1QXYA

Crystal structure of s. aureus methionine aminopeptidase in complex with a ketoheterocycle 618
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
b'MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQNDLKVIKNLTGHGVGLSLHEAPAHVLNYFDPKDKTLLTEGMVLAIEPFISSNASFVTEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methionyl aminopeptidase
publication title Crystal structures of staphylococcusaureus methionine aminopeptidase complexed with keto heterocycle and aminoketone inhibitors reveal the formation of a tetrahedral intermediate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 81
structure length 249
sequence length 249
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1qxyA00
2Q8KA 1C23A 2BWWA 4FLKA 5FCHA 2B3HA 1O0XA 1QZYA 3RORA 2BWTA 4S01A 5CIKA 4FKCA 1KP0A 4QR8A 2BWUA 4FUKA 4ZWUA 2GU4A 3TAVA 1C22A 2MATA 4U76A 1W2MA 1WL9A 4FLLA 4IPAA 3CB6A 2OAZA 2EVMA 2P98A 4JUQA 4U71A 2GG2A 1WY2A 4IKSA 3IU8A 3IU7A 1XGNA 1XNZA 2BWYA 2NQ7A 4R60A 5CDLA 3RVAA 4U73A 1W7VA 4U6WA 5JHUA 4Z7MA 2GU6A 3PKBA 3PKAA 1BOAA 2ZSGA 2BHDA 4ZNGA 1B6AA 2BN7A 4PNCA 1C21A 2BWVA 5JI6A 1JAWA 1M35A 4U69A 3MR1A 5CDEA 2G6PA 3FMRA 4U6ZA 5JFRA 1XGSA 2GG7A 2Q95A 3D27A 5E5BA 1WN1A 4IKRA 4IKUA 4RZYA 2V3XA 2GG0A 2GA2A 1YW8A 2B3LA 5D6EA 2P9AA 1YW7A 4PV4A 4S00A 1YW9A 1QXYA 2Q92A 3BIPA 3MATA 3Q6DA 1WLRA 5D6FA 5CNXA 3FMQA 4U6CA 4KM3A 1PV9A 4B28A 1XGOA 1C27A 1CHMA 4RZZA 2BWSA 3PKEA 4U75A 2EVCA 2OKNA 4IKTA 2GG3A 4FLJA 2GZ5A 3TB5A 3CTZA 2GGBA 4A6WA 4S2TP 2Q96A 2V3YA 2V6CA 1A16A 1R58A 3FM3A 2ADUA 2BHCA 1R5HA 2V3ZA 1KQ9A 2DFIA 4RGZ1 3PKCA 2NQ6A 2GTXA 1Y1NA 3MX6A 1WBQA 3IU9A 2HOWA 2EA2A 2BHBA 2IW2A 2GGCA 3L24A 2Q93A 4MATA 1YVMA 1N51A 1QXWA 2GG9A 3CB5A 4IF7A 1B59A 5FCFA 4FO8A 1YJ3A 2P99A 1MATA 4A6VA 3IG4A 2BWXA 1R5GA 3S6BA 2GU5A 4U70A 1QXZA 4ZWOA 2Q94A 5CDVA 4FO7A 5CLSA 3PKDA 1WL6A 2EA4A 1BN5A 2GU7A 4U6EA 5CE6A 4IDYA 4ZWPA 4HXXA 1KQ0A 2GG8A 2GG5A 2EVOA 4S2RP 1WKMA 4IU6A 4FLIA 2BH3A 2BHAA 3BIQA 4IECA 1XGMA 2B3KA 3BITA 4U6JA 3L7GA 4U1BA 2BB7A 4EGEA 1C24A 4OOKA
chains in the Genus database with same CATH superfamily
