2GG5A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 81
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg5A00
1YW9A 2BWYA 4IKUA 4EGEA 1W2MA 1XGMA 4ZWOA 2BHAA 2BHCA 5FCHA 2B3LA 5JI6A 3FMQA 2GGCA 2Q93A 5CDLA 4U73A 4ZWPA 4FLLA 2ADUA 2V6CA 1PV9A 3MATA 4S01A 1MATA 1XNZA 4IDYA 4RGZ1 5JHUA 1C27A 4U6ZA 3L7GA 2GG0A 1N51A 1W7VA 4A6VA 3CB6A 4FO8A 3BIPA 1QXWA 3MX6A 4IKTA 1XGOA 1YW7A 5D6EA 4S2RP 4FLJA 3IU9A 1KQ0A 4KM3A 2P9AA 5CIKA 3S6BA 1KP0A 5JFRA 3TB5A 2GU6A 3PKDA 5CDEA 2IW2A 5CDVA 1YVMA 1B59A 1BN5A 1JAWA 4Z7MA 2HOWA 1C24A 3PKEA 2P99A 1M35A 4IECA 2GG8A 4JUQA 1C23A 1YJ3A 3PKCA 5D6FA 4U6EA 4QR8A 2B3HA 4IPAA 3RORA 1WY2A 4R60A 3D27A 2B3KA 1C21A 3IG4A 5E5BA 2BHDA 4FO7A 5CNXA 3Q6DA 2Q95A 4FLKA 4PNCA 1WLRA 4HXXA 2BB7A 1A16A 2BN7A 3L24A 1WL9A 3TAVA 2GG3A 4B28A 4RZZA 1YW8A 2GGBA 2BWVA 4U70A 5FCFA 2G6PA 4U1BA 3PKAA 3CTZA 2GG7A 2BHBA 5CLSA 4PV4A 2MATA 4FUKA 2EVOA 4U6JA 1R5HA 2OAZA 1C22A 2Q92A 3IU8A 2EVCA 3CB5A 2DFIA 2Q96A 4U76A 2BWXA 4U69A 2BWWA 2BWSA 2EA2A 4FLIA 3BIQA 4OOKA 1O0XA 3IU7A 1QZYA 3FM3A 1KQ9A 2GG2A 3PKBA 3BITA 2OKNA 2V3XA 2BH3A 4ZWUA 1XGSA 2V3ZA 4S00A 1WBQA 1BOAA 2BWUA 1B6AA 4ZNGA 2NQ6A 1CHMA 4U6CA 1XGNA 3MR1A 2EVMA 2P98A 1WN1A 4U6WA 2EA4A 2GTXA 2V3YA 2GG5A 4IKSA 4IU6A 4FKCA 1QXYA 2BWTA 2GU7A 1Y1NA 1R58A 2GU4A 4MATA 4IF7A 1WKMA 4IKRA 3RVAA 5CE6A 2GZ5A 4S2TP 3FMRA 2Q8KA 2GG9A 2ZSGA 4A6WA 4U71A 1WL6A 2GA2A 4U75A 2GU5A 1R5GA 4RZYA 2NQ7A 1QXZA 2Q94A
chains in the Genus database with same CATH superfamily
1YW9A 2BWYA 4IKUA 4EGEA 1W2MA 1XGMA 4ZWOA 2BHAA 2BHCA 5FCHA 2B3LA 5JI6A 3FMQA 2GGCA 2Q93A 5CDLA 4U73A 4ZWPA 4FLLA 2ADUA 2V6CA 1PV9A 3MATA 4S01A 1MATA 1XNZA 4IDYA 4RGZ1 5JHUA 1C27A 4U6ZA 3L7GA 2GG0A 1N51A 1W7VA 4A6VA 3CB6A 4FO8A 3BIPA 1QXWA 3MX6A 4IKTA 1XGOA 1YW7A 5D6EA 4S2RP 4FLJA 3IU9A 1KQ0A 4KM3A 2P9AA 5CIKA 3S6BA 1KP0A 5JFRA 3TB5A 2GU6A 3PKDA 5CDEA 2IW2A 5CDVA 1YVMA 1B59A 1BN5A 1JAWA 4Z7MA 2HOWA 1C24A 3PKEA 2P99A 1M35A 4IECA 2GG8A 4JUQA 1C23A 1YJ3A 