1QXYA

Crystal structure of s. aureus methionine aminopeptidase in complex with a ketoheterocycle 618
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords methionyl aminopeptidase
total genus 81
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxyA00
2BWUA 3PKCA 2V3XA 4FLKA 2NQ6A 5FCFA 2BWYA 3RORA 2BN7A 2Q8KA 2BHDA 5D6FA 4EGEA 4RGZ1 2BHCA 4B28A 3BITA 1W7VA 3PKDA 4U73A 4IKTA 1QXWA 2GG0A 3BIPA 4U76A 3CB6A 2GTXA 4KM3A 2ZSGA 2GZ5A 4OOKA 2GG2A 4U1BA 1XGNA 1YVMA 4U6ZA 1XGMA 4IECA 2GU5A 4S2RP 4IU6A 2BWTA 1B6AA 2EVCA 4FO7A 4FO8A 4FLIA 2Q95A 4IKSA 4FLLA 4IPAA 1YW7A 2GA2A 1C27A 5JFRA 2GGBA 4S00A 3RVAA 5E5BA 1JAWA 1QXZA 2GU7A 4U69A 1N51A 2Q93A 1BOAA 2BHAA 4QR8A 4S2TP 3FMRA 3MR1A 1WBQA 4ZWPA 1YW8A 2BWWA 2DFIA 2EA4A 2GU4A 2EA2A 4ZWOA 1KQ0A 4FKCA 4A6VA 1WLRA 1WKMA 3MX6A 1C24A 1YW9A 1A16A 2MATA 2V3YA 3PKAA 3PKBA 2HOWA 2P9AA 1Y1NA 4A6WA 3IU8A 1C22A 1C23A 4ZNGA 1R5HA 1WY2A 1XGOA 2BH3A 4JUQA 4RZYA 5CNXA 5CDEA 2GG9A 1M35A 4FLJA 1CHMA 4IF7A 4U6CA 1PV9A 2GGCA 2B3KA 2GU6A 4R60A 1WL9A 3FMQA 3PKEA 1KP0A 3Q6DA 4IDYA 4MATA 2BWVA 2GG8A 2G6PA 3CB5A 2ADUA 2NQ7A 2BHBA 2IW2A 2V6CA 1WN1A 4Z7MA 3S6BA 5CDVA 2OAZA 3IU9A 1C21A 3CTZA 2EVMA 4U6WA 1QXYA 1YJ3A 1XGSA 4IKUA 2P99A 2Q94A 2BWXA 1BN5A 4PV4A 5CLSA 4HXXA 1R5GA 4S01A 1XNZA 2B3LA 2BWSA 2P98A 4ZWUA 4IKRA 4U6JA 5CDLA 1B59A 2Q92A 3TB5A 3MATA 2GG5A 2GG7A 5JI6A 1KQ9A 3IG4A 4FUKA 4U71A 2OKNA 4U75A 2Q96A 5D6EA 4PNCA 4RZZA 1WL6A 2EVOA 4U70A 3L24A 3TAVA 2GG3A 3FM3A 1O0XA 5FCHA 2BB7A 1QZYA 2B3HA 3D27A 3L7GA 5JHUA 1MATA 3BIQA 1R58A 3IU7A 5CE6A 5CIKA 4U6EA 1W2MA 2V3ZA
chains in the Genus database with same CATH superfamily
2BWUA 3PKCA 2V3XA 4FLKA 2NQ6A 5FCFA 2BWYA 3RORA 2BN7A 2Q8KA 2BHDA 5D6FA 4EGEA 4RGZ1 2BHCA 4B28A 3BITA 1W7VA 3PKDA 4U73A 4IKTA 1QXWA 2GG0A 3BIPA 4U76A 3CB6A 2GTXA 4KM3A 2ZSGA 2GZ5A 4OOKA 2GG2A 4U1BA 1XGNA 1YVMA 4U6ZA 1XGMA 4IECA 2GU5A 4S2RP 4IU6A 2BWTA 1B6AA 2EVCA 4FO7A 4FO8A 4FLIA 2Q95A 4IKSA 4FLLA 4IPAA 1YW7A 2GA2A 1C27A 5JFRA 2GGBA 4S00A 3RVAA 5E5BA 1JAWA 1QXZA 2GU7A 4U69A 1N51A 2Q93A 1BOAA 2BHAA 4QR8A 4S2TP 3FMRA 3MR1A 