2GG5A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
molecule tags Hydrolase
source organism Escherichia coli k12
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
total genus 81
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg5A00
5D6FA 1WLRA 1CHMA 2BWXA 2V3XA 2GG5A 2Q93A 3CB6A 1XGMA 3PKEA 4U70A 3PKCA 4IKTA 1WY2A 4FLKA 2GZ5A 5CE6A 3D27A 2MATA 4PV4A 4U6JA 4U6WA 4RGZ1 3BIPA 5E5BA 1WL6A 4Z7MA 2DFIA 4S00A 2HOWA 2OAZA 4FLIA 4B28A 2GU7A 1WN1A 1MATA 5CDVA 2BWYA 1B59A 5CNXA 1PV9A 1XNZA 1WKMA 5CIKA 2GTXA 1O0XA 4JUQA 1JAWA 1QXZA 3CTZA 1WL9A 1WBQA 1YVMA 2B3LA 4S2RP 2BB7A 4ZNGA 2Q8KA 1YW8A 2BH3A 1KQ9A 2GG7A 3IG4A 5JFRA 1YW7A 5JI6A 2NQ6A 1YJ3A 4FO8A 1C23A 4QR8A 2BWSA 3FMQA 4FLLA 4PNCA 4U71A 2GGCA 2BN7A 2BWUA 3MX6A 5JHUA 1W2MA 2BHDA 2IW2A 4IKRA 4FUKA 4OOKA 5CDEA 4KM3A 1KQ0A 1KP0A 2GU6A 2GU5A 3PKAA 1C22A 2BWWA 2B3HA 1Y1NA 2P9AA 4IU6A 4EGEA 3MR1A 1A16A 4IF7A 1B6AA 2P99A 1XGSA 2BHAA 2V6CA 2OKNA 5FCHA 2EA4A 2P98A 3BIQA 4U6CA 3FM3A 2EVOA 4IECA 1QZYA 2G6PA 1XGNA 4U69A 2GGBA 4U76A 1M35A 5FCFA 4U75A 3TB5A 4IPAA 2B3KA 2Q92A 4FKCA 3L7GA 5D6EA 2ZSGA 4IKSA 4IKUA 1W7VA 2V3YA 2EVCA 2BWVA 2GG2A 3RVAA 4ZWPA 2GG3A 4U6EA 2Q96A 2GG8A 4ZWUA 3BITA 3MATA 3CB5A 4ZWOA 5CDLA 1QXYA 1QXWA 3FMRA 4IDYA 3IU9A 2BWTA 1N51A 1R5GA 2BHBA 2NQ7A 4U73A 2ADUA 3PKDA 3PKBA 3S6BA 3Q6DA 4A6WA 2EVMA 2GG0A 2GU4A 4MATA 5CLSA 4FLJA 4R60A 4RZZA 1YW9A 2Q94A 3RORA 2EA2A 4FO7A 2V3ZA 1BN5A 2Q95A 4HXXA 1R5HA 4RZYA 4S2TP 3IU8A 3TAVA 1BOAA 3L24A 2GA2A 3IU7A 1XGOA 2GG9A 2BHCA 4U1BA 4U6ZA 1C21A 1C27A 1R58A 1C24A 4S01A 4A6VA
chains in the Genus database with same CATH superfamily
5D6FA 1WLRA 1CHMA 2BWXA 2V3XA 2GG5A 2Q93A 3CB6A 1XGMA 3PKEA 4U70A 3PKCA 4IKTA 1WY2A 4FLKA 2GZ5A 5CE6A 3D27A 2MATA 4PV4A 4U6JA 4U6WA 4RGZ1 3BIPA 5E5BA 1WL6A 4Z7MA 2DFIA 4S00A 2HOWA 2OAZA 4FLIA 4B28A 2GU7A 1WN1A 1MATA 5CDVA 2BWYA 1B59A 5CNXA 1PV9A 1XNZA 1WKMA 5CIKA 2GTXA 1O0XA 4JUQA 1JAWA 1QXZA 3CTZA 1WL9A 1WBQA 1YVMA 2B3LA 4S2RP 2BB7A 4ZNGA 2Q8KA 1YW8A 2BH3A 1KQ9A 2GG7A 3IG4A 5JFRA 1YW7A 5JI6A 2NQ6A 1YJ3A 4FO8A 1C23A 4QR8A 2BWSA 