1QXYA

Crystal structure of s. aureus methionine aminopeptidase in complex with a ketoheterocycle 618
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords methionyl aminopeptidase
total genus 81
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxyA00
5CDVA 4IKSA 5FCFA 3L24A 4RZZA 2BWUA 2B3LA 1WL9A 1R5HA 1KQ0A 2BHCA 5CDEA 1WKMA 3BIPA 4JUQA 2BHAA 2Q96A 3RORA 2EVCA 4FLLA 5FCHA 5CNXA 1KP0A 3PKEA 4QR8A 4PV4A 4ZWUA 2NQ7A 2V6CA 1A16A 1WY2A 1YW9A 4A6VA 3FMRA 4IPAA 3Q6DA 4U6ZA 4HXXA 4IKRA 3MX6A 3S6BA 1XGSA 1BOAA 1B6AA 2Q93A 4IKTA 3IU9A 3PKBA 4IDYA 5D6EA 5CDLA 2GGBA 2V3XA 2GGCA 1W7VA 2EA2A 2B3HA 1YW7A 3PKDA 1YJ3A 4EGEA 2NQ6A 2Q92A 2GA2A 4U76A 4U73A 2BN7A 1C22A 1R58A 2DFIA 3PKAA 2Q8KA 2IW2A 1C24A 3FM3A 4KM3A 1WN1A 4A6WA 1WL6A 1XGMA 1QXWA 2G6PA 2Q94A 4ZWOA 2HOWA 4MATA 2BH3A 2V3YA 4U6WA 5CE6A 5JHUA 5D6FA 1W2MA 4RZYA 5JFRA 4IU6A 2BHDA 4U6EA 2GTXA 4S00A 2BWXA 1O0XA 3IU7A 4FLIA 2ZSGA 4U6CA 5CIKA 2BB7A 3MATA 4ZWPA 1WLRA 2GG2A 4Z7MA 2OAZA 2Q95A 1JAWA 1C27A 2BWSA 2GU7A 1C21A 4S2RP 2BWWA 2EA4A 1CHMA 2GG9A 4IKUA 2GG0A 3FMQA 2GG5A 2GU4A 1QXYA 3RVAA 4IECA 4U70A 3CTZA 5JI6A 1PV9A 2GU5A 2BWVA 1YVMA 1Y1NA 1N51A 4FLJA 4U71A 1YW8A 1C23A 2P99A 4S01A 1WBQA 3BITA 3MR1A 4U1BA 3PKCA 5E5BA 2BHBA 2GG3A 2EVMA 4FKCA 3CB5A 4U69A 4FLKA 4OOKA 3IU8A 4IF7A 1BN5A 1M35A 2EVOA 4FO8A 2GU6A 2P98A 2V3ZA 3D27A 4FO7A 1KQ9A 1B59A 2BWTA 2GG8A 4ZNGA 3TAVA 2B3KA 2GG7A 3BIQA 1XGNA 1XNZA 2P9AA 4B28A 4R60A 4RGZ1 4S2TP 2OKNA 5CLSA 2ADUA 1MATA 4PNCA 1XGOA 1QZYA 2GZ5A 3IG4A 1R5GA 4FUKA 4U6JA 3TB5A 2BWYA 1QXZA 2MATA 3L7GA 4U75A 3CB6A
chains in the Genus database with same CATH superfamily
5CDVA 4IKSA 5FCFA 3L24A 4RZZA 2BWUA 2B3LA 1WL9A 1R5HA 1KQ0A 2BHCA 5CDEA 1WKMA 3BIPA 4JUQA 2BHAA 2Q96A 3RORA 2EVCA 4FLLA 5FCHA 5CNXA 1KP0A 3PKEA 4QR8A 4PV4A 4ZWUA 2NQ7A 2V6CA 1A16A 1WY2A 1YW9A 4A6VA 3FMRA 4IPAA 3Q6DA 4U6ZA 4HXXA 4IKRA 3MX6A 3S6BA 1XGSA 1BOAA 1B6AA 2Q93A 4IKTA 3IU9A 3PKBA 4IDYA 5D6EA 5CDLA 2GGBA 2V3XA 2GGCA 1W7VA 2EA2A 2B3HA 1YW7A 3PKDA 1YJ3A 4EGEA 2NQ6A 2Q92A 2GA2A 4U76A 4U73A 2BN7A 1C22A 1R58A 2DFIA 3PKAA 