 4IKUA 3MATA 4JUQA 4IU6A 4U73A 4U75A 1R58A 2EVMA 3IG4A 1R5HA 2V3YA 1XGNA 1Y1NA 4IKSA 5JI6A 3BIQA 4U71A 2GA2A 3L7GA 4EGEA 2GG5A 3CB6A 3PKAA 2GZ5A 4U6ZA 5CNXA 3L24A 5CDVA 4A6WA 2Q95A 3PKDA 4S2TP 1WKMA 1WL9A 4PNCA 1BOAA 1O0XA 1WBQA 3Q6DA 1WLRA 5CIKA 2GG3A 3D27A 5CE6A 2HOWA 2Q96A 3FMRA 4Z7MA 1C23A 1QXYA 3PKBA 4RZZA 2Q8KA 1WN1A 3RVAA 2GGBA 2P9AA 1MATA 4U70A 5CLSA 1W7VA 2GGCA 4ZWUA 4S2RP 5E5BA 2B3HA 5D6FA 3IU8A 2BHAA 1XGOA 3S6BA 2BWWA 1KP0A 3CTZA 4PV4A 2Q93A 3PKEA 1YVMA 4KM3A 4FO8A 2EA4A 4FLLA 1WL6A 1XGMA 4FKCA 4U69A 2MATA 1C21A 2BWXA 2GG0A 1B59A 4IPAA 4IKTA 2NQ6A 3FM3A 1C24A 2G6PA 4B28A
chains in the Genus database with same CATH topology
2GG2A 1N51A 1YW9A 2BB7A 2GTXA 3MR1A 2GG7A 1XNZA 1PV9A 1R5GA 4U76A 5CDLA 4IDYA 5JFRA 1YW8A 5CDEA 1W2MA 2B3LA 2OKNA 4FO7A 1BN5A 3CB5A 1A16A 4IECA 4IKRA 4ZNGA 5JHUA 1M35A 4U1BA 2IW2A 2EVOA 2Q92A 4FLIA 2EA2A 4R60A 1KQ0A 1JAWA 2BWVA 2OAZA 4HXXA 2NQ7A 2BHDA 3FMQA 3BIPA 4MATA 2GU7A 2ZSGA 2V6CA 4RZYA 1C27A 1CHMA 4RGZ1 4U6WA 2ADUA 4U6EA 4A6VA 2BWSA 2BH3A 2V3ZA 5D6EA 4OOKA 4QR8A 2BWTA 2BHBA 4FUKA 1YW7A 3MX6A 5FCFA 2Q94A 4ZWPA 2BWYA 3TB5A 3PKCA 1YJ3A 1KQ9A 1C22A 3RORA 2P98A 2V3XA 3BITA 3IU9A 4S01A 2BWUA 4ZWOA 1QXZA 2GG8A 3IU7A 4U6JA 2GU4A 5FCHA 2EVCA 2GU5A 4IF7A 2BN7A 4FLKA 2DFIA 2B3KA 1QZYA 2GU6A 4FLJA 1WY2A 1QXWA 2GG9A 1B6AA 3TAVA 2P99A 4U6CA 2BHCA 1XGSA 4S00A 4IKUA 3MATA 4JUQA 4IU6A 4U73A 4U75A 1R58A 2EVMA 3IG4A 1R5HA 2V3YA 1XGNA 1Y1NA 4IKSA 5JI6A 3BIQA 4U71A 2GA2A 3L7GA 4EGEA 2GG5A 3CB6A 3PKAA 2GZ5A 4U6ZA 5CNXA 3L24A 5CDVA 4A6WA 2Q95A 3PKDA 4S2TP 1WKMA 1WL9A 4PNCA 1BOAA 1O0XA 1WBQA 3Q6DA 1WLRA 5CIKA 2GG3A 3D27A 5CE6A 2HOWA 2Q96A 3FMRA 4Z7MA 1C23A 1QXYA 3PKBA 4RZZA 2Q8KA 1WN1A 3RVAA 2GGBA 2P9AA 1MATA 4U70A 5CLSA 1W7VA 2GGCA 4ZWUA 4S2RP 5E5BA 2B3HA 5D6FA 3IU8A 2BHAA 1XGOA 3S6BA 2BWWA 1KP0A 3CTZA 4PV4A 2Q93A 3PKEA 1YVMA 4KM3A 4FO8A 2EA4A 4FLLA 1WL6A 1XGMA 4FKCA 4U69A 2MATA 1C21A 2BWXA 2GG0A 1B59A 4IPAA 4IKTA 2NQ6A 3FM3A 1C24A 2G6PA 4B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG2 