3FMQA 4FLLA 4PNCA 4U71A 2GGCA 2BN7A 2BWUA 3MX6A 5JHUA 1W2MA 2BHDA 2IW2A 4IKRA 4FUKA 4OOKA 5CDEA 4KM3A 1KQ0A 1KP0A 2GU6A 2GU5A 3PKAA 1C22A 2BWWA 2B3HA 1Y1NA 2P9AA 4IU6A 4EGEA 3MR1A 1A16A 4IF7A 1B6AA 2P99A 1XGSA 2BHAA 2V6CA 2OKNA 5FCHA 2EA4A 2P98A 3BIQA 4U6CA 3FM3A 2EVOA 4IECA 1QZYA 2G6PA 1XGNA 4U69A 2GGBA 4U76A 1M35A 5FCFA 4U75A 3TB5A 4IPAA 2B3KA 2Q92A 4FKCA 3L7GA 5D6EA 2ZSGA 4IKSA 4IKUA 1W7VA 2V3YA 2EVCA 2BWVA 2GG2A 3RVAA 4ZWPA 2GG3A 4U6EA 2Q96A 2GG8A 4ZWUA 3BITA 3MATA 3CB5A 4ZWOA 5CDLA 1QXYA 1QXWA 3FMRA 4IDYA 3IU9A 2BWTA 1N51A 1R5GA 2BHBA 2NQ7A 4U73A 2ADUA 3PKDA 3PKBA 3S6BA 3Q6DA 4A6WA 2EVMA 2GG0A 2GU4A 4MATA 5CLSA 4FLJA 4R60A 4RZZA 1YW9A 2Q94A 3RORA 2EA2A 4FO7A 2V3ZA 1BN5A 2Q95A 4HXXA 1R5HA 4RZYA 4S2TP 3IU8A 3TAVA 1BOAA 3L24A 2GA2A 3IU7A 1XGOA 2GG9A 2BHCA 4U1BA 4U6ZA 1C21A 1C27A 1R58A 1C24A 4S01A 4A6VA
chains in the Genus database with same CATH topology
5D6FA 1WLRA 1CHMA 2BWXA 2V3XA 2GG5A 2Q93A 3CB6A 1XGMA 3PKEA 4U70A 3PKCA 4IKTA 1WY2A 4FLKA 2GZ5A 5CE6A 3D27A 2MATA 4PV4A 4U6JA 4U6WA 4RGZ1 3BIPA 5E5BA 1WL6A 4Z7MA 2DFIA 4S00A 2HOWA 2OAZA 4FLIA 4B28A 2GU7A 1WN1A 1MATA 5CDVA 2BWYA 1B59A 5CNXA 1PV9A 1XNZA 1WKMA 5CIKA 2GTXA 1O0XA 4JUQA 1JAWA 1QXZA 3CTZA 1WL9A 1WBQA 1YVMA 2B3LA 4S2RP 2BB7A 4ZNGA 2Q8KA 1YW8A 2BH3A 1KQ9A 2GG7A 3IG4A 5JFRA 1YW7A 5JI6A 2NQ6A 1YJ3A 4FO8A 1C23A 4QR8A 2BWSA 3FMQA 4FLLA 4PNCA 4U71A 2GGCA 2BN7A 2BWUA 3MX6A 5JHUA 1W2MA 2BHDA 2IW2A 4IKRA 4FUKA 4OOKA 5CDEA 4KM3A 1KQ0A 1KP0A 2GU6A 2GU5A 3PKAA 1C22A 2BWWA 2B3HA 1Y1NA 2P9AA 4IU6A 4EGEA 3MR1A 1A16A 4IF7A 1B6AA 2P99A 1XGSA 2BHAA 2V6CA 2OKNA 5FCHA 2EA4A 2P98A 3BIQA 4U6CA 3FM3A 2EVOA 4IECA 1QZYA 2G6PA 1XGNA 4U69A 2GGBA 4U76A 1M35A 5FCFA 4U75A 3TB5A 4IPAA 2B3KA 2Q92A 4FKCA 3L7GA 5D6EA 2ZSGA 4IKSA 4IKUA 1W7VA 2V3YA 2EVCA 2BWVA 2GG2A 3RVAA 4ZWPA 2GG3A 4U6EA 2Q96A 2GG8A 4ZWUA 3BITA 3MATA 3CB5A 4ZWOA 5CDLA 1QXYA 1QXWA 3FMRA 4IDYA 3IU9A 2BWTA 1N51A 1R5GA 2BHBA 2NQ7A 4U73A 2ADUA 3PKDA 3PKBA 3S6BA 3Q6DA 4A6WA 2EVMA 2GG0A 2GU4A 4MATA 5CLSA 4FLJA 4R60A 4RZZA 1YW9A 2Q94A 3RORA 2EA2A 4FO7A 2V3ZA 1BN5A 