1WBQA 4ZWPA 1YW8A 2BWWA 2DFIA 2EA4A 2GU4A 2EA2A 4ZWOA 1KQ0A 4FKCA 4A6VA 1WLRA 1WKMA 3MX6A 1C24A 1YW9A 1A16A 2MATA 2V3YA 3PKAA 3PKBA 2HOWA 2P9AA 1Y1NA 4A6WA 3IU8A 1C22A 1C23A 4ZNGA 1R5HA 1WY2A 1XGOA 2BH3A 4JUQA 4RZYA 5CNXA 5CDEA 2GG9A 1M35A 4FLJA 1CHMA 4IF7A 4U6CA 1PV9A 2GGCA 2B3KA 2GU6A 4R60A 1WL9A 3FMQA 3PKEA 1KP0A 3Q6DA 4IDYA 4MATA 2BWVA 2GG8A 2G6PA 3CB5A 2ADUA 2NQ7A 2BHBA 2IW2A 2V6CA 1WN1A 4Z7MA 3S6BA 5CDVA 2OAZA 3IU9A 1C21A 3CTZA 2EVMA 4U6WA 1QXYA 1YJ3A 1XGSA 4IKUA 2P99A 2Q94A 2BWXA 1BN5A 4PV4A 5CLSA 4HXXA 1R5GA 4S01A 1XNZA 2B3LA 2BWSA 2P98A 4ZWUA 4IKRA 4U6JA 5CDLA 1B59A 2Q92A 3TB5A 3MATA 2GG5A 2GG7A 5JI6A 1KQ9A 3IG4A 4FUKA 4U71A 2OKNA 4U75A 2Q96A 5D6EA 4PNCA 4RZZA 1WL6A 2EVOA 4U70A 3L24A 3TAVA 2GG3A 3FM3A 1O0XA 5FCHA 2BB7A 1QZYA 2B3HA 3D27A 3L7GA 5JHUA 1MATA 3BIQA 1R58A 3IU7A 5CE6A 5CIKA 4U6EA 1W2MA 2V3ZA
chains in the Genus database with same CATH topology
2BWUA 3PKCA 2V3XA 4FLKA 2NQ6A 5FCFA 2BWYA 3RORA 2BN7A 2Q8KA 2BHDA 5D6FA 4EGEA 4RGZ1 2BHCA 4B28A 3BITA 1W7VA 3PKDA 4U73A 4IKTA 1QXWA 2GG0A 3BIPA 4U76A 3CB6A 2GTXA 4KM3A 2ZSGA 2GZ5A 4OOKA 2GG2A 4U1BA 1XGNA 1YVMA 4U6ZA 1XGMA 4IECA 2GU5A 4S2RP 4IU6A 2BWTA 1B6AA 2EVCA 4FO7A 4FO8A 4FLIA 2Q95A 4IKSA 4FLLA 4IPAA 1YW7A 2GA2A 1C27A 5JFRA 2GGBA 4S00A 3RVAA 5E5BA 1JAWA 1QXZA 2GU7A 4U69A 1N51A 2Q93A 1BOAA 2BHAA 4QR8A 4S2TP 3FMRA 3MR1A 1WBQA 4ZWPA 1YW8A 2BWWA 2DFIA 2EA4A 2GU4A 2EA2A 4ZWOA 1KQ0A 4FKCA 4A6VA 1WLRA 1WKMA 3MX6A 1C24A 1YW9A 1A16A 2MATA 2V3YA 3PKAA 3PKBA 2HOWA 2P9AA 1Y1NA 4A6WA 3IU8A 1C22A 1C23A 4ZNGA 1R5HA 1WY2A 1XGOA 2BH3A 4JUQA 4RZYA 5CNXA 5CDEA 2GG9A 1M35A 4FLJA 1CHMA 4IF7A 4U6CA 1PV9A 2GGCA 2B3KA 2GU6A 4R60A 1WL9A 3FMQA 3PKEA 1KP0A 3Q6DA 4IDYA 4MATA 2BWVA 2GG8A 2G6PA 3CB5A 2ADUA 2NQ7A 2BHBA 2IW2A 2V6CA 1WN1A 4Z7MA 3S6BA 5CDVA 2OAZA 3IU9A 1C21A 3CTZA 2EVMA 4U6WA 1QXYA 1YJ3A 1XGSA 4IKUA 2P99A 2Q94A 2BWXA 1BN5A 4PV4A 5CLSA 4HXXA 1R5GA 4S01A 1XNZA 2B3LA 2BWSA 2P98A 4ZWUA 4IKRA 4U6JA 5CDLA 1B59A 2Q92A 3TB5A 3MATA 2GG5A 2GG7A 5JI6A 1KQ9A 3IG4A 4FUKA 4U71A 2OKNA 4U75A 2Q96A 5D6EA 4PNCA 4RZZA 1WL6A 