1QXYA

Crystal structure of s. aureus methionine aminopeptidase in complex with a ketoheterocycle 618
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords methionyl aminopeptidase
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 81
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxyA00
4FO8A 4U71A 1WLRA 4MATA 1R58A 3CB6A 4S2TP 2ZSGA 4IECA 3RVAA 4U6JA 2Q95A 5FCHA 2EA2A 2GG9A 2BN7A 4U6EA 3PKBA 4FLKA 1C24A 2BHBA 3IU9A 2BHCA 1PV9A 1KP0A 2Q94A 1MATA 1XGOA 1XGNA 1KQ9A 5CE6A 5CIKA 5JFRA 3Q6DA 5CLSA 2GG3A 5CDEA 2BWVA 3CB5A 4FKCA 2GTXA 4FLJA 2EA4A 2B3HA 2GGBA 2GG5A 5D6EA 4FLIA 4IKTA 1QZYA 4KM3A 2GU7A 1C21A 4FLLA 4ZWUA 5E5BA 4JUQA 4Z7MA 4IU6A 2GU5A 1WN1A 1C23A 1XGSA 3TB5A 2BWYA 2ADUA 1QXWA 2EVOA 4IKUA 4U76A 1N51A 4ZWOA 1W7VA 2V3ZA 4HXXA 1B59A 1QXZA 2GGCA 2NQ7A 1R5GA 4S01A 3FM3A 2MATA 3CTZA 2BWWA 4RGZ1 2Q92A 2G6PA 3MR1A 2P99A 2V3XA 2Q93A 3PKDA 1B6AA 4PV4A 1WKMA 1KQ0A 1WBQA 2BWXA 2B3LA 3FMRA 1O0XA 3MX6A 2BWSA 4S00A 2GA2A 4S2RP 4EGEA 4U70A 4U6WA 3L7GA 1XNZA 2BWTA 1YJ3A 3BITA 2GG2A 2BB7A 5JHUA 2IW2A 3BIPA 4FUKA 1BOAA 2GG0A 3IG4A 1WL6A 3PKAA 3PKEA 1WY2A 4IDYA 5CNXA 2P9AA 3MATA 4A6WA 2Q8KA 5FCFA 4IPAA 2V6CA 5CDLA 1WL9A 3IU8A 1C22A 2GG8A 1C27A 2GU4A 3RORA 4IF7A 4B28A 4R60A 1JAWA 2BH3A 2BHDA 2BHAA 4OOKA 1A16A 1W2MA 4ZNGA 3L24A 3IU7A 3S6BA 5CDVA 2EVCA 1Y1NA 1YW9A 2Q96A 3PKCA 3TAVA 3D27A 2P98A 4RZZA 2OAZA 1M35A 2BWUA 3BIQA 5JI6A 1YW8A 4U75A 4ZWPA 2V3YA 2GU6A 4QR8A 4U6CA 2OKNA 4FO7A 4U6ZA 5D6FA 1CHMA 1YVMA 2B3KA 2EVMA 2DFIA 2NQ6A 4RZYA 1XGMA 4U73A 4IKRA 1BN5A 2GZ5A 4IKSA 4PNCA 4U1BA 3FMQA 4U69A 2HOWA 2GG7A 4A6VA 1YW7A 1QXYA 1R5HA
chains in the Genus database with same CATH superfamily
4FO8A 4U71A 1WLRA 4MATA 1R58A 3CB6A 4S2TP 2ZSGA 4IECA 3RVAA 4U6JA 2Q95A 5FCHA 2EA2A 2GG9A 2BN7A 4U6EA 3PKBA 4FLKA 1C24A 2BHBA 3IU9A 2BHCA 1PV9A 1KP0A 2Q94A 1MATA 1XGOA 1XGNA 1KQ9A 5CE6A 5CIKA 5JFRA 3Q6DA 5CLSA 2GG3A 5CDEA 2BWVA 3CB5A 4FKCA 2GTXA 4FLJA 2EA4A 2B3HA 2GGBA 2GG5A 5D6EA 4FLIA 4IKTA 1QZYA 4KM3A 2GU7A 1C21A 4FLLA 4ZWUA 5E5BA 4JUQA 4Z7MA 4IU6A 2GU5A 1WN1A 1C23A 1XGSA 3TB5A 2BWYA 