2GG5A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 81
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg5A00
5CE6A 1KQ0A 3TB5A 5CDVA 1C23A 1YVMA 2GGCA 3MX6A 2BWTA 1WBQA 2DFIA 1WY2A 4ZWUA 2Q96A 5E5BA 1WKMA 2BWUA 4ZWPA 1B59A 3D27A 4IKTA 4U1BA 2NQ6A 4FO8A 2Q93A 3BIQA 2P98A 4IU6A 4U76A 2V3YA 2Q92A 4U6ZA 2Q94A 4IKRA 4B28A 4OOKA 4U6WA 1XGMA 5CLSA 4U6EA 2EVMA 2BWSA 2EVCA 4FLJA 2OAZA 4S00A 4S2RP 4KM3A 1YJ3A 5FCFA 2ZSGA 3PKAA 4R60A 3IU7A 4A6VA 4IF7A 2BH3A 2B3KA 2P99A 4QR8A 4Z7MA 1QZYA 2BHDA 2BWVA 5CIKA 3PKBA 1XGSA 4RGZ1 1WL9A 1M35A 2EA4A 3IU9A 3PKCA 3S6BA 3IG4A 4FLIA 3MR1A 5CDLA 1Y1NA 4FKCA 5FCHA 5D6FA 5JFRA 2BB7A 5D6EA 1QXWA 1MATA 1O0XA 3MATA 4U71A 2GGBA 2BWWA 2GZ5A 2IW2A 3IU8A 4FO7A 4PNCA 2P9AA 2ADUA 5CDEA 1WLRA 4IECA 4RZZA 2Q8KA 1C21A 3RVAA 2V6CA 3L7GA 2GG9A 4IKSA 1R58A 2GG5A 3BIPA 1XGNA 3PKDA 3FMRA 1PV9A 2BWYA 1CHMA 1KQ9A 1N51A 2NQ7A 2GG2A 5CNXA 4FUKA 1QXYA 2V3ZA 2BHBA 5JHUA 4FLLA 4U69A 4ZWOA 3CB6A 4A6WA 2B3HA 2GU7A 4HXXA 1BOAA 2GG8A 4S2TP 3TAVA 4IKUA 1C24A 5JI6A 2GTXA 4IPAA 3CB5A 3FM3A 4JUQA 2HOWA 1C27A 2BN7A 4U73A 2GG3A 3BITA 2GU4A 3CTZA 3FMQA 4IDYA 3PKEA 1WL6A 1W2MA 1JAWA 4U75A 2BHAA 2BWXA 2B3LA 3L24A 4FLKA 4PV4A 2GU5A 1XNZA 2G6PA 2GG7A 1R5HA 2GA2A 2GG0A 4MATA 4U70A 2Q95A 1BN5A 1YW8A 4RZYA 1YW9A 2EVOA 1B6AA 3RORA 2GU6A 1QXZA 2BHCA 2OKNA 2MATA 4EGEA 2V3XA 1W7VA 1KP0A 4U6CA 1C22A 4S01A 2EA2A 1A16A 1YW7A 1R5GA 3Q6DA 1WN1A 4ZNGA 1XGOA 4U6JA
chains in the Genus database with same CATH superfamily
5CE6A 1KQ0A 3TB5A 5CDVA 1C23A 1YVMA 2GGCA 3MX6A 2BWTA 1WBQA 2DFIA 1WY2A 4ZWUA 2Q96A 5E5BA 1WKMA 2BWUA 4ZWPA 1B59A 3D27A 4IKTA 4U1BA 2NQ6A 4FO8A 2Q93A 3BIQA 2P98A 4IU6A 4U76A 2V3YA 2Q92A 4U6ZA 2Q94A 4IKRA 4B28A 4OOKA 4U6WA 1XGMA 5CLSA 4U6EA 2EVMA 2BWSA 2EVCA 4FLJA 2OAZA 4S00A 4S2RP 4KM3A 1YJ3A 5FCFA 2ZSGA 3PKAA 4R60A 3IU7A 4A6VA 4IF7A 2BH3A 2B3KA 2P99A 4QR8A 4Z7MA 1QZYA 2BHDA 2BWVA 5CIKA 3PKBA 1XGSA 4RGZ1 1WL9A 1M35A 2EA4A 3IU9A 3PKCA 3S6BA 3IG4A 4FLIA 3MR1A 5CDLA 1Y1NA 4FKCA 5FCHA 5D6FA 5JFRA 2BB7A 5D6EA 1QXWA 1MATA 1O0XA 3MATA 