3PKCA 5D6FA 4U6EA 4QR8A 2B3HA 4IPAA 3RORA 1WY2A 4R60A 3D27A 2B3KA 1C21A 3IG4A 5E5BA 2BHDA 4FO7A 5CNXA 3Q6DA 2Q95A 4FLKA 4PNCA 1WLRA 4HXXA 2BB7A 1A16A 2BN7A 3L24A 1WL9A 3TAVA 2GG3A 4B28A 4RZZA 1YW8A 2GGBA 2BWVA 4U70A 5FCFA 2G6PA 4U1BA 3PKAA 3CTZA 2GG7A 2BHBA 5CLSA 4PV4A 2MATA 4FUKA 2EVOA 4U6JA 1R5HA 2OAZA 1C22A 2Q92A 3IU8A 2EVCA 3CB5A 2DFIA 2Q96A 4U76A 2BWXA 4U69A 2BWWA 2BWSA 2EA2A 4FLIA 3BIQA 4OOKA 1O0XA 3IU7A 1QZYA 3FM3A 1KQ9A 2GG2A 3PKBA 3BITA 2OKNA 2V3XA 2BH3A 4ZWUA 1XGSA 2V3ZA 4S00A 1WBQA 1BOAA 2BWUA 1B6AA 4ZNGA 2NQ6A 1CHMA 4U6CA 1XGNA 3MR1A 2EVMA 2P98A 1WN1A 4U6WA 2EA4A 2GTXA 2V3YA 2GG5A 4IKSA 4IU6A 4FKCA 1QXYA 2BWTA 2GU7A 1Y1NA 1R58A 2GU4A 4MATA 4IF7A 1WKMA 4IKRA 3RVAA 5CE6A 2GZ5A 4S2TP 3FMRA 2Q8KA 2GG9A 2ZSGA 4A6WA 4U71A 1WL6A 2GA2A 4U75A 2GU5A 1R5GA 4RZYA 2NQ7A 1QXZA 2Q94A
chains in the Genus database with same CATH topology
1YW9A 2BWYA 4IKUA 4EGEA 1W2MA 1XGMA 4ZWOA 2BHAA 2BHCA 5FCHA 2B3LA 5JI6A 3FMQA 2GGCA 2Q93A 5CDLA 4U73A 4ZWPA 4FLLA 2ADUA 2V6CA 1PV9A 3MATA 4S01A 1MATA 1XNZA 4IDYA 4RGZ1 5JHUA 1C27A 4U6ZA 3L7GA 2GG0A 1N51A 1W7VA 4A6VA 3CB6A 4FO8A 3BIPA 1QXWA 3MX6A 4IKTA 1XGOA 1YW7A 5D6EA 4S2RP 4FLJA 3IU9A 1KQ0A 4KM3A 2P9AA 5CIKA 3S6BA 1KP0A 5JFRA 3TB5A 2GU6A 3PKDA 5CDEA 2IW2A 5CDVA 1YVMA 1B59A 1BN5A 1JAWA 4Z7MA 2HOWA 1C24A 3PKEA 2P99A 1M35A 4IECA 2GG8A 4JUQA 1C23A 1YJ3A 3PKCA 5D6FA 4U6EA 4QR8A 2B3HA 4IPAA 3RORA 1WY2A 4R60A 3D27A 2B3KA 1C21A 3IG4A 5E5BA 2BHDA 4FO7A 5CNXA 3Q6DA 2Q95A 4FLKA 4PNCA 1WLRA 4HXXA 2BB7A 1A16A 2BN7A 3L24A 1WL9A 3TAVA 2GG3A 4B28A 4RZZA 1YW8A 2GGBA 2BWVA 4U70A 5FCFA 2G6PA 4U1BA 3PKAA 3CTZA 2GG7A 2BHBA 5CLSA 4PV4A 2MATA 4FUKA 2EVOA 4U6JA 1R5HA 2OAZA 1C22A 2Q92A 3IU8A 2EVCA 3CB5A 2DFIA 2Q96A 4U76A 2BWXA 4U69A 2BWWA 2BWSA 2EA2A 4FLIA 3BIQA 4OOKA 1O0XA 3IU7A 1QZYA 3FM3A 1KQ9A 2GG2A 3PKBA 3BITA 2OKNA 2V3XA 2BH3A 4ZWUA 1XGSA 2V3ZA 4S00A 1WBQA 1BOAA 2BWUA 1B6AA 4ZNGA 2NQ6A 1CHMA 4U6CA 1XGNA 3MR1A 2EVMA 2P98A 1WN1A 4U6WA 2EA4A 