2Q8KA 1C23A 2BWWA 4FLKA 5FCHA 2B3HA 1O0XA 1QZYA 3RORA 2BWTA 4S01A 5CIKA 4FKCA 1KP0A 4QR8A 2BWUA 4FUKA 4ZWUA 2GU4A 3TAVA 1C22A 2MATA 4U76A 1W2MA 1WL9A 4FLLA 4IPAA 3CB6A 2OAZA 2EVMA 2P98A 4JUQA 4U71A 2GG2A 1WY2A 4IKSA 3IU8A 3IU7A 1XGNA 1XNZA 2BWYA 2NQ7A 4R60A 5CDLA 3RVAA 4U73A 1W7VA 4U6WA 5JHUA 4Z7MA 2GU6A 3PKBA 3PKAA 1BOAA 2ZSGA 2BHDA 4ZNGA 1B6AA 2BN7A 4PNCA 1C21A 2BWVA 5JI6A 1JAWA 1M35A 4U69A 3MR1A 5CDEA 2G6PA 3FMRA 4U6ZA 5JFRA 1XGSA 2GG7A 2Q95A 3D27A 5E5BA 1WN1A 4IKRA 4IKUA 4RZYA 2V3XA 2GG0A 2GA2A 1YW8A 2B3LA 5D6EA 2P9AA 1YW7A 4PV4A 4S00A 1YW9A 1QXYA 2Q92A 3BIPA 3MATA 3Q6DA 1WLRA 5D6FA 5CNXA 3FMQA 4U6CA 4KM3A 1PV9A 4B28A 1XGOA 1C27A 1CHMA 4RZZA 2BWSA 3PKEA 4U75A 2EVCA 2OKNA 4IKTA 2GG3A 4FLJA 2GZ5A 3TB5A 3CTZA 2GGBA 4A6WA 4S2TP 2Q96A 2V3YA 2V6CA 1A16A 1R58A 3FM3A 2ADUA 2BHCA 1R5HA 2V3ZA 1KQ9A 2DFIA 4RGZ1 3PKCA 2NQ6A 2GTXA 1Y1NA 3MX6A 1WBQA 3IU9A 2HOWA 2EA2A 2BHBA 2IW2A 2GGCA 3L24A 2Q93A 4MATA 1YVMA 1N51A 1QXWA 2GG9A 3CB5A 4IF7A 1B59A 5FCFA 4FO8A 1YJ3A 2P99A 1MATA 4A6VA 3IG4A 2BWXA 1R5GA 3S6BA 2GU5A 4U70A 1QXZA 4ZWOA 2Q94A 5CDVA 4FO7A 5CLSA 3PKDA 1WL6A 2EA4A 1BN5A 2GU7A 4U6EA 5CE6A 4IDYA 4ZWPA 4HXXA 1KQ0A 2GG8A 2GG5A 2EVOA 4S2RP 1WKMA 4IU6A 4FLIA 2BH3A 2BHAA 3BIQA 4IECA 1XGMA 2B3KA 3BITA 4U6JA 3L7GA 4U1BA 2BB7A 4EGEA 1C24A 4OOKA
chains in the Genus database with same CATH topology
2Q8KA 1C23A 2BWWA 4FLKA 5FCHA 2B3HA 1O0XA 1QZYA 3RORA 2BWTA 4S01A 5CIKA 4FKCA 1KP0A 4QR8A 2BWUA 4FUKA 4ZWUA 2GU4A 3TAVA 1C22A 2MATA 4U76A 1W2MA 1WL9A 4FLLA 4IPAA 3CB6A 2OAZA 2EVMA 2P98A 4JUQA 4U71A 2GG2A 1WY2A 4IKSA 3IU8A 3IU7A 1XGNA 1XNZA 2BWYA 2NQ7A 4R60A 5CDLA 3RVAA 4U73A 1W7VA 4U6WA 5JHUA 4Z7MA 2GU6A 3PKBA 3PKAA 1BOAA 2ZSGA 2BHDA 4ZNGA 1B6AA 2BN7A 4PNCA 1C21A 2BWVA 5JI6A 1JAWA 1M35A 4U69A 3MR1A 5CDEA 2G6PA 3FMRA 4U6ZA 5JFRA 1XGSA 2GG7A 2Q95A 3D27A 5E5BA 1WN1A 4IKRA 4IKUA 4RZYA 2V3XA 2GG0A 2GA2A 1YW8A 2B3LA 5D6EA 2P9AA 1YW7A 4PV4A 4S00A 1YW9A 1QXYA 2Q92A 3BIPA 3MATA 3Q6DA 1WLRA 5D6FA 5CNXA 3FMQA 4U6CA 4KM3A 1PV9A 4B28A 1XGOA 1C27A 1CHMA 4RZZA 2BWSA 3PKEA 4U75A 2EVCA 2OKNA 4IKTA 2GG3A 4FLJA 2GZ5A 3TB5A 3CTZA 2GGBA 4A6WA 4S2TP 2Q96A 2V3YA 2V6CA 1A16A 1R58A 3FM3A 2ADUA 2BHCA 1R5HA 2V3ZA 1KQ9A 2DFIA 4RGZ1 3PKCA 2NQ6A 2GTXA 1Y1NA 3MX6A 