2Q95A 4HXXA 1R5HA 4RZYA 4S2TP 3IU8A 3TAVA 1BOAA 3L24A 2GA2A 3IU7A 1XGOA 2GG9A 2BHCA 4U1BA 4U6ZA 1C21A 1C27A 1R58A 1C24A 4S01A 4A6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6F A;  1WLR A;  1CHM A;  2BWX A;  2V3X A;  2GG5 A;  2Q93 A;  3CB6 A;  1XGM A;  3PKE A;  4U70 A;  3PKC A;  4IKT A;  1WY2 A;  4FLK A;  2GZ5 A;  5CE6 A;  3D27 A;  2MAT A;  4PV4 A;  4U6J A;  4U6W A;  4RGZ 1;  3BIP A;  5E5B A;  1WL6 A;  4Z7M A;  2DFI A;  4S00 A;  2HOW A;  2OAZ A;  4FLI A;  4B28 A;  2GU7 A;  1WN1 A;  1MAT A;  5CDV A;  2BWY A;  1B59 A;  5CNX A;  1PV9 A;  1XNZ A;  1WKM A;  5CIK A;  2GTX A;  1O0X A;  4JUQ A;  1JAW A;  1QXZ A;  3CTZ A;  1WL9 A;  1WBQ A;  1YVM A;  2B3L A;  4S2R P;  2BB7 A;  4ZNG A;  2Q8K A;  1YW8 A;  2BH3 A;  1KQ9 A;  2GG7 A;  3IG4 A;  5JFR A;  1YW7 A;  5JI6 A;  2NQ6 A;  1YJ3 A;  4FO8 A;  1C23 A;  4QR8 A;  2BWS A;  3FMQ A;  4FLL A;  4PNC A;  4U71 A;  2GGC A;  2BN7 A;  2BWU A;  3MX6 A;  5JHU A;  1W2M A;  2BHD A;  2IW2 A;  4IKR A;  4FUK A;  4OOK A;  5CDE A;  4KM3 A;  1KQ0 A;  1KP0 A;  2GU6 A;  2GU5 A;  3PKA A;  1C22 A;  2BWW A;  2B3H A;  1Y1N A;  2P9A A;  4IU6 A;  4EGE A;  3MR1 A;  1A16 A;  4IF7 A;  1B6A A;  2P99 A;  1XGS A;  2BHA A;  2V6C A;  2OKN A;  5FCH A;  2EA4 A;  2P98 A;  3BIQ A;  4U6C A;  3FM3 A;  2EVO A;  4IEC A;  1QZY A;  2G6P A;  1XGN A;  4U69 A;  2GGB A;  4U76 A;  1M35 A;  5FCF A;  4U75 A;  3TB5 A;  4IPA A;  2B3K A;  2Q92 A;  4FKC A;  3L7G A;  5D6E A;  2ZSG A;  4IKS A;  4IKU A;  1W7V A;  2V3Y A;  2EVC A;  2BWV A;  2GG2 A;  3RVA A;  4ZWP A;  2GG3 A;  4U6E A;  2Q96 A;  2GG8 A;  4ZWU A;  3BIT A;  3MAT A;  3CB5 A;  4ZWO A;  5CDL A;  1QXY A;  1QXW A;  3FMR A;  4IDY A;  3IU9 A;  2BWT A;  1N51 A;  1R5G A;  2BHB A;  2NQ7 A;  4U73 A;  2ADU A;  3PKD A;  3PKB A;  3S6B A;  3Q6D A;  4A6W A;  2EVM A;  2GG0 A;  2GU4 A;  4MAT A;  5CLS A;  4FLJ A;  4R60 A;  4RZZ A;  1YW9 A;  2Q94 A;  3ROR A;  2EA2 A;  4FO7 A;  2V3Z A;  1BN5 A;  2Q95 A;  4HXX A;  1R5H A;  4RZY A;  4S2T P;  3IU8 A;  3TAV A;  1BOA A;  3L24 A;  2GA2 A;  3IU7 A;  1XGO A;  2GG9 A;  2BHC A;  4U1B A;  4U6Z A;  1C21 A;  1C27 A;  1R58 A;  1C24 A;  4S01 A;  4A6V A; 