2ADUA 1QXWA 2EVOA 4IKUA 4U76A 1N51A 4ZWOA 1W7VA 2V3ZA 4HXXA 1B59A 1QXZA 2GGCA 2NQ7A 1R5GA 4S01A 3FM3A 2MATA 3CTZA 2BWWA 4RGZ1 2Q92A 2G6PA 3MR1A 2P99A 2V3XA 2Q93A 3PKDA 1B6AA 4PV4A 1WKMA 1KQ0A 1WBQA 2BWXA 2B3LA 3FMRA 1O0XA 3MX6A 2BWSA 4S00A 2GA2A 4S2RP 4EGEA 4U70A 4U6WA 3L7GA 1XNZA 2BWTA 1YJ3A 3BITA 2GG2A 2BB7A 5JHUA 2IW2A 3BIPA 4FUKA 1BOAA 2GG0A 3IG4A 1WL6A 3PKAA 3PKEA 1WY2A 4IDYA 5CNXA 2P9AA 3MATA 4A6WA 2Q8KA 5FCFA 4IPAA 2V6CA 5CDLA 1WL9A 3IU8A 1C22A 2GG8A 1C27A 2GU4A 3RORA 4IF7A 4B28A 4R60A 1JAWA 2BH3A 2BHDA 2BHAA 4OOKA 1A16A 1W2MA 4ZNGA 3L24A 3IU7A 3S6BA 5CDVA 2EVCA 1Y1NA 1YW9A 2Q96A 3PKCA 3TAVA 3D27A 2P98A 4RZZA 2OAZA 1M35A 2BWUA 3BIQA 5JI6A 1YW8A 4U75A 4ZWPA 2V3YA 2GU6A 4QR8A 4U6CA 2OKNA 4FO7A 4U6ZA 5D6FA 1CHMA 1YVMA 2B3KA 2EVMA 2DFIA 2NQ6A 4RZYA 1XGMA 4U73A 4IKRA 1BN5A 2GZ5A 4IKSA 4PNCA 4U1BA 3FMQA 4U69A 2HOWA 2GG7A 4A6VA 1YW7A 1QXYA 1R5HA
chains in the Genus database with same CATH topology
4FO8A 4U71A 1WLRA 4MATA 1R58A 3CB6A 4S2TP 2ZSGA 4IECA 3RVAA 4U6JA 2Q95A 5FCHA 2EA2A 2GG9A 2BN7A 4U6EA 3PKBA 4FLKA 1C24A 2BHBA 3IU9A 2BHCA 1PV9A 1KP0A 2Q94A 1MATA 1XGOA 1XGNA 1KQ9A 5CE6A 5CIKA 5JFRA 3Q6DA 5CLSA 2GG3A 5CDEA 2BWVA 3CB5A 4FKCA 2GTXA 4FLJA 2EA4A 2B3HA 2GGBA 2GG5A 5D6EA 4FLIA 4IKTA 1QZYA 4KM3A 2GU7A 1C21A 4FLLA 4ZWUA 5E5BA 4JUQA 4Z7MA 4IU6A 2GU5A 1WN1A 1C23A 1XGSA 3TB5A 2BWYA 2ADUA 1QXWA 2EVOA 4IKUA 4U76A 1N51A 4ZWOA 1W7VA 2V3ZA 4HXXA 1B59A 1QXZA 2GGCA 2NQ7A 1R5GA 4S01A 3FM3A 2MATA 3CTZA 2BWWA 4RGZ1 2Q92A 2G6PA 3MR1A 2P99A 2V3XA 2Q93A 3PKDA 1B6AA 4PV4A 1WKMA 1KQ0A 1WBQA 2BWXA 2B3LA 3FMRA 1O0XA 3MX6A 2BWSA 4S00A 2GA2A 4S2RP 4EGEA 4U70A 4U6WA 3L7GA 1XNZA 2BWTA 1YJ3A 3BITA 2GG2A 2BB7A 5JHUA 2IW2A 3BIPA 4FUKA 1BOAA 2GG0A 3IG4A 1WL6A 3PKAA 3PKEA 1WY2A 4IDYA 5CNXA 2P9AA 3MATA 4A6WA 2Q8KA 5FCFA 4IPAA 2V6CA 5CDLA 1WL9A 3IU8A 1C22A 2GG8A 1C27A 2GU4A 3RORA 4IF7A 4B28A 4R60A 1JAWA 2BH3A 2BHDA 2BHAA 4OOKA 1A16A 1W2MA 4ZNGA 3L24A 3IU7A 3S6BA 5CDVA 2EVCA 1Y1NA 1YW9A 2Q96A 3PKCA 3TAVA 3D27A 2P98A 4RZZA 2OAZA 1M35A 2BWUA 3BIQA 5JI6A 1YW8A 4U75A 4ZWPA 2V3YA 2GU6A 4QR8A 4U6CA 