1WBQA 3IU9A 2HOWA 2EA2A 2BHBA 2IW2A 2GGCA 3L24A 2Q93A 4MATA 1YVMA 1N51A 1QXWA 2GG9A 3CB5A 4IF7A 1B59A 5FCFA 4FO8A 1YJ3A 2P99A 1MATA 4A6VA 3IG4A 2BWXA 1R5GA 3S6BA 2GU5A 4U70A 1QXZA 4ZWOA 2Q94A 5CDVA 4FO7A 5CLSA 3PKDA 1WL6A 2EA4A 1BN5A 2GU7A 4U6EA 5CE6A 4IDYA 4ZWPA 4HXXA 1KQ0A 2GG8A 2GG5A 2EVOA 4S2RP 1WKMA 4IU6A 4FLIA 2BH3A 2BHAA 3BIQA 4IECA 1XGMA 2B3KA 3BITA 4U6JA 3L7GA 4U1BA 2BB7A 4EGEA 1C24A 4OOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8K A;  1C23 A;  2BWW A;  4FLK A;  5FCH A;  2B3H A;  1O0X A;  1QZY A;  3ROR A;  2BWT A;  4S01 A;  5CIK A;  4FKC A;  1KP0 A;  4QR8 A;  2BWU A;  4FUK A;  4ZWU A;  2GU4 A;  3TAV A;  1C22 A;  2MAT A;  4U76 A;  1W2M A;  1WL9 A;  4FLL A;  4IPA A;  3CB6 A;  2OAZ A;  2EVM A;  2P98 A;  4JUQ A;  4U71 A;  2GG2 A;  1WY2 A;  4IKS A;  3IU8 A;  3IU7 A;  1XGN A;  1XNZ A;  2BWY A;  2NQ7 A;  4R60 A;  5CDL A;  3RVA A;  4U73 A;  1W7V A;  4U6W A;  5JHU A;  4Z7M A;  2GU6 A;  3PKB A;  3PKA A;  1BOA A;  2ZSG A;  2BHD A;  4ZNG A;  1B6A A;  2BN7 A;  4PNC A;  1C21 A;  2BWV A;  5JI6 A;  1JAW A;  1M35 A;  4U69 A;  3MR1 A;  5CDE A;  2G6P A;  3FMR A;  4U6Z A;  5JFR A;  1XGS A;  2GG7 A;  2Q95 A;  3D27 A;  5E5B A;  1WN1 A;  4IKR A;  4IKU A;  4RZY A;  2V3X A;  2GG0 A;  2GA2 A;  1YW8 A;  2B3L A;  5D6E A;  2P9A A;  1YW7 A;  4PV4 A;  4S00 A;  1YW9 A;  1QXY A;  2Q92 A;  3BIP A;  3MAT A;  3Q6D A;  1WLR A;  5D6F A;  5CNX A;  3FMQ A;  4U6C A;  4KM3 A;  1PV9 A;  4B28 A;  1XGO A;  1C27 A;  1CHM A;  4RZZ A;  2BWS A;  3PKE A;  4U75 A;  2EVC A;  2OKN A;  4IKT A;  2GG3 A;  4FLJ A;  2GZ5 A;  3TB5 A;  3CTZ A;  2GGB A;  4A6W A;  4S2T P;  2Q96 A;  2V3Y A;  2V6C A;  1A16 A;  1R58 A;  3FM3 A;  2ADU A;  2BHC A;  1R5H A;  2V3Z A;  1KQ9 A;  2DFI A;  4RGZ 1;  3PKC A;  2NQ6 A;  2GTX A;  1Y1N A;  3MX6 A;  1WBQ A;  3IU9 A;  2HOW A;  2EA2 A;  2BHB A;  2IW2 A;  2GGC A;  3L24 A;  2Q93 A;  4MAT A;  1YVM A;  1N51 A;  1QXW A;  2GG9 A;  3CB5 A;  4IF7 A;  1B59 A;  5FCF A;  4FO8 A;  1YJ3 A;  2P99 A;  1MAT A;  4A6V A;  3IG4 A;  2BWX A;  1R5G A;  3S6B A;  2GU5 A;  4U70 A;  1QXZ A;  4ZWO A;  2Q94 A;  5CDV A;  4FO7 A;  5CLS A;  3PKD A;  1WL6 A;  2EA4 A;  1BN5 A;  2GU7 A;  4U6E A;  5CE6 A;  4IDY A;  4ZWP A;  4HXX A;  1KQ0 A;  2GG8 A;  2GG5 A;  2EVO A;  4S2R P;  1WKM A;  4IU6 A;  4FLI A;  2BH3 A;  2BHA A;  3BIQ A;  4IEC A;  1XGM A;  2B3K A;  3BIT A;  4U6J A;  3L7G A;  4U1B A;  2BB7 A;  4EGE A;  1C24 A;  4OOK A; 