A;  1N51 A;  1YW9 A;  2BB7 A;  2GTX A;  3MR1 A;  2GG7 A;  1XNZ A;  1PV9 A;  1R5G A;  4U76 A;  5CDL A;  4IDY A;  5JFR A;  1YW8 A;  5CDE A;  1W2M A;  2B3L A;  2OKN A;  4FO7 A;  1BN5 A;  3CB5 A;  1A16 A;  4IEC A;  4IKR A;  4ZNG A;  5JHU A;  1M35 A;  4U1B A;  2IW2 A;  2EVO A;  2Q92 A;  4FLI A;  2EA2 A;  4R60 A;  1KQ0 A;  1JAW A;  2BWV A;  2OAZ A;  4HXX A;  2NQ7 A;  2BHD A;  3FMQ A;  3BIP A;  4MAT A;  2GU7 A;  2ZSG A;  2V6C A;  4RZY A;  1C27 A;  1CHM A;  4RGZ 1;  4U6W A;  2ADU A;  4U6E A;  4A6V A;  2BWS A;  2BH3 A;  2V3Z A;  5D6E A;  4OOK A;  4QR8 A;  2BWT A;  2BHB A;  4FUK A;  1YW7 A;  3MX6 A;  5FCF A;  2Q94 A;  4ZWP A;  2BWY A;  3TB5 A;  3PKC A;  1YJ3 A;  1KQ9 A;  1C22 A;  3ROR A;  2P98 A;  2V3X A;  3BIT A;  3IU9 A;  4S01 A;  2BWU A;  4ZWO A;  1QXZ A;  2GG8 A;  3IU7 A;  4U6J A;  2GU4 A;  5FCH A;  2EVC A;  2GU5 A;  4IF7 A;  2BN7 A;  4FLK A;  2DFI A;  2B3K A;  1QZY A;  2GU6 A;  4FLJ A;  1WY2 A;  1QXW A;  2GG9 A;  1B6A A;  3TAV A;  2P99 A;  4U6C A;  2BHC A;  1XGS A;  4S00 A;  4IKU A;  3MAT A;  4JUQ A;  4IU6 A;  4U73 A;  4U75 A;  1R58 A;  2EVM A;  3IG4 A;  1R5H A;  2V3Y A;  1XGN A;  1Y1N A;  4IKS A;  5JI6 A;  3BIQ A;  4U71 A;  2GA2 A;  3L7G A;  4EGE A;  2GG5 A;  3CB6 A;  3PKA A;  2GZ5 A;  4U6Z A;  5CNX A;  3L24 A;  5CDV A;  4A6W A;  2Q95 A;  3PKD A;  4S2T P;  1WKM A;  1WL9 A;  4PNC A;  1BOA A;  1O0X A;  1WBQ A;  3Q6D A;  1WLR A;  5CIK A;  2GG3 A;  3D27 A;  5CE6 A;  2HOW A;  2Q96 A;  3FMR A;  4Z7M A;  1C23 A;  1QXY A;  3PKB A;  4RZZ A;  2Q8K A;  1WN1 A;  3RVA A;  2GGB A;  2P9A A;  1MAT A;  4U70 A;  5CLS A;  1W7V A;  2GGC A;  4ZWU A;  4S2R P;  5E5B A;  2B3H A;  5D6F A;  3IU8 A;  2BHA A;  1XGO A;  3S6B A;  2BWW A;  1KP0 A;  3CTZ A;  4PV4 A;  2Q93 A;  3PKE A;  1YVM A;  4KM3 A;  4FO8 A;  2EA4 A;  4FLL A;  1WL6 A;  1XGM A;  4FKC A;  4U69 A;  2MAT A;  1C21 A;  2BWX A;  2GG0 A;  1B59 A;  4IPA A;  4IKT A;  2NQ6 A;  3FM3 A;  1C24 A;  2G6P A;  4B28 A; 
#chains in the Genus database with same CATH topology