2OKNA 4FO7A 4U6ZA 5D6FA 1CHMA 1YVMA 2B3KA 2EVMA 2DFIA 2NQ6A 4RZYA 1XGMA 4U73A 4IKRA 1BN5A 2GZ5A 4IKSA 4PNCA 4U1BA 3FMQA 4U69A 2HOWA 2GG7A 4A6VA 1YW7A 1QXYA 1R5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO8 A;  4U71 A;  1WLR A;  4MAT A;  1R58 A;  3CB6 A;  4S2T P;  2ZSG A;  4IEC A;  3RVA A;  4U6J A;  2Q95 A;  5FCH A;  2EA2 A;  2GG9 A;  2BN7 A;  4U6E A;  3PKB A;  4FLK A;  1C24 A;  2BHB A;  3IU9 A;  2BHC A;  1PV9 A;  1KP0 A;  2Q94 A;  1MAT A;  1XGO A;  1XGN A;  1KQ9 A;  5CE6 A;  5CIK A;  5JFR A;  3Q6D A;  5CLS A;  2GG3 A;  5CDE A;  2BWV A;  3CB5 A;  4FKC A;  2GTX A;  4FLJ A;  2EA4 A;  2B3H A;  2GGB A;  2GG5 A;  5D6E A;  4FLI A;  4IKT A;  1QZY A;  4KM3 A;  2GU7 A;  1C21 A;  4FLL A;  4ZWU A;  5E5B A;  4JUQ A;  4Z7M A;  4IU6 A;  2GU5 A;  1WN1 A;  1C23 A;  1XGS A;  3TB5 A;  2BWY A;  2ADU A;  1QXW A;  2EVO A;  4IKU A;  4U76 A;  1N51 A;  4ZWO A;  1W7V A;  2V3Z A;  4HXX A;  1B59 A;  1QXZ A;  2GGC A;  2NQ7 A;  1R5G A;  4S01 A;  3FM3 A;  2MAT A;  3CTZ A;  2BWW A;  4RGZ 1;  2Q92 A;  2G6P A;  3MR1 A;  2P99 A;  2V3X A;  2Q93 A;  3PKD A;  1B6A A;  4PV4 A;  1WKM A;  1KQ0 A;  1WBQ A;  2BWX A;  2B3L A;  3FMR A;  1O0X A;  3MX6 A;  2BWS A;  4S00 A;  2GA2 A;  4S2R P;  4EGE A;  4U70 A;  4U6W A;  3L7G A;  1XNZ A;  2BWT A;  1YJ3 A;  3BIT A;  2GG2 A;  2BB7 A;  5JHU A;  2IW2 A;  3BIP A;  4FUK A;  1BOA A;  2GG0 A;  3IG4 A;  1WL6 A;  3PKA A;  3PKE A;  1WY2 A;  4IDY A;  5CNX A;  2P9A A;  3MAT A;  4A6W A;  2Q8K A;  5FCF A;  4IPA A;  2V6C A;  5CDL A;  1WL9 A;  3IU8 A;  1C22 A;  2GG8 A;  1C27 A;  2GU4 A;  3ROR A;  4IF7 A;  4B28 A;  4R60 A;  1JAW A;  2BH3 A;  2BHD A;  2BHA A;  4OOK A;  1A16 A;  1W2M A;  4ZNG A;  3L24 A;  3IU7 A;  3S6B A;  5CDV A;  2EVC A;  1Y1N A;  1YW9 A;  2Q96 A;  3PKC A;  3TAV A;  3D27 A;  2P98 A;  4RZZ A;  2OAZ A;  1M35 A;  2BWU A;  3BIQ A;  5JI6 A;  1YW8 A;  4U75 A;  4ZWP A;  2V3Y A;  2GU6 A;  4QR8 A;  4U6C A;  2OKN A;  4FO7 A;  4U6Z A;  5D6F A;  1CHM A;  1YVM A;  2B3K A;  2EVM A;  2DFI A;  2NQ6 A;  4RZY A;  1XGM A;  4U73 A;  4IKR A;  1BN5 A;  2GZ5 A;  4IKS A;  4PNC A;  4U1B A;  3FMQ A;  4U69 A;  2HOW A;  2GG7 A;  4A6V A;  1YW7 A;  1QXY A;  1R5H A; 