#chains in the Genus database with same CATH topology
 5D6F A;  1WLR A;  1CHM A;  2BWX A;  2V3X A;  2GG5 A;  2Q93 A;  3CB6 A;  1XGM A;  3PKE A;  4U70 A;  3PKC A;  4IKT A;  1WY2 A;  4FLK A;  2GZ5 A;  5CE6 A;  3D27 A;  2MAT A;  4PV4 A;  4U6J A;  4U6W A;  4RGZ 1;  3BIP A;  5E5B A;  1WL6 A;  4Z7M A;  2DFI A;  4S00 A;  2HOW A;  2OAZ A;  4FLI A;  4B28 A;  2GU7 A;  1WN1 A;  1MAT A;  5CDV A;  2BWY A;  1B59 A;  5CNX A;  1PV9 A;  1XNZ A;  1WKM A;  5CIK A;  2GTX A;  1O0X A;  4JUQ A;  1JAW A;  1QXZ A;  3CTZ A;  1WL9 A;  1WBQ A;  1YVM A;  2B3L A;  4S2R P;  2BB7 A;  4ZNG A;  2Q8K A;  1YW8 A;  2BH3 A;  1KQ9 A;  2GG7 A;  3IG4 A;  5JFR A;  1YW7 A;  5JI6 A;  2NQ6 A;  1YJ3 A;  4FO8 A;  1C23 A;  4QR8 A;  2BWS A;  3FMQ A;  4FLL A;  4PNC A;  4U71 A;  2GGC A;  2BN7 A;  2BWU A;  3MX6 A;  5JHU A;  1W2M A;  2BHD A;  2IW2 A;  4IKR A;  4FUK A;  4OOK A;  5CDE A;  4KM3 A;  1KQ0 A;  1KP0 A;  2GU6 A;  2GU5 A;  3PKA A;  1C22 A;  2BWW A;  2B3H A;  1Y1N A;  2P9A A;  4IU6 A;  4EGE A;  3MR1 A;  1A16 A;  4IF7 A;  1B6A A;  2P99 A;  1XGS A;  2BHA A;  2V6C A;  2OKN A;  5FCH A;  2EA4 A;  2P98 A;  3BIQ A;  4U6C A;  3FM3 A;  2EVO A;  4IEC A;  1QZY A;  2G6P A;  1XGN A;  4U69 A;  2GGB A;  4U76 A;  1M35 A;  5FCF A;  4U75 A;  3TB5 A;  4IPA A;  2B3K A;  2Q92 A;  4FKC A;  3L7G A;  5D6E A;  2ZSG A;  4IKS A;  4IKU A;  1W7V A;  2V3Y A;  2EVC A;  2BWV A;  2GG2 A;  3RVA A;  4ZWP A;  2GG3 A;  4U6E A;  2Q96 A;  2GG8 A;  4ZWU A;  3BIT A;  3MAT A;  3CB5 A;  4ZWO A;  5CDL A;  1QXY A;  1QXW A;  3FMR A;  4IDY A;  3IU9 A;  2BWT A;  1N51 A;  1R5G A;  2BHB A;  2NQ7 A;  4U73 A;  2ADU A;  3PKD A;  3PKB A;  3S6B A;  3Q6D A;  4A6W A;  2EVM A;  2GG0 A;  2GU4 A;  4MAT A;  5CLS A;  4FLJ A;  4R60 A;  4RZZ A;  1YW9 A;  2Q94 A;  3ROR A;  2EA2 A;  4FO7 A;  2V3Z A;  1BN5 A;  2Q95 A;  4HXX A;  1R5H A;  4RZY A;  4S2T P;  3IU8 A;  3TAV A;  1BOA A;  3L24 A;  2GA2 A;  3IU7 A;  1XGO A;  2GG9 A;  2BHC A;  4U1B A;  4U6Z A;  1C21 A;  1C27 A;  1R58 A;  1C24 A;  4S01 A;  4A6V A; 