2GTXA 2V3YA 2GG5A 4IKSA 4IU6A 4FKCA 1QXYA 2BWTA 2GU7A 1Y1NA 1R58A 2GU4A 4MATA 4IF7A 1WKMA 4IKRA 3RVAA 5CE6A 2GZ5A 4S2TP 3FMRA 2Q8KA 2GG9A 2ZSGA 4A6WA 4U71A 1WL6A 2GA2A 4U75A 2GU5A 1R5GA 4RZYA 2NQ7A 1QXZA 2Q94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW9 A;  2BWY A;  4IKU A;  4EGE A;  1W2M A;  1XGM A;  4ZWO A;  2BHA A;  2BHC A;  5FCH A;  2B3L A;  5JI6 A;  3FMQ A;  2GGC A;  2Q93 A;  5CDL A;  4U73 A;  4ZWP A;  4FLL A;  2ADU A;  2V6C A;  1PV9 A;  3MAT A;  4S01 A;  1MAT A;  1XNZ A;  4IDY A;  4RGZ 1;  5JHU A;  1C27 A;  4U6Z A;  3L7G A;  2GG0 A;  1N51 A;  1W7V A;  4A6V A;  3CB6 A;  4FO8 A;  3BIP A;  1QXW A;  3MX6 A;  4IKT A;  1XGO A;  1YW7 A;  5D6E A;  4S2R P;  4FLJ A;  3IU9 A;  1KQ0 A;  4KM3 A;  2P9A A;  5CIK A;  3S6B A;  1KP0 A;  5JFR A;  3TB5 A;  2GU6 A;  3PKD A;  5CDE A;  2IW2 A;  5CDV A;  1YVM A;  1B59 A;  1BN5 A;  1JAW A;  4Z7M A;  2HOW A;  1C24 A;  3PKE A;  2P99 A;  1M35 A;  4IEC A;  2GG8 A;  4JUQ A;  1C23 A;  1YJ3 A;  3PKC A;  5D6F A;  4U6E A;  4QR8 A;  2B3H A;  4IPA A;  3ROR A;  1WY2 A;  4R60 A;  3D27 A;  2B3K A;  1C21 A;  3IG4 A;  5E5B A;  2BHD A;  4FO7 A;  5CNX A;  3Q6D A;  2Q95 A;  4FLK A;  4PNC A;  1WLR A;  4HXX A;  2BB7 A;  1A16 A;  2BN7 A;  3L24 A;  1WL9 A;  3TAV A;  2GG3 A;  4B28 A;  4RZZ A;  1YW8 A;  2GGB A;  2BWV A;  4U70 A;  5FCF A;  2G6P A;  4U1B A;  3PKA A;  3CTZ A;  2GG7 A;  2BHB A;  5CLS A;  4PV4 A;  2MAT A;  4FUK A;  2EVO A;  4U6J A;  1R5H A;  2OAZ A;  1C22 A;  2Q92 A;  3IU8 A;  2EVC A;  3CB5 A;  2DFI A;  2Q96 A;  4U76 A;  2BWX A;  4U69 A;  2BWW A;  2BWS A;  2EA2 A;  4FLI A;  3BIQ A;  4OOK A;  1O0X A;  3IU7 A;  1QZY A;  3FM3 A;  1KQ9 A;  2GG2 A;  3PKB A;  3BIT A;  2OKN A;  2V3X A;  2BH3 A;  4ZWU A;  1XGS A;  2V3Z A;  4S00 A;  1WBQ A;  1BOA A;  2BWU A;  1B6A A;  4ZNG A;  2NQ6 A;  1CHM A;  4U6C A;  1XGN A;  3MR1 A;  2EVM A;  2P98 A;  1WN1 A;  4U6W A;  2EA4 A;  2GTX A;  2V3Y A;  2GG5 A;  4IKS A;  4IU6 A;  4FKC A;  1QXY A;  2BWT A;  2GU7 A;  1Y1N A;  1R58 A;  2GU4 A;  4MAT A;  4IF7 A;  1WKM A;  4IKR A;  3RVA A;  5CE6 A;  2GZ5 A;  4S2T P;  3FMR A;  2Q8K A;  2GG9 A;  2ZSG A;  4A6W A;  4U71 A;  1WL6 A;  2GA2 A;  4U75 A;  2GU5 A;  1R5G A;  4RZY A;  2NQ7 A;  1QXZ A;  2Q94 A; 