4U71A 2GGBA 2BWWA 2GZ5A 2IW2A 3IU8A 4FO7A 4PNCA 2P9AA 2ADUA 5CDEA 1WLRA 4IECA 4RZZA 2Q8KA 1C21A 3RVAA 2V6CA 3L7GA 2GG9A 4IKSA 1R58A 2GG5A 3BIPA 1XGNA 3PKDA 3FMRA 1PV9A 2BWYA 1CHMA 1KQ9A 1N51A 2NQ7A 2GG2A 5CNXA 4FUKA 1QXYA 2V3ZA 2BHBA 5JHUA 4FLLA 4U69A 4ZWOA 3CB6A 4A6WA 2B3HA 2GU7A 4HXXA 1BOAA 2GG8A 4S2TP 3TAVA 4IKUA 1C24A 5JI6A 2GTXA 4IPAA 3CB5A 3FM3A 4JUQA 2HOWA 1C27A 2BN7A 4U73A 2GG3A 3BITA 2GU4A 3CTZA 3FMQA 4IDYA 3PKEA 1WL6A 1W2MA 1JAWA 4U75A 2BHAA 2BWXA 2B3LA 3L24A 4FLKA 4PV4A 2GU5A 1XNZA 2G6PA 2GG7A 1R5HA 2GA2A 2GG0A 4MATA 4U70A 2Q95A 1BN5A 1YW8A 4RZYA 1YW9A 2EVOA 1B6AA 3RORA 2GU6A 1QXZA 2BHCA 2OKNA 2MATA 4EGEA 2V3XA 1W7VA 1KP0A 4U6CA 1C22A 4S01A 2EA2A 1A16A 1YW7A 1R5GA 3Q6DA 1WN1A 4ZNGA 1XGOA 4U6JA
chains in the Genus database with same CATH topology
5CE6A 1KQ0A 3TB5A 5CDVA 1C23A 1YVMA 2GGCA 3MX6A 2BWTA 1WBQA 2DFIA 1WY2A 4ZWUA 2Q96A 5E5BA 1WKMA 2BWUA 4ZWPA 1B59A 3D27A 4IKTA 4U1BA 2NQ6A 4FO8A 2Q93A 3BIQA 2P98A 4IU6A 4U76A 2V3YA 2Q92A 4U6ZA 2Q94A 4IKRA 4B28A 4OOKA 4U6WA 1XGMA 5CLSA 4U6EA 2EVMA 2BWSA 2EVCA 4FLJA 2OAZA 4S00A 4S2RP 4KM3A 1YJ3A 5FCFA 2ZSGA 3PKAA 4R60A 3IU7A 4A6VA 4IF7A 2BH3A 2B3KA 2P99A 4QR8A 4Z7MA 1QZYA 2BHDA 2BWVA 5CIKA 3PKBA 1XGSA 4RGZ1 1WL9A 1M35A 2EA4A 3IU9A 3PKCA 3S6BA 3IG4A 4FLIA 3MR1A 5CDLA 1Y1NA 4FKCA 5FCHA 5D6FA 5JFRA 2BB7A 5D6EA 1QXWA 1MATA 1O0XA 3MATA 4U71A 2GGBA 2BWWA 2GZ5A 2IW2A 3IU8A 4FO7A 4PNCA 2P9AA 2ADUA 5CDEA 1WLRA 4IECA 4RZZA 2Q8KA 1C21A 3RVAA 2V6CA 3L7GA 2GG9A 4IKSA 1R58A 2GG5A 3BIPA 1XGNA 3PKDA 3FMRA 1PV9A 2BWYA 1CHMA 1KQ9A 1N51A 2NQ7A 2GG2A 5CNXA 4FUKA 1QXYA 2V3ZA 2BHBA 5JHUA 4FLLA 4U69A 4ZWOA 3CB6A 4A6WA 2B3HA 2GU7A 4HXXA 1BOAA 2GG8A 4S2TP 3TAVA 4IKUA 1C24A 5JI6A 2GTXA 4IPAA 3CB5A 3FM3A 4JUQA 2HOWA 1C27A 2BN7A 4U73A 2GG3A 3BITA 2GU4A 3CTZA 3FMQA 4IDYA 3PKEA 1WL6A 1W2MA 1JAWA 4U75A 2BHAA 2BWXA 2B3LA 3L24A 4FLKA 4PV4A 2GU5A 1XNZA 2G6PA 2GG7A 1R5HA 2GA2A 2GG0A 4MATA 4U70A 2Q95A 1BN5A 1YW8A 4RZYA 1YW9A 2EVOA 1B6AA 3RORA 2GU6A 1QXZA 2BHCA 2OKNA 2MATA 4EGEA 2V3XA 1W7VA 1KP0A 4U6CA 1C22A 4S01A 