#chains in the Genus database with same CATH homology
 5D6F A;  1WLR A;  1CHM A;  2BWX A;  2V3X A;  2GG5 A;  2Q93 A;  3CB6 A;  1XGM A;  3PKE A;  4U70 A;  3PKC A;  4IKT A;  1WY2 A;  4FLK A;  2GZ5 A;  5CE6 A;  3D27 A;  2MAT A;  4PV4 A;  4U6J A;  4U6W A;  4RGZ 1;  3BIP A;  5E5B A;  1WL6 A;  4Z7M A;  2DFI A;  4S00 A;  2HOW A;  2OAZ A;  4FLI A;  4B28 A;  2GU7 A;  1WN1 A;  1MAT A;  5CDV A;  2BWY A;  1B59 A;  5CNX A;  1PV9 A;  1XNZ A;  1WKM A;  5CIK A;  2GTX A;  1O0X A;  4JUQ A;  1JAW A;  1QXZ A;  3CTZ A;  1WL9 A;  1WBQ A;  1YVM A;  2B3L A;  4S2R P;  2BB7 A;  4ZNG A;  2Q8K A;  1YW8 A;  2BH3 A;  1KQ9 A;  2GG7 A;  3IG4 A;  5JFR A;  1YW7 A;  5JI6 A;  2NQ6 A;  1YJ3 A;  4FO8 A;  1C23 A;  4QR8 A;  2BWS A;  3FMQ A;  4FLL A;  4PNC A;  4U71 A;  2GGC A;  2BN7 A;  2BWU A;  3MX6 A;  5JHU A;  1W2M A;  2BHD A;  2IW2 A;  4IKR A;  4FUK A;  4OOK A;  5CDE A;  4KM3 A;  1KQ0 A;  1KP0 A;  2GU6 A;  2GU5 A;  3PKA A;  1C22 A;  2BWW A;  2B3H A;  1Y1N A;  2P9A A;  4IU6 A;  4EGE A;  3MR1 A;  1A16 A;  4IF7 A;  1B6A A;  2P99 A;  1XGS A;  2BHA A;  2V6C A;  2OKN A;  5FCH A;  2EA4 A;  2P98 A;  3BIQ A;  4U6C A;  3FM3 A;  2EVO A;  4IEC A;  1QZY A;  2G6P A;  1XGN A;  4U69 A;  2GGB A;  4U76 A;  1M35 A;  5FCF A;  4U75 A;  3TB5 A;  4IPA A;  2B3K A;  2Q92 A;  4FKC A;  3L7G A;  5D6E A;  2ZSG A;  4IKS A;  4IKU A;  1W7V A;  2V3Y A;  2EVC A;  2BWV A;  2GG2 A;  3RVA A;  4ZWP A;  2GG3 A;  4U6E A;  2Q96 A;  2GG8 A;  4ZWU A;  3BIT A;  3MAT A;  3CB5 A;  4ZWO A;  5CDL A;  1QXY A;  1QXW A;  3FMR A;  4IDY A;  3IU9 A;  2BWT A;  1N51 A;  1R5G A;  2BHB A;  2NQ7 A;  4U73 A;  2ADU A;  3PKD A;  3PKB A;  3S6B A;  3Q6D A;  4A6W A;  2EVM A;  2GG0 A;  2GU4 A;  4MAT A;  5CLS A;  4FLJ A;  4R60 A;  4RZZ A;  1YW9 A;  2Q94 A;  3ROR A;  2EA2 A;  4FO7 A;  2V3Z A;  1BN5 A;  2Q95 A;  4HXX A;  1R5H A;  4RZY A;  4S2T P;  3IU8 A;  3TAV A;  1BOA A;  3L24 A;  2GA2 A;  3IU7 A;  1XGO A;  2GG9 A;  2BHC A;  4U1B A;  4U6Z A;  1C21 A;  1C27 A;  1R58 A;  1C24 A;  4S01 A;  4A6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...