2Q8KA 2IW2A 1C24A 3FM3A 4KM3A 1WN1A 4A6WA 1WL6A 1XGMA 1QXWA 2G6PA 2Q94A 4ZWOA 2HOWA 4MATA 2BH3A 2V3YA 4U6WA 5CE6A 5JHUA 5D6FA 1W2MA 4RZYA 5JFRA 4IU6A 2BHDA 4U6EA 2GTXA 4S00A 2BWXA 1O0XA 3IU7A 4FLIA 2ZSGA 4U6CA 5CIKA 2BB7A 3MATA 4ZWPA 1WLRA 2GG2A 4Z7MA 2OAZA 2Q95A 1JAWA 1C27A 2BWSA 2GU7A 1C21A 4S2RP 2BWWA 2EA4A 1CHMA 2GG9A 4IKUA 2GG0A 3FMQA 2GG5A 2GU4A 1QXYA 3RVAA 4IECA 4U70A 3CTZA 5JI6A 1PV9A 2GU5A 2BWVA 1YVMA 1Y1NA 1N51A 4FLJA 4U71A 1YW8A 1C23A 2P99A 4S01A 1WBQA 3BITA 3MR1A 4U1BA 3PKCA 5E5BA 2BHBA 2GG3A 2EVMA 4FKCA 3CB5A 4U69A 4FLKA 4OOKA 3IU8A 4IF7A 1BN5A 1M35A 2EVOA 4FO8A 2GU6A 2P98A 2V3ZA 3D27A 4FO7A 1KQ9A 1B59A 2BWTA 2GG8A 4ZNGA 3TAVA 2B3KA 2GG7A 3BIQA 1XGNA 1XNZA 2P9AA 4B28A 4R60A 4RGZ1 4S2TP 2OKNA 5CLSA 2ADUA 1MATA 4PNCA 1XGOA 1QZYA 2GZ5A 3IG4A 1R5GA 4FUKA 4U6JA 3TB5A 2BWYA 1QXZA 2MATA 3L7GA 4U75A 3CB6A
chains in the Genus database with same CATH topology
5CDVA 4IKSA 5FCFA 3L24A 4RZZA 2BWUA 2B3LA 1WL9A 1R5HA 1KQ0A 2BHCA 5CDEA 1WKMA 3BIPA 4JUQA 2BHAA 2Q96A 3RORA 2EVCA 4FLLA 5FCHA 5CNXA 1KP0A 3PKEA 4QR8A 4PV4A 4ZWUA 2NQ7A 2V6CA 1A16A 1WY2A 1YW9A 4A6VA 3FMRA 4IPAA 3Q6DA 4U6ZA 4HXXA 4IKRA 3MX6A 3S6BA 1XGSA 1BOAA 1B6AA 2Q93A 4IKTA 3IU9A 3PKBA 4IDYA 5D6EA 5CDLA 2GGBA 2V3XA 2GGCA 1W7VA 2EA2A 2B3HA 1YW7A 3PKDA 1YJ3A 4EGEA 2NQ6A 2Q92A 2GA2A 4U76A 4U73A 2BN7A 1C22A 1R58A 2DFIA 3PKAA 2Q8KA 2IW2A 1C24A 3FM3A 4KM3A 1WN1A 4A6WA 1WL6A 1XGMA 1QXWA 2G6PA 2Q94A 4ZWOA 2HOWA 4MATA 2BH3A 2V3YA 4U6WA 5CE6A 5JHUA 5D6FA 1W2MA 4RZYA 5JFRA 4IU6A 2BHDA 4U6EA 2GTXA 4S00A 2BWXA 1O0XA 3IU7A 4FLIA 2ZSGA 4U6CA 5CIKA 2BB7A 3MATA 4ZWPA 1WLRA 2GG2A 4Z7MA 2OAZA 2Q95A 1JAWA 1C27A 2BWSA 2GU7A 1C21A 4S2RP 2BWWA 2EA4A 1CHMA 2GG9A 4IKUA 2GG0A 3FMQA 2GG5A 2GU4A 1QXYA 3RVAA 4IECA 4U70A 3CTZA 5JI6A 1PV9A 2GU5A 2BWVA 1YVMA 1Y1NA 1N51A 4FLJA 4U71A 1YW8A 1C23A 2P99A 4S01A 1WBQA 3BITA 3MR1A 4U1BA 3PKCA 5E5BA 2BHBA 2GG3A 2EVMA 4FKCA 3CB5A 4U69A 4FLKA 4OOKA 3IU8A 4IF7A 1BN5A 1M35A 2EVOA 4FO8A 2GU6A 2P98A 2V3ZA 3D27A 4FO7A 1KQ9A 1B59A 2BWTA 2GG8A 4ZNGA 3TAVA 2B3KA 2GG7A 3BIQA 1XGNA 1XNZA 2P9AA 