2EA2A 1A16A 1YW7A 1R5GA 3Q6DA 1WN1A 4ZNGA 1XGOA 4U6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CE6 A;  1KQ0 A;  3TB5 A;  5CDV A;  1C23 A;  1YVM A;  2GGC A;  3MX6 A;  2BWT A;  1WBQ A;  2DFI A;  1WY2 A;  4ZWU A;  2Q96 A;  5E5B A;  1WKM A;  2BWU A;  4ZWP A;  1B59 A;  3D27 A;  4IKT A;  4U1B A;  2NQ6 A;  4FO8 A;  2Q93 A;  3BIQ A;  2P98 A;  4IU6 A;  4U76 A;  2V3Y A;  2Q92 A;  4U6Z A;  2Q94 A;  4IKR A;  4B28 A;  4OOK A;  4U6W A;  1XGM A;  5CLS A;  4U6E A;  2EVM A;  2BWS A;  2EVC A;  4FLJ A;  2OAZ A;  4S00 A;  4S2R P;  4KM3 A;  1YJ3 A;  5FCF A;  2ZSG A;  3PKA A;  4R60 A;  3IU7 A;  4A6V A;  4IF7 A;  2BH3 A;  2B3K A;  2P99 A;  4QR8 A;  4Z7M A;  1QZY A;  2BHD A;  2BWV A;  5CIK A;  3PKB A;  1XGS A;  4RGZ 1;  1WL9 A;  1M35 A;  2EA4 A;  3IU9 A;  3PKC A;  3S6B A;  3IG4 A;  4FLI A;  3MR1 A;  5CDL A;  1Y1N A;  4FKC A;  5FCH A;  5D6F A;  5JFR A;  2BB7 A;  5D6E A;  1QXW A;  1MAT A;  1O0X A;  3MAT A;  4U71 A;  2GGB A;  2BWW A;  2GZ5 A;  2IW2 A;  3IU8 A;  4FO7 A;  4PNC A;  2P9A A;  2ADU A;  5CDE A;  1WLR A;  4IEC A;  4RZZ A;  2Q8K A;  1C21 A;  3RVA A;  2V6C A;  3L7G A;  2GG9 A;  4IKS A;  1R58 A;  2GG5 A;  3BIP A;  1XGN A;  3PKD A;  3FMR A;  1PV9 A;  2BWY A;  1CHM A;  1KQ9 A;  1N51 A;  2NQ7 A;  2GG2 A;  5CNX A;  4FUK A;  1QXY A;  2V3Z A;  2BHB A;  5JHU A;  4FLL A;  4U69 A;  4ZWO A;  3CB6 A;  4A6W A;  2B3H A;  2GU7 A;  4HXX A;  1BOA A;  2GG8 A;  4S2T P;  3TAV A;  4IKU A;  1C24 A;  5JI6 A;  2GTX A;  4IPA A;  3CB5 A;  3FM3 A;  4JUQ A;  2HOW A;  1C27 A;  2BN7 A;  4U73 A;  2GG3 A;  3BIT A;  2GU4 A;  3CTZ A;  3FMQ A;  4IDY A;  3PKE A;  1WL6 A;  1W2M A;  1JAW A;  4U75 A;  2BHA A;  2BWX A;  2B3L A;  3L24 A;  4FLK A;  4PV4 A;  2GU5 A;  1XNZ A;  2G6P A;  2GG7 A;  1R5H A;  2GA2 A;  2GG0 A;  4MAT A;  4U70 A;  2Q95 A;  1BN5 A;  1YW8 A;  4RZY A;  1YW9 A;  2EVO A;  1B6A A;  3ROR A;  2GU6 A;  1QXZ A;  2BHC A;  2OKN A;  2MAT A;  4EGE A;  2V3X A;  1W7V A;  1KP0 A;  4U6C A;  1C22 A;  4S01 A;  2EA2 A;  1A16 A;  1YW7 A;  1R5G A;  3Q6D A;  1WN1 A;  4ZNG A;  1XGO A;  4U6J A; 