#chains in the Genus database with same CATH topology
 4FO8 A;  4U71 A;  1WLR A;  4MAT A;  1R58 A;  3CB6 A;  4S2T P;  2ZSG A;  4IEC A;  3RVA A;  4U6J A;  2Q95 A;  5FCH A;  2EA2 A;  2GG9 A;  2BN7 A;  4U6E A;  3PKB A;  4FLK A;  1C24 A;  2BHB A;  3IU9 A;  2BHC A;  1PV9 A;  1KP0 A;  2Q94 A;  1MAT A;  1XGO A;  1XGN A;  1KQ9 A;  5CE6 A;  5CIK A;  5JFR A;  3Q6D A;  5CLS A;  2GG3 A;  5CDE A;  2BWV A;  3CB5 A;  4FKC A;  2GTX A;  4FLJ A;  2EA4 A;  2B3H A;  2GGB A;  2GG5 A;  5D6E A;  4FLI A;  4IKT A;  1QZY A;  4KM3 A;  2GU7 A;  1C21 A;  4FLL A;  4ZWU A;  5E5B A;  4JUQ A;  4Z7M A;  4IU6 A;  2GU5 A;  1WN1 A;  1C23 A;  1XGS A;  3TB5 A;  2BWY A;  2ADU A;  1QXW A;  2EVO A;  4IKU A;  4U76 A;  1N51 A;  4ZWO A;  1W7V A;  2V3Z A;  4HXX A;  1B59 A;  1QXZ A;  2GGC A;  2NQ7 A;  1R5G A;  4S01 A;  3FM3 A;  2MAT A;  3CTZ A;  2BWW A;  4RGZ 1;  2Q92 A;  2G6P A;  3MR1 A;  2P99 A;  2V3X A;  2Q93 A;  3PKD A;  1B6A A;  4PV4 A;  1WKM A;  1KQ0 A;  1WBQ A;  2BWX A;  2B3L A;  3FMR A;  1O0X A;  3MX6 A;  2BWS A;  4S00 A;  2GA2 A;  4S2R P;  4EGE A;  4U70 A;  4U6W A;  3L7G A;  1XNZ A;  2BWT A;  1YJ3 A;  3BIT A;  2GG2 A;  2BB7 A;  5JHU A;  2IW2 A;  3BIP A;  4FUK A;  1BOA A;  2GG0 A;  3IG4 A;  1WL6 A;  3PKA A;  3PKE A;  1WY2 A;  4IDY A;  5CNX A;  2P9A A;  3MAT A;  4A6W A;  2Q8K A;  5FCF A;  4IPA A;  2V6C A;  5CDL A;  1WL9 A;  3IU8 A;  1C22 A;  2GG8 A;  1C27 A;  2GU4 A;  3ROR A;  4IF7 A;  4B28 A;  4R60 A;  1JAW A;  2BH3 A;  2BHD A;  2BHA A;  4OOK A;  1A16 A;  1W2M A;  4ZNG A;  3L24 A;  3IU7 A;  3S6B A;  5CDV A;  2EVC A;  1Y1N A;  1YW9 A;  2Q96 A;  3PKC A;  3TAV A;  3D27 A;  2P98 A;  4RZZ A;  2OAZ A;  1M35 A;  2BWU A;  3BIQ A;  5JI6 A;  1YW8 A;  4U75 A;  4ZWP A;  2V3Y A;  2GU6 A;  4QR8 A;  4U6C A;  2OKN A;  4FO7 A;  4U6Z A;  5D6F A;  1CHM A;  1YVM A;  2B3K A;  2EVM A;  2DFI A;  2NQ6 A;  4RZY A;  1XGM A;  4U73 A;  4IKR A;  1BN5 A;  2GZ5 A;  4IKS A;  4PNC A;  4U1B A;  3FMQ A;  4U69 A;  2HOW A;  2GG7 A;  4A6V A;  1YW7 A;  1QXY A;  1R5H A; 