2EVOA 4U70A 3L24A 3TAVA 2GG3A 3FM3A 1O0XA 5FCHA 2BB7A 1QZYA 2B3HA 3D27A 3L7GA 5JHUA 1MATA 3BIQA 1R58A 3IU7A 5CE6A 5CIKA 4U6EA 1W2MA 2V3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWU A;  3PKC A;  2V3X A;  4FLK A;  2NQ6 A;  5FCF A;  2BWY A;  3ROR A;  2BN7 A;  2Q8K A;  2BHD A;  5D6F A;  4EGE A;  4RGZ 1;  2BHC A;  4B28 A;  3BIT A;  1W7V A;  3PKD A;  4U73 A;  4IKT A;  1QXW A;  2GG0 A;  3BIP A;  4U76 A;  3CB6 A;  2GTX A;  4KM3 A;  2ZSG A;  2GZ5 A;  4OOK A;  2GG2 A;  4U1B A;  1XGN A;  1YVM A;  4U6Z A;  1XGM A;  4IEC A;  2GU5 A;  4S2R P;  4IU6 A;  2BWT A;  1B6A A;  2EVC A;  4FO7 A;  4FO8 A;  4FLI A;  2Q95 A;  4IKS A;  4FLL A;  4IPA A;  1YW7 A;  2GA2 A;  1C27 A;  5JFR A;  2GGB A;  4S00 A;  3RVA A;  5E5B A;  1JAW A;  1QXZ A;  2GU7 A;  4U69 A;  1N51 A;  2Q93 A;  1BOA A;  2BHA A;  4QR8 A;  4S2T P;  3FMR A;  3MR1 A;  1WBQ A;  4ZWP A;  1YW8 A;  2BWW A;  2DFI A;  2EA4 A;  2GU4 A;  2EA2 A;  4ZWO A;  1KQ0 A;  4FKC A;  4A6V A;  1WLR A;  1WKM A;  3MX6 A;  1C24 A;  1YW9 A;  1A16 A;  2MAT A;  2V3Y A;  3PKA A;  3PKB A;  2HOW A;  2P9A A;  1Y1N A;  4A6W A;  3IU8 A;  1C22 A;  1C23 A;  4ZNG A;  1R5H A;  1WY2 A;  1XGO A;  2BH3 A;  4JUQ A;  4RZY A;  5CNX A;  5CDE A;  2GG9 A;  1M35 A;  4FLJ A;  1CHM A;  4IF7 A;  4U6C A;  1PV9 A;  2GGC A;  2B3K A;  2GU6 A;  4R60 A;  1WL9 A;  3FMQ A;  3PKE A;  1KP0 A;  3Q6D A;  4IDY A;  4MAT A;  2BWV A;  2GG8 A;  2G6P A;  3CB5 A;  2ADU A;  2NQ7 A;  2BHB A;  2IW2 A;  2V6C A;  1WN1 A;  4Z7M A;  3S6B A;  5CDV A;  2OAZ A;  3IU9 A;  1C21 A;  3CTZ A;  2EVM A;  4U6W A;  1QXY A;  1YJ3 A;  1XGS A;  4IKU A;  2P99 A;  2Q94 A;  2BWX A;  1BN5 A;  4PV4 A;  5CLS A;  4HXX A;  1R5G A;  4S01 A;  1XNZ A;  2B3L A;  2BWS A;  2P98 A;  4ZWU A;  4IKR A;  4U6J A;  5CDL A;  1B59 A;  2Q92 A;  3TB5 A;  3MAT A;  2GG5 A;  2GG7 A;  5JI6 A;  1KQ9 A;  3IG4 A;  4FUK A;  4U71 A;  2OKN A;  4U75 A;  2Q96 A;  5D6E A;  4PNC A;  4RZZ A;  1WL6 A;  2EVO A;  4U70 A;  3L24 A;  3TAV A;  2GG3 A;  3FM3 A;  1O0X A;  5FCH A;  2BB7 A;  1QZY A;  2B3H A;  3D27 A;  3L7G A;  5JHU A;  1MAT A;  3BIQ A;  1R58 A;  3IU7 A;  5CE6 A;  5CIK A;  4U6E A;  1W2M A;  2V3Z A; 