#chains in the Genus database with same CATH topology
 1YW9 A;  2BWY A;  4IKU A;  4EGE A;  1W2M A;  1XGM A;  4ZWO A;  2BHA A;  2BHC A;  5FCH A;  2B3L A;  5JI6 A;  3FMQ A;  2GGC A;  2Q93 A;  5CDL A;  4U73 A;  4ZWP A;  4FLL A;  2ADU A;  2V6C A;  1PV9 A;  3MAT A;  4S01 A;  1MAT A;  1XNZ A;  4IDY A;  4RGZ 1;  5JHU A;  1C27 A;  4U6Z A;  3L7G A;  2GG0 A;  1N51 A;  1W7V A;  4A6V A;  3CB6 A;  4FO8 A;  3BIP A;  1QXW A;  3MX6 A;  4IKT A;  1XGO A;  1YW7 A;  5D6E A;  4S2R P;  4FLJ A;  3IU9 A;  1KQ0 A;  4KM3 A;  2P9A A;  5CIK A;  3S6B A;  1KP0 A;  5JFR A;  3TB5 A;  2GU6 A;  3PKD A;  5CDE A;  2IW2 A;  5CDV A;  1YVM A;  1B59 A;  1BN5 A;  1JAW A;  4Z7M A;  2HOW A;  1C24 A;  3PKE A;  2P99 A;  1M35 A;  4IEC A;  2GG8 A;  4JUQ A;  1C23 A;  1YJ3 A;  3PKC A;  5D6F A;  4U6E A;  4QR8 A;  2B3H A;  4IPA A;  3ROR A;  1WY2 A;  4R60 A;  3D27 A;  2B3K A;  1C21 A;  3IG4 A;  5E5B A;  2BHD A;  4FO7 A;  5CNX A;  3Q6D A;  2Q95 A;  4FLK A;  4PNC A;  1WLR A;  4HXX A;  2BB7 A;  1A16 A;  2BN7 A;  3L24 A;  1WL9 A;  3TAV A;  2GG3 A;  4B28 A;  4RZZ A;  1YW8 A;  2GGB A;  2BWV A;  4U70 A;  5FCF A;  2G6P A;  4U1B A;  3PKA A;  3CTZ A;  2GG7 A;  2BHB A;  5CLS A;  4PV4 A;  2MAT A;  4FUK A;  2EVO A;  4U6J A;  1R5H A;  2OAZ A;  1C22 A;  2Q92 A;  3IU8 A;  2EVC A;  3CB5 A;  2DFI A;  2Q96 A;  4U76 A;  2BWX A;  4U69 A;  2BWW A;  2BWS A;  2EA2 A;  4FLI A;  3BIQ A;  4OOK A;  1O0X A;  3IU7 A;  1QZY A;  3FM3 A;  1KQ9 A;  2GG2 A;  3PKB A;  3BIT A;  2OKN A;  2V3X A;  2BH3 A;  4ZWU A;  1XGS A;  2V3Z A;  4S00 A;  1WBQ A;  1BOA A;  2BWU A;  1B6A A;  4ZNG A;  2NQ6 A;  1CHM A;  4U6C A;  1XGN A;  3MR1 A;  2EVM A;  2P98 A;  1WN1 A;  4U6W A;  2EA4 A;  2GTX A;  2V3Y A;  