#chains in the Genus database with same CATH topology
 2Q8K A;  1C23 A;  2BWW A;  4FLK A;  5FCH A;  2B3H A;  1O0X A;  1QZY A;  3ROR A;  2BWT A;  4S01 A;  5CIK A;  4FKC A;  1KP0 A;  4QR8 A;  2BWU A;  4FUK A;  4ZWU A;  2GU4 A;  3TAV A;  1C22 A;  2MAT A;  4U76 A;  1W2M A;  1WL9 A;  4FLL A;  4IPA A;  3CB6 A;  2OAZ A;  2EVM A;  2P98 A;  4JUQ A;  4U71 A;  2GG2 A;  1WY2 A;  4IKS A;  3IU8 A;  3IU7 A;  1XGN A;  1XNZ A;  2BWY A;  2NQ7 A;  4R60 A;  5CDL A;  3RVA A;  4U73 A;  1W7V A;  4U6W A;  5JHU A;  4Z7M A;  2GU6 A;  3PKB A;  3PKA A;  1BOA A;  2ZSG A;  2BHD A;  4ZNG A;  1B6A A;  2BN7 A;  4PNC A;  1C21 A;  2BWV A;  5JI6 A;  1JAW A;  1M35 A;  4U69 A;  3MR1 A;  5CDE A;  2G6P A;  3FMR A;  4U6Z A;  5JFR A;  1XGS A;  2GG7 A;  2Q95 A;  3D27 A;  5E5B A;  1WN1 A;  4IKR A;  4IKU A;  4RZY A;  2V3X A;  2GG0 A;  2GA2 A;  1YW8 A;  2B3L A;  5D6E A;  2P9A A;  1YW7 A;  4PV4 A;  4S00 A;  1YW9 A;  1QXY A;  2Q92 A;  3BIP A;  3MAT A;  3Q6D A;  1WLR A;  5D6F A;  5CNX A;  3FMQ A;  4U6C A;  4KM3 A;  1PV9 A;  4B28 A;  1XGO A;  1C27 A;  1CHM A;  4RZZ A;  2BWS A;  3PKE A;  4U75 A;  2EVC A;  2OKN A;  4IKT A;  2GG3 A;  4FLJ A;  2GZ5 A;  3TB5 A;  3CTZ A;  2GGB A;  4A6W A;  4S2T P;  2Q96 A;  2V3Y A;  2V6C A;  1A16 A;  1R58 A;  3FM3 A;  2ADU A;  2BHC A;  1R5H A;  2V3Z A;  1KQ9 A;  2DFI A;  4RGZ 1;  3PKC A;  2NQ6 A;  2GTX A;  1Y1N A;  3MX6 A;  1WBQ A;  3IU9 A;  2HOW A;  2EA2 A;  2BHB A;  2IW2 A;  2GGC A;  3L24 A;  2Q93 A;  4MAT A;  1YVM A;  1N51 A;  1QXW A;  2GG9 A;  3CB5 A;  4IF7 A;  1B59 A;  5FCF A;  4FO8 A;  1YJ3 A;  2P99 A;  1MAT A;  4A6V A;  3IG4 A;  2BWX A;  1R5G A;  3S6B A;  2GU5 A;  4U70 A;  1QXZ A;  4ZWO A;  2Q94 A;  5CDV A;  4FO7 A;  5CLS A;  3PKD A;  1WL6 A;  2EA4 A;  1BN5 A;  2GU7 A;  4U6E A;  5CE6 A;  4IDY A;  4ZWP A;  4HXX A;  1KQ0 A;  2GG8 A;  2GG5 A;  2EVO A;  4S2R P;  1WKM A;  4IU6 A;  4FLI A;  2BH3 A;  2BHA A;  3BIQ A;  4IEC A;  1XGM A;  2B3K A;  3BIT A;  4U6J A;  3L7G A;  4U1B A;  2BB7 A;  4EGE A;  1C24 A;  4OOK A; 