#chains in the Genus database with same CATH topology
 2BWU A;  3PKC A;  2V3X A;  4FLK A;  2NQ6 A;  5FCF A;  2BWY A;  3ROR A;  2BN7 A;  2Q8K A;  2BHD A;  5D6F A;  4EGE A;  4RGZ 1;  2BHC A;  4B28 A;  3BIT A;  1W7V A;  3PKD A;  4U73 A;  4IKT A;  1QXW A;  2GG0 A;  3BIP A;  4U76 A;  3CB6 A;  2GTX A;  4KM3 A;  2ZSG A;  2GZ5 A;  4OOK A;  2GG2 A;  4U1B A;  1XGN A;  1YVM A;  4U6Z A;  1XGM A;  4IEC A;  2GU5 A;  4S2R P;  4IU6 A;  2BWT A;  1B6A A;  2EVC A;  4FO7 A;  4FO8 A;  4FLI A;  2Q95 A;  4IKS A;  4FLL A;  4IPA A;  1YW7 A;  2GA2 A;  1C27 A;  5JFR A;  2GGB A;  4S00 A;  3RVA A;  5E5B A;  1JAW A;  1QXZ A;  2GU7 A;  4U69 A;  1N51 A;  2Q93 A;  1BOA A;  2BHA A;  4QR8 A;  4S2T P;  3FMR A;  3MR1 A;  1WBQ A;  4ZWP A;  1YW8 A;  2BWW A;  2DFI A;  2EA4 A;  2GU4 A;  2EA2 A;  4ZWO A;  1KQ0 A;  4FKC A;  4A6V A;  1WLR A;  1WKM A;  3MX6 A;  1C24 A;  1YW9 A;  1A16 A;  2MAT A;  2V3Y A;  3PKA A;  3PKB A;  2HOW A;  2P9A A;  1Y1N A;  4A6W A;  3IU8 A;  1C22 A;  1C23 A;  4ZNG A;  1R5H A;  1WY2 A;  1XGO A;  2BH3 A;  4JUQ A;  4RZY A;  5CNX A;  5CDE A;  2GG9 A;  1M35 A;  4FLJ A;  1CHM A;  4IF7 A;  4U6C A;  1PV9 A;  2GGC A;  2B3K A;  2GU6 A;  4R60 A;  1WL9 A;  3FMQ A;  3PKE A;  1KP0 A;  3Q6D A;  4IDY A;  4MAT A;  2BWV A;  2GG8 A;  2G6P A;  3CB5 A;  2ADU A;  2NQ7 A;  2BHB A;  2IW2 A;  2V6C A;  1WN1 A;  4Z7M A;  3S6B A;  5CDV A;  2OAZ A;  3IU9 A;  1C21 A;  3CTZ A;  2EVM A;  4U6W A;  1QXY A;  1YJ3 A;  1XGS A;  4IKU A;  2P99 A;  2Q94 A;  2BWX A;  1BN5 A;  4PV4 A;  5CLS A;  4HXX A;  1R5G A;  4S01 A;  1XNZ A;  2B3L A;  2BWS A;  2P98 A;  4ZWU A;  4IKR A;  4U6J A;  5CDL A;  1B59 A;  2Q92 A;  3TB5 A;  3MAT A;  2GG5 A;  2GG7 A;  5JI6 A;  1KQ9 A;  3IG4 A;  4FUK A;  4U71 A;  2OKN A;  4U75 A;  2Q96 A;  5D6E A;  4PNC A;  4RZZ A;  1WL6 A;  2EVO A;  4U70 A;  3L24 A;  3TAV A;  2GG3 A;  3FM3 A;  1O0X A;  5FCH A;  2BB7 A;  1QZY A;  2B3H A;  3D27 A;  3L7G A;  5JHU A;  1MAT A;  3BIQ A;  1R58 A;  3IU7 A;  5CE6 A;  5CIK A;  4U6E A;  1W2M A;  2V3Z A; 