#chains in the Genus database with same CATH topology
 5CE6 A;  1KQ0 A;  3TB5 A;  5CDV A;  1C23 A;  1YVM A;  2GGC A;  3MX6 A;  2BWT A;  1WBQ A;  2DFI A;  1WY2 A;  4ZWU A;  2Q96 A;  5E5B A;  1WKM A;  2BWU A;  4ZWP A;  1B59 A;  3D27 A;  4IKT A;  4U1B A;  2NQ6 A;  4FO8 A;  2Q93 A;  3BIQ A;  2P98 A;  4IU6 A;  4U76 A;  2V3Y A;  2Q92 A;  4U6Z A;  2Q94 A;  4IKR A;  4B28 A;  4OOK A;  4U6W A;  1XGM A;  5CLS A;  4U6E A;  2EVM A;  2BWS A;  2EVC A;  4FLJ A;  2OAZ A;  4S00 A;  4S2R P;  4KM3 A;  1YJ3 A;  5FCF A;  2ZSG A;  3PKA A;  4R60 A;  3IU7 A;  4A6V A;  4IF7 A;  2BH3 A;  2B3K A;  2P99 A;  4QR8 A;  4Z7M A;  1QZY A;  2BHD A;  2BWV A;  5CIK A;  3PKB A;  1XGS A;  4RGZ 1;  1WL9 A;  1M35 A;  2EA4 A;  3IU9 A;  3PKC A;  3S6B A;  3IG4 A;  4FLI A;  3MR1 A;  5CDL A;  1Y1N A;  4FKC A;  5FCH A;  5D6F A;  5JFR A;  2BB7 A;  5D6E A;  1QXW A;  1MAT A;  1O0X A;  3MAT A;  4U71 A;  2GGB A;  2BWW A;  2GZ5 A;  2IW2 A;  3IU8 A;  4FO7 A;  4PNC A;  2P9A A;  2ADU A;  5CDE A;  1WLR A;  4IEC A;  4RZZ A;  2Q8K A;  1C21 A;  3RVA A;  2V6C A;  3L7G A;  2GG9 A;  4IKS A;  1R58 A;  2GG5 A;  3BIP A;  1XGN A;  3PKD A;  3FMR A;  1PV9 A;  2BWY A;  1CHM A;  1KQ9 A;  1N51 A;  2NQ7 A;  2GG2 A;  5CNX A;  4FUK A;  1QXY A;  2V3Z A;  2BHB A;  5JHU A;  4FLL A;  4U69 A;  4ZWO A;  3CB6 A;  4A6W A;  2B3H A;  2GU7 A;  4HXX A;  1BOA A;  2GG8 A;  4S2T P;  3TAV A;  4IKU A;  1C24 A;  5JI6 A;  2GTX A;  4IPA A;  3CB5 A;  3FM3 A;  4JUQ A;  2HOW A;  1C27 A;  2BN7 A;  4U73 A;  2GG3 A;  3BIT A;  2GU4 A;  3CTZ A;  3FMQ A;  4IDY A;  3PKE A;  1WL6 A;  1W2M A;  1JAW A;  4U75 A;  2BHA A;  2BWX A;  2B3L A;  3L24 A;  4FLK A;  4PV4 A;  2GU5 A;  1XNZ A;  2G6P A;  2GG7 A;  1R5H A;  2GA2 A;  2GG0 A;  4MAT A;  4U70 A;  2Q95 A;  1BN5 A;  1YW8 A;  4RZY A;  1YW9 A;  2EVO A;  1B6A A;  3ROR A;  2GU6 A;  1QXZ A;  2BHC A;  2OKN A;  2MAT A;  4EGE A;  2V3X A;  1W7V A;  1KP0 A;  4U6C A;  1C22 A;  4S01 A;  2EA2 A;  1A16 A;  1YW7 A;  1R5G A;  3Q6D A;  1WN1 A;  4ZNG A;  1XGO A;  4U6J A; 