4B28A 4R60A 4RGZ1 4S2TP 2OKNA 5CLSA 2ADUA 1MATA 4PNCA 1XGOA 1QZYA 2GZ5A 3IG4A 1R5GA 4FUKA 4U6JA 3TB5A 2BWYA 1QXZA 2MATA 3L7GA 4U75A 3CB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CDV A;  4IKS A;  5FCF A;  3L24 A;  4RZZ A;  2BWU A;  2B3L A;  1WL9 A;  1R5H A;  1KQ0 A;  2BHC A;  5CDE A;  1WKM A;  3BIP A;  4JUQ A;  2BHA A;  2Q96 A;  3ROR A;  2EVC A;  4FLL A;  5FCH A;  5CNX A;  1KP0 A;  3PKE A;  4QR8 A;  4PV4 A;  4ZWU A;  2NQ7 A;  2V6C A;  1A16 A;  1WY2 A;  1YW9 A;  4A6V A;  3FMR A;  4IPA A;  3Q6D A;  4U6Z A;  4HXX A;  4IKR A;  3MX6 A;  3S6B A;  1XGS A;  1BOA A;  1B6A A;  2Q93 A;  4IKT A;  3IU9 A;  3PKB A;  4IDY A;  5D6E A;  5CDL A;  2GGB A;  2V3X A;  2GGC A;  1W7V A;  2EA2 A;  2B3H A;  1YW7 A;  3PKD A;  1YJ3 A;  4EGE A;  2NQ6 A;  2Q92 A;  2GA2 A;  4U76 A;  4U73 A;  2BN7 A;  1C22 A;  1R58 A;  2DFI A;  3PKA A;  2Q8K A;  2IW2 A;  1C24 A;  3FM3 A;  4KM3 A;  1WN1 A;  4A6W A;  1WL6 A;  1XGM A;  1QXW A;  2G6P A;  2Q94 A;  4ZWO A;  2HOW A;  4MAT A;  2BH3 A;  2V3Y A;  4U6W A;  5CE6 A;  5JHU A;  5D6F A;  1W2M A;  4RZY A;  5JFR A;  4IU6 A;  2BHD A;  4U6E A;  2GTX A;  4S00 A;  2BWX A;  1O0X A;  3IU7 A;  4FLI A;  2ZSG A;  4U6C A;  5CIK A;  2BB7 A;  3MAT A;  4ZWP A;  1WLR A;  2GG2 A;  4Z7M A;  2OAZ A;  2Q95 A;  1JAW A;  1C27 A;  2BWS A;  2GU7 A;  1C21 A;  4S2R P;  2BWW A;  2EA4 A;  1CHM A;  2GG9 A;  4IKU A;  2GG0 A;  3FMQ A;  2GG5 A;  2GU4 A;  1QXY A;  3RVA A;  4IEC A;  4U70 A;  3CTZ A;  5JI6 A;  1PV9 A;  2GU5 A;  2BWV A;  1YVM A;  1Y1N A;  1N51 A;  4FLJ A;  4U71 A;  1YW8 A;  1C23 A;  2P99 A;  4S01 A;  1WBQ A;  3BIT A;  3MR1 A;  4U1B A;  3PKC A;  5E5B A;  2BHB A;  2GG3 A;  2EVM A;  4FKC A;  3CB5 A;  4U69 A;  4FLK A;  4OOK A;  3IU8 A;  4IF7 A;  1BN5 A;  1M35 A;  2EVO A;  4FO8 A;  2GU6 A;  2P98 A;  2V3Z A;  3D27 A;  4FO7 A;  1KQ9 A;  1B59 A;  2BWT A;  2GG8 A;  4ZNG A;  3TAV A;  2B3K A;  2GG7 A;  3BIQ A;  1XGN A;  1XNZ A;  2P9A A;  4B28 A;  4R60 A;  4RGZ 1;  4S2T P;  2OKN A;  5CLS A;  2ADU A;  1MAT A;  4PNC A;  1XGO A;  1QZY A;  2GZ5 A;  3IG4 A;  1R5G A;  4FUK A;  4U6J A;  3TB5 A;  2BWY A;  1QXZ A;  2MAT A;  3L7G A;  4U75 A;  3CB6 A; 