#chains in the Genus database with same CATH homology
 2Q8K A;  1C23 A;  2BWW A;  4FLK A;  5FCH A;  2B3H A;  1O0X A;  1QZY A;  3ROR A;  2BWT A;  4S01 A;  5CIK A;  4FKC A;  1KP0 A;  4QR8 A;  2BWU A;  4FUK A;  4ZWU A;  2GU4 A;  3TAV A;  1C22 A;  2MAT A;  4U76 A;  1W2M A;  1WL9 A;  4FLL A;  4IPA A;  3CB6 A;  2OAZ A;  2EVM A;  2P98 A;  4JUQ A;  4U71 A;  2GG2 A;  1WY2 A;  4IKS A;  3IU8 A;  3IU7 A;  1XGN A;  1XNZ A;  2BWY A;  2NQ7 A;  4R60 A;  5CDL A;  3RVA A;  4U73 A;  1W7V A;  4U6W A;  5JHU A;  4Z7M A;  2GU6 A;  3PKB A;  3PKA A;  1BOA A;  2ZSG A;  2BHD A;  4ZNG A;  1B6A A;  2BN7 A;  4PNC A;  1C21 A;  2BWV A;  5JI6 A;  1JAW A;  1M35 A;  4U69 A;  3MR1 A;  5CDE A;  2G6P A;  3FMR A;  4U6Z A;  5JFR A;  1XGS A;  2GG7 A;  2Q95 A;  3D27 A;  5E5B A;  1WN1 A;  4IKR A;  4IKU A;  4RZY A;  2V3X A;  2GG0 A;  2GA2 A;  1YW8 A;  2B3L A;  5D6E A;  2P9A A;  1YW7 A;  4PV4 A;  4S00 A;  1YW9 A;  1QXY A;  2Q92 A;  3BIP A;  3MAT A;  3Q6D A;  1WLR A;  5D6F A;  5CNX A;  3FMQ A;  4U6C A;  4KM3 A;  1PV9 A;  4B28 A;  1XGO A;  1C27 A;  1CHM A;  4RZZ A;  2BWS A;  3PKE A;  4U75 A;  2EVC A;  2OKN A;  4IKT A;  2GG3 A;  4FLJ A;  2GZ5 A;  3TB5 A;  3CTZ A;  2GGB A;  4A6W A;  4S2T P;  2Q96 A;  2V3Y A;  2V6C A;  1A16 A;  1R58 A;  3FM3 A;  2ADU A;  2BHC A;  1R5H A;  2V3Z A;  1KQ9 A;  2DFI A;  4RGZ 1;  3PKC A;  2NQ6 A;  2GTX A;  1Y1N A;  3MX6 A;  1WBQ A;  3IU9 A;  2HOW A;  2EA2 A;  2BHB A;  2IW2 A;  2GGC A;  3L24 A;  2Q93 A;  4MAT A;  1YVM A;  1N51 A;  1QXW A;  2GG9 A;  3CB5 A;  4IF7 A;  1B59 A;  5FCF A;  4FO8 A;  1YJ3 A;  2P99 A;  1MAT A;  4A6V A;  3IG4 A;  2BWX A;  1R5G A;  3S6B A;  2GU5 A;  4U70 A;  1QXZ A;  4ZWO A;  2Q94 A;  5CDV A;  4FO7 A;  5CLS A;  3PKD A;  1WL6 A;  2EA4 A;  1BN5 A;  2GU7 A;  4U6E A;  5CE6 A;  4IDY A;  4ZWP A;  4HXX A;  1KQ0 A;  2GG8 A;  2GG5 A;  2EVO A;  4S2R P;  1WKM A;  4IU6 A;  4FLI A;  2BH3 A;  2BHA A;  3BIQ A;  4IEC A;  1XGM A;  2B3K A;  3BIT A;  4U6J A;  3L7G A;  4U1B A;  2BB7 A;  4EGE A;  1C24 A;  4OOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...