#chains in the Genus database with same CATH homology
 5CE6 A;  1KQ0 A;  3TB5 A;  5CDV A;  1C23 A;  1YVM A;  2GGC A;  3MX6 A;  2BWT A;  1WBQ A;  2DFI A;  1WY2 A;  4ZWU A;  2Q96 A;  5E5B A;  1WKM A;  2BWU A;  4ZWP A;  1B59 A;  3D27 A;  4IKT A;  4U1B A;  2NQ6 A;  4FO8 A;  2Q93 A;  3BIQ A;  2P98 A;  4IU6 A;  4U76 A;  2V3Y A;  2Q92 A;  4U6Z A;  2Q94 A;  4IKR A;  4B28 A;  4OOK A;  4U6W A;  1XGM A;  5CLS A;  4U6E A;  2EVM A;  2BWS A;  2EVC A;  4FLJ A;  2OAZ A;  4S00 A;  4S2R P;  4KM3 A;  1YJ3 A;  5FCF A;  2ZSG A;  3PKA A;  4R60 A;  3IU7 A;  4A6V A;  4IF7 A;  2BH3 A;  2B3K A;  2P99 A;  4QR8 A;  4Z7M A;  1QZY A;  2BHD A;  2BWV A;  5CIK A;  3PKB A;  1XGS A;  4RGZ 1;  1WL9 A;  1M35 A;  2EA4 A;  3IU9 A;  3PKC A;  3S6B A;  3IG4 A;  4FLI A;  3MR1 A;  5CDL A;  1Y1N A;  4FKC A;  5FCH A;  5D6F A;  5JFR A;  2BB7 A;  5D6E A;  1QXW A;  1MAT A;  1O0X A;  3MAT A;  4U71 A;  2GGB A;  2BWW A;  2GZ5 A;  2IW2 A;  3IU8 A;  4FO7 A;  4PNC A;  2P9A A;  2ADU A;  5CDE A;  1WLR A;  4IEC A;  4RZZ A;  2Q8K A;  1C21 A;  3RVA A;  2V6C A;  3L7G A;  2GG9 A;  4IKS A;  1R58 A;  2GG5 A;  3BIP A;  1XGN A;  3PKD A;  3FMR A;  1PV9 A;  2BWY A;  1CHM A;  1KQ9 A;  1N51 A;  2NQ7 A;  2GG2 A;  5CNX A;  4FUK A;  1QXY A;  2V3Z A;  2BHB A;  5JHU A;  4FLL A;  4U69 A;  4ZWO A;  3CB6 A;  4A6W A;  2B3H A;  2GU7 A;  4HXX A;  1BOA A;  2GG8 A;  4S2T P;  3TAV A;  4IKU A;  1C24 A;  5JI6 A;  2GTX A;  4IPA A;  3CB5 A;  3FM3 A;  4JUQ A;  2HOW A;  1C27 A;  2BN7 A;  4U73 A;  2GG3 A;  3BIT A;  2GU4 A;  3CTZ A;  3FMQ A;  4IDY A;  3PKE A;  1WL6 A;  1W2M A;  1JAW A;  4U75 A;  2BHA A;  2BWX A;  2B3L A;  3L24 A;  4FLK A;  4PV4 A;  2GU5 A;  1XNZ A;  2G6P A;  2GG7 A;  1R5H A;  2GA2 A;  2GG0 A;  4MAT A;  4U70 A;  2Q95 A;  1BN5 A;  1YW8 A;  4RZY A;  1YW9 A;  2EVO A;  1B6A A;  3ROR A;  2GU6 A;  1QXZ A;  2BHC A;  2OKN A;  2MAT A;  4EGE A;  2V3X A;  1W7V A;  1KP0 A;  4U6C A;  1C22 A;  4S01 A;  2EA2 A;  1A16 A;  1YW7 A;  1R5G A;  3Q6D A;  1WN1 A;  4ZNG A;  1XGO A;  4U6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...