#chains in the Genus database with same CATH topology
 5CDV A;  4IKS A;  5FCF A;  3L24 A;  4RZZ A;  2BWU A;  2B3L A;  1WL9 A;  1R5H A;  1KQ0 A;  2BHC A;  5CDE A;  1WKM A;  3BIP A;  4JUQ A;  2BHA A;  2Q96 A;  3ROR A;  2EVC A;  4FLL A;  5FCH A;  5CNX A;  1KP0 A;  3PKE A;  4QR8 A;  4PV4 A;  4ZWU A;  2NQ7 A;  2V6C A;  1A16 A;  1WY2 A;  1YW9 A;  4A6V A;  3FMR A;  4IPA A;  3Q6D A;  4U6Z A;  4HXX A;  4IKR A;  3MX6 A;  3S6B A;  1XGS A;  1BOA A;  1B6A A;  2Q93 A;  4IKT A;  3IU9 A;  3PKB A;  4IDY A;  5D6E A;  5CDL A;  2GGB A;  2V3X A;  2GGC A;  1W7V A;  2EA2 A;  2B3H A;  1YW7 A;  3PKD A;  1YJ3 A;  4EGE A;  2NQ6 A;  2Q92 A;  2GA2 A;  4U76 A;  4U73 A;  2BN7 A;  1C22 A;  1R58 A;  2DFI A;  3PKA A;  2Q8K A;  2IW2 A;  1C24 A;  3FM3 A;  4KM3 A;  1WN1 A;  4A6W A;  1WL6 A;  1XGM A;  1QXW A;  2G6P A;  2Q94 A;  4ZWO A;  2HOW A;  4MAT A;  2BH3 A;  2V3Y A;  4U6W A;  5CE6 A;  5JHU A;  5D6F A;  1W2M A;  4RZY A;  5JFR A;  4IU6 A;  2BHD A;  4U6E A;  2GTX A;  4S00 A;  2BWX A;  1O0X A;  3IU7 A;  4FLI A;  2ZSG A;  4U6C A;  5CIK A;  2BB7 A;  3MAT A;  4ZWP A;  1WLR A;  2GG2 A;  4Z7M A;  2OAZ A;  2Q95 A;  1JAW A;  1C27 A;  2BWS A;  2GU7 A;  1C21 A;  4S2R P;  2BWW A;  2EA4 A;  1CHM A;  2GG9 A;  4IKU A;  2GG0 A;  3FMQ A;  2GG5 A;  2GU4 A;  1QXY A;  3RVA A;  4IEC A;  4U70 A;  3CTZ A;  5JI6 A;  1PV9 A;  2GU5 A;  2BWV A;  1YVM A;  1Y1N A;  1N51 A;  4FLJ A;  4U71 A;  1YW8 A;  1C23 A;  2P99 A;  4S01 A;  1WBQ A;  3BIT A;  3MR1 A;  4U1B A;  3PKC A;  5E5B A;  2BHB A;  2GG3 A;  2EVM A;  4FKC A;  3CB5 A;  4U69 A;  4FLK A;  4OOK A;  3IU8 A;  4IF7 A;  1BN5 A;  1M35 A;  2EVO A;  4FO8 A;  2GU6 A;  2P98 A;  2V3Z A;  3D27 A;  4FO7 A;  1KQ9 A;  1B59 A;  2BWT A;  2GG8 A;  4ZNG A;  3TAV A;  2B3K A;  2GG7 A;  3BIQ A;  1XGN A;  1XNZ A;  2P9A A;  4B28 A;  4R60 A;  4RGZ 1;  4S2T P;  2OKN A;  5CLS A;  2ADU A;  1MAT A;  4PNC A;  1XGO A;  1QZY A;  2GZ5 A;  3IG4 A;  1R5G A;  4FUK A;  4U6J A;  3TB5 A;  2BWY A;  1QXZ A;  2MAT A;  3L7G A;  4U75 A;  3CB6 A; 