#chains in the Genus database with same CATH homology
 2BWU A;  3PKC A;  2V3X A;  4FLK A;  2NQ6 A;  5FCF A;  2BWY A;  3ROR A;  2BN7 A;  2Q8K A;  2BHD A;  5D6F A;  4EGE A;  4RGZ 1;  2BHC A;  4B28 A;  3BIT A;  1W7V A;  3PKD A;  4U73 A;  4IKT A;  1QXW A;  2GG0 A;  3BIP A;  4U76 A;  3CB6 A;  2GTX A;  4KM3 A;  2ZSG A;  2GZ5 A;  4OOK A;  2GG2 A;  4U1B A;  1XGN A;  1YVM A;  4U6Z A;  1XGM A;  4IEC A;  2GU5 A;  4S2R P;  4IU6 A;  2BWT A;  1B6A A;  2EVC A;  4FO7 A;  4FO8 A;  4FLI A;  2Q95 A;  4IKS A;  4FLL A;  4IPA A;  1YW7 A;  2GA2 A;  1C27 A;  5JFR A;  2GGB A;  4S00 A;  3RVA A;  5E5B A;  1JAW A;  1QXZ A;  2GU7 A;  4U69 A;  1N51 A;  2Q93 A;  1BOA A;  2BHA A;  4QR8 A;  4S2T P;  3FMR A;  3MR1 A;  1WBQ A;  4ZWP A;  1YW8 A;  2BWW A;  2DFI A;  2EA4 A;  2GU4 A;  2EA2 A;  4ZWO A;  1KQ0 A;  4FKC A;  4A6V A;  1WLR A;  1WKM A;  3MX6 A;  1C24 A;  1YW9 A;  1A16 A;  2MAT A;  2V3Y A;  3PKA A;  3PKB A;  2HOW A;  2P9A A;  1Y1N A;  4A6W A;  3IU8 A;  1C22 A;  1C23 A;  4ZNG A;  1R5H A;  1WY2 A;  1XGO A;  2BH3 A;  4JUQ A;  4RZY A;  5CNX A;  5CDE A;  2GG9 A;  1M35 A;  4FLJ A;  1CHM A;  4IF7 A;  4U6C A;  1PV9 A;  2GGC A;  2B3K A;  2GU6 A;  4R60 A;  1WL9 A;  3FMQ A;  3PKE A;  1KP0 A;  3Q6D A;  4IDY A;  4MAT A;  2BWV A;  2GG8 A;  2G6P A;  3CB5 A;  2ADU A;  2NQ7 A;  2BHB A;  2IW2 A;  2V6C A;  1WN1 A;  4Z7M A;  3S6B A;  5CDV A;  2OAZ A;  3IU9 A;  1C21 A;  3CTZ A;  2EVM A;  4U6W A;  1QXY A;  1YJ3 A;  1XGS A;  4IKU A;  2P99 A;  2Q94 A;  2BWX A;  1BN5 A;  4PV4 A;  5CLS A;  4HXX A;  1R5G A;  4S01 A;  1XNZ A;  2B3L A;  2BWS A;  2P98 A;  4ZWU A;  4IKR A;  4U6J A;  5CDL A;  1B59 A;  2Q92 A;  3TB5 A;  3MAT A;  2GG5 A;  2GG7 A;  5JI6 A;  1KQ9 A;  3IG4 A;  4FUK A;  4U71 A;  2OKN A;  4U75 A;  2Q96 A;  5D6E A;  4PNC A;  4RZZ A;  1WL6 A;  2EVO A;  4U70 A;  3L24 A;  3TAV A;  2GG3 A;  3FM3 A;  1O0X A;  5FCH A;  2BB7 A;  1QZY A;  2B3H A;  3D27 A;  3L7G A;  5JHU A;  1MAT A;  3BIQ A;  1R58 A;  3IU7 A;  5CE6 A;  5CIK A;  4U6E A;  1W2M A;  2V3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...