 2GG2 A;  1N51 A;  1YW9 A;  2BB7 A;  2GTX A;  3MR1 A;  2GG7 A;  1XNZ A;  1PV9 A;  1R5G A;  4U76 A;  5CDL A;  4IDY A;  5JFR A;  1YW8 A;  5CDE A;  1W2M A;  2B3L A;  2OKN A;  4FO7 A;  1BN5 A;  3CB5 A;  1A16 A;  4IEC A;  4IKR A;  4ZNG A;  5JHU A;  1M35 A;  4U1B A;  2IW2 A;  2EVO A;  2Q92 A;  4FLI A;  2EA2 A;  4R60 A;  1KQ0 A;  1JAW A;  2BWV A;  2OAZ A;  4HXX A;  2NQ7 A;  2BHD A;  3FMQ A;  3BIP A;  4MAT A;  2GU7 A;  2ZSG A;  2V6C A;  4RZY A;  1C27 A;  1CHM A;  4RGZ 1;  4U6W A;  2ADU A;  4U6E A;  4A6V A;  2BWS A;  2BH3 A;  2V3Z A;  5D6E A;  4OOK A;  4QR8 A;  2BWT A;  2BHB A;  4FUK A;  1YW7 A;  3MX6 A;  5FCF A;  2Q94 A;  4ZWP A;  2BWY A;  3TB5 A;  3PKC A;  1YJ3 A;  1KQ9 A;  1C22 A;  3ROR A;  2P98 A;  2V3X A;  3BIT A;  3IU9 A;  4S01 A;  2BWU A;  4ZWO A;  1QXZ A;  2GG8 A;  3IU7 A;  4U6J A;  2GU4 A;  5FCH A;  2EVC A;  2GU5 A;  4IF7 A;  2BN7 A;  4FLK A;  2DFI A;  2B3K A;  1QZY A;  2GU6 A;  4FLJ A;  1WY2 A;  1QXW A;  2GG9 A;  1B6A A;  3TAV A;  2P99 A;  4U6C A;  2BHC A;  1XGS A;  4S00 A;  4IKU A;  3MAT A;  4JUQ A;  4IU6 A;  4U73 A;  4U75 A;  1R58 A;  2EVM A;  3IG4 A;  1R5H A;  2V3Y A;  1XGN A;  1Y1N A;  4IKS A;  5JI6 A;  3BIQ A;  4U71 A;  2GA2 A;  3L7G A;  4EGE A;  2GG5 A;  3CB6 A;  3PKA A;  2GZ5 A;  4U6Z A;  5CNX A;  3L24 A;  5CDV A;  4A6W A;  2Q95 A;  3PKD A;  4S2T P;  1WKM A;  1WL9 A;  4PNC A;  1BOA A;  1O0X A;  1WBQ A;  3Q6D A;  1WLR A;  5CIK A;  2GG3 A;  3D27 A;  5CE6 A;  2HOW A;  2Q96 A;  3FMR A;  4Z7M A;  1C23 A;  1QXY A;  3PKB A;  4RZZ A;  2Q8K A;  1WN1 A;  3RVA A;  2GGB A;  2P9A A;  1MAT A;  4U70 A;  5CLS A;  1W7V A;  2GGC A;  4ZWU A;  4S2R P;  5E5B A;  2B3H A;  5D6F A;  3IU8 A;  2BHA A;  1XGO A;  3S6B A;  2BWW A;  1KP0 A;  3CTZ A;  4PV4 A;  2Q93 A;  3PKE A;  1YVM A;  4KM3 A;  4FO8 A;  2EA4 A;  4FLL A;  1WL6 A;  1XGM A;  4FKC A;  4U69 A;  2MAT A;  1C21 A;  2BWX A;  2GG0 A;  1B59 A;  4IPA A;  4IKT A;  2NQ6 A;  3FM3 A;  1C24 A;  2G6P A;  4B28 A; 
#chains in the Genus database with same CATH homology