#chains in the Genus database with same CATH homology
 5CDV A;  4IKS A;  5FCF A;  3L24 A;  4RZZ A;  2BWU A;  2B3L A;  1WL9 A;  1R5H A;  1KQ0 A;  2BHC A;  5CDE A;  1WKM A;  3BIP A;  4JUQ A;  2BHA A;  2Q96 A;  3ROR A;  2EVC A;  4FLL A;  5FCH A;  5CNX A;  1KP0 A;  3PKE A;  4QR8 A;  4PV4 A;  4ZWU A;  2NQ7 A;  2V6C A;  1A16 A;  1WY2 A;  1YW9 A;  4A6V A;  3FMR A;  4IPA A;  3Q6D A;  4U6Z A;  4HXX A;  4IKR A;  3MX6 A;  3S6B A;  1XGS A;  1BOA A;  1B6A A;  2Q93 A;  4IKT A;  3IU9 A;  3PKB A;  4IDY A;  5D6E A;  5CDL A;  2GGB A;  2V3X A;  2GGC A;  1W7V A;  2EA2 A;  2B3H A;  1YW7 A;  3PKD A;  1YJ3 A;  4EGE A;  2NQ6 A;  2Q92 A;  2GA2 A;  4U76 A;  4U73 A;  2BN7 A;  1C22 A;  1R58 A;  2DFI A;  3PKA A;  2Q8K A;  2IW2 A;  1C24 A;  3FM3 A;  4KM3 A;  1WN1 A;  4A6W A;  1WL6 A;  1XGM A;  1QXW A;  2G6P A;  2Q94 A;  4ZWO A;  2HOW A;  4MAT A;  2BH3 A;  2V3Y A;  4U6W A;  5CE6 A;  5JHU A;  5D6F A;  1W2M A;  4RZY A;  5JFR A;  4IU6 A;  2BHD A;  4U6E A;  2GTX A;  4S00 A;  2BWX A;  1O0X A;  3IU7 A;  4FLI A;  2ZSG A;  4U6C A;  5CIK A;  2BB7 A;  3MAT A;  4ZWP A;  1WLR A;  2GG2 A;  4Z7M A;  2OAZ A;  2Q95 A;  1JAW A;  1C27 A;  2BWS A;  2GU7 A;  1C21 A;  4S2R P;  2BWW A;  2EA4 A;  1CHM A;  2GG9 A;  4IKU A;  2GG0 A;  3FMQ A;  2GG5 A;  2GU4 A;  1QXY A;  3RVA A;  4IEC A;  4U70 A;  3CTZ A;  5JI6 A;  1PV9 A;  2GU5 A;  2BWV A;  1YVM A;  1Y1N A;  1N51 A;  4FLJ A;  4U71 A;  1YW8 A;  1C23 A;  2P99 A;  4S01 A;  1WBQ A;  3BIT A;  3MR1 A;  4U1B A;  3PKC A;  5E5B A;  2BHB A;  2GG3 A;  2EVM A;  4FKC A;  3CB5 A;  4U69 A;  4FLK A;  4OOK A;  3IU8 A;  4IF7 A;  1BN5 A;  1M35 A;  2EVO A;  4FO8 A;  2GU6 A;  2P98 A;  2V3Z A;  3D27 A;  4FO7 A;  1KQ9 A;  1B59 A;  2BWT A;  2GG8 A;  4ZNG A;  3TAV A;  2B3K A;  2GG7 A;  3BIQ A;  1XGN A;  1XNZ A;  2P9A A;  4B28 A;  4R60 A;  4RGZ 1;  4S2T P;  2OKN A;  5CLS A;  2ADU A;  1MAT A;  4PNC A;  1XGO A;  1QZY A;  2GZ5 A;  3IG4 A;  1R5G A;  4FUK A;  4U6J A;  3TB5 A;  2BWY A;  1QXZ A;  2MAT A;  3L7G A;  4U75 A;  3CB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...