#chains in the Genus database with same CATH homology
 4FO8 A;  4U71 A;  1WLR A;  4MAT A;  1R58 A;  3CB6 A;  4S2T P;  2ZSG A;  4IEC A;  3RVA A;  4U6J A;  2Q95 A;  5FCH A;  2EA2 A;  2GG9 A;  2BN7 A;  4U6E A;  3PKB A;  4FLK A;  1C24 A;  2BHB A;  3IU9 A;  2BHC A;  1PV9 A;  1KP0 A;  2Q94 A;  1MAT A;  1XGO A;  1XGN A;  1KQ9 A;  5CE6 A;  5CIK A;  5JFR A;  3Q6D A;  5CLS A;  2GG3 A;  5CDE A;  2BWV A;  3CB5 A;  4FKC A;  2GTX A;  4FLJ A;  2EA4 A;  2B3H A;  2GGB A;  2GG5 A;  5D6E A;  4FLI A;  4IKT A;  1QZY A;  4KM3 A;  2GU7 A;  1C21 A;  4FLL A;  4ZWU A;  5E5B A;  4JUQ A;  4Z7M A;  4IU6 A;  2GU5 A;  1WN1 A;  1C23 A;  1XGS A;  3TB5 A;  2BWY A;  2ADU A;  1QXW A;  2EVO A;  4IKU A;  4U76 A;  1N51 A;  4ZWO A;  1W7V A;  2V3Z A;  4HXX A;  1B59 A;  1QXZ A;  2GGC A;  2NQ7 A;  1R5G A;  4S01 A;  3FM3 A;  2MAT A;  3CTZ A;  2BWW A;  4RGZ 1;  2Q92 A;  2G6P A;  3MR1 A;  2P99 A;  2V3X A;  2Q93 A;  3PKD A;  1B6A A;  4PV4 A;  1WKM A;  1KQ0 A;  1WBQ A;  2BWX A;  2B3L A;  3FMR A;  1O0X A;  3MX6 A;  2BWS A;  4S00 A;  2GA2 A;  4S2R P;  4EGE A;  4U70 A;  4U6W A;  3L7G A;  1XNZ A;  2BWT A;  1YJ3 A;  3BIT A;  2GG2 A;  2BB7 A;  5JHU A;  2IW2 A;  3BIP A;  4FUK A;  1BOA A;  2GG0 A;  3IG4 A;  1WL6 A;  3PKA A;  3PKE A;  1WY2 A;  4IDY A;  5CNX A;  2P9A A;  3MAT A;  4A6W A;  2Q8K A;  5FCF A;  4IPA A;  2V6C A;  5CDL A;  1WL9 A;  3IU8 A;  1C22 A;  2GG8 A;  1C27 A;  2GU4 A;  3ROR A;  4IF7 A;  4B28 A;  4R60 A;  1JAW A;  2BH3 A;  2BHD A;  2BHA A;  4OOK A;  1A16 A;  1W2M A;  4ZNG A;  3L24 A;  3IU7 A;  3S6B A;  5CDV A;  2EVC A;  1Y1N A;  1YW9 A;  2Q96 A;  3PKC A;  3TAV A;  3D27 A;  2P98 A;  4RZZ A;  2OAZ A;  1M35 A;  2BWU A;  3BIQ A;  5JI6 A;  1YW8 A;  4U75 A;  4ZWP A;  2V3Y A;  2GU6 A;  4QR8 A;  4U6C A;  2OKN A;  4FO7 A;  4U6Z A;  5D6F A;  1CHM A;  1YVM A;  2B3K A;  2EVM A;  2DFI A;  2NQ6 A;  4RZY A;  1XGM A;  4U73 A;  4IKR A;  1BN5 A;  2GZ5 A;  4IKS A;  4PNC A;  4U1B A;  3FMQ A;  4U69 A;  2HOW A;  2GG7 A;  4A6V A;  1YW7 A;  1QXY A;  1R5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...