 2GG2 A;  1N51 A;  1YW9 A;  2BB7 A;  2GTX A;  3MR1 A;  2GG7 A;  1XNZ A;  1PV9 A;  1R5G A;  4U76 A;  5CDL A;  4IDY A;  5JFR A;  1YW8 A;  5CDE A;  1W2M A;  2B3L A;  2OKN A;  4FO7 A;  1BN5 A;  3CB5 A;  1A16 A;  4IEC A;  4IKR A;  4ZNG A;  5JHU A;  1M35 A;  4U1B A;  2IW2 A;  2EVO A;  2Q92 A;  4FLI A;  2EA2 A;  4R60 A;  1KQ0 A;  1JAW A;  2BWV A;  2OAZ A;  4HXX A;  2NQ7 A;  2BHD A;  3FMQ A;  3BIP A;  4MAT A;  2GU7 A;  2ZSG A;  2V6C A;  4RZY A;  1C27 A;  1CHM A;  4RGZ 1;  4U6W A;  2ADU A;  4U6E A;  4A6V A;  2BWS A;  2BH3 A;  2V3Z A;  5D6E A;  4OOK A;  4QR8 A;  2BWT A;  2BHB A;  4FUK A;  1YW7 A;  3MX6 A;  5FCF A;  2Q94 A;  4ZWP A;  2BWY A;  3TB5 A;  3PKC A;  1YJ3 A;  1KQ9 A;  1C22 A;  3ROR A;  2P98 A;  2V3X A;  3BIT A;  3IU9 A;  4S01 A;  2BWU A;  4ZWO A;  1QXZ A;  2GG8 A;  3IU7 A;  4U6J A;  2GU4 A;  5FCH A;  2EVC A;  2GU5 A;  4IF7 A;  2BN7 A;  4FLK A;  2DFI A;  2B3K A;  1QZY A;  2GU6 A;  4FLJ A;  1WY2 A;  1QXW A;  2GG9 A;  1B6A A;  3TAV A;  2P99 A;  4U6C A;  2BHC A;  1XGS A;  4S00 A;  4IKU A;  3MAT A;  4JUQ A;  4IU6 A;  4U73 A;  4U75 A;  1R58 A;  2EVM A;  3IG4 A;  1R5H A;  2V3Y A;  1XGN A;  1Y1N A;  4IKS A;  5JI6 A;  3BIQ A;  4U71 A;  2GA2 A;  3L7G A;  4EGE A;  2GG5 A;  3CB6 A;  3PKA A;  2GZ5 A;  4U6Z A;  5CNX A;  3L24 A;  5CDV A;  4A6W A;  2Q95 A;  3PKD A;  4S2T P;  1WKM A;  1WL9 A;  4PNC A;  1BOA A;  1O0X A;  1WBQ A;  3Q6D A;  1WLR A;  5CIK A;  2GG3 A;  3D27 A;  5CE6 A;  2HOW A;  2Q96 A;  3FMR A;  4Z7M A;  1C23 A;  1QXY A;  3PKB A;  4RZZ A;  2Q8K A;  1WN1 A;  3RVA A;  2GGB A;  2P9A A;  1MAT A;  4U70 A;  5CLS A;  1W7V A;  2GGC A;  4ZWU A;  4S2R P;  5E5B A;  2B3H A;  5D6F A;  3IU8 A;  2BHA A;  1XGO A;  3S6B A;  2BWW A;  1KP0 A;  3CTZ A;  4PV4 A;  2Q93 A;  3PKE A;  1YVM A;  4KM3 A;  4FO8 A;  2EA4 A;  4FLL A;  1WL6 A;  1XGM A;  4FKC A;  4U69 A;  2MAT A;  1C21 A;  2BWX A;  2GG0 A;  1B59 A;  4IPA A;  4IKT A;  2NQ6 A;  3FM3 A;  1C24 A;  2G6P A;  4B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...