2GG5 A;  4IKS A;  4IU6 A;  4FKC A;  1QXY A;  2BWT A;  2GU7 A;  1Y1N A;  1R58 A;  2GU4 A;  4MAT A;  4IF7 A;  1WKM A;  4IKR A;  3RVA A;  5CE6 A;  2GZ5 A;  4S2T P;  3FMR A;  2Q8K A;  2GG9 A;  2ZSG A;  4A6W A;  4U71 A;  1WL6 A;  2GA2 A;  4U75 A;  2GU5 A;  1R5G A;  4RZY A;  2NQ7 A;  1QXZ A;  2Q94 A; 
#chains in the Genus database with same CATH homology
 1YW9 A;  2BWY A;  4IKU A;  4EGE A;  1W2M A;  1XGM A;  4ZWO A;  2BHA A;  2BHC A;  5FCH A;  2B3L A;  5JI6 A;  3FMQ A;  2GGC A;  2Q93 A;  5CDL A;  4U73 A;  4ZWP A;  4FLL A;  2ADU A;  2V6C A;  1PV9 A;  3MAT A;  4S01 A;  1MAT A;  1XNZ A;  4IDY A;  4RGZ 1;  5JHU A;  1C27 A;  4U6Z A;  3L7G A;  2GG0 A;  1N51 A;  1W7V A;  4A6V A;  3CB6 A;  4FO8 A;  3BIP A;  1QXW A;  3MX6 A;  4IKT A;  1XGO A;  1YW7 A;  5D6E A;  4S2R P;  4FLJ A;  3IU9 A;  1KQ0 A;  4KM3 A;  2P9A A;  5CIK A;  3S6B A;  1KP0 A;  5JFR A;  3TB5 A;  2GU6 A;  3PKD A;  5CDE A;  2IW2 A;  5CDV A;  1YVM A;  1B59 A;  1BN5 A;  1JAW A;  4Z7M A;  2HOW A;  1C24 A;  3PKE A;  2P99 A;  1M35 A;  4IEC A;  2GG8 A;  4JUQ A;  1C23 A;  1YJ3 A;  3PKC A;  5D6F A;  4U6E A;  4QR8 A;  2B3H A;  4IPA A;  3ROR A;  1WY2 A;  4R60 A;  3D27 A;  2B3K A;  1C21 A;  3IG4 A;  5E5B A;  2BHD A;  4FO7 A;  5CNX A;  3Q6D A;  2Q95 A;  4FLK A;  4PNC A;  1WLR A;  4HXX A;  2BB7 A;  1A16 A;  2BN7 A;  3L24 A;  1WL9 A;  3TAV A;  2GG3 A;  4B28 A;  4RZZ A;  1YW8 A;  2GGB A;  2BWV A;  4U70 A;  5FCF A;  2G6P A;  4U1B A;  3PKA A;  3CTZ A;  2GG7 A;  2BHB A;  5CLS A;  4PV4 A;  2MAT A;  4FUK A;  2EVO A;  4U6J A;  1R5H A;  2OAZ A;  1C22 A;  2Q92 A;  3IU8 A;  2EVC A;  3CB5 A;  2DFI A;  2Q96 A;  4U76 A;  2BWX A;  4U69 A;  2BWW A;  2BWS A;  2EA2 A;  4FLI A;  3BIQ A;  4OOK A;  1O0X A;  3IU7 A;  1QZY A;  3FM3 A;  1KQ9 A;  2GG2 A;  3PKB A;  3BIT A;  2OKN A;  2V3X A;  2BH3 A;  4ZWU A;  1XGS A;  2V3Z A;  4S00 A;  1WBQ A;  1BOA A;  2BWU A;  1B6A A;  4ZNG A;  2NQ6 A;  1CHM A;  4U6C A;  1XGN A;  3MR1 A;  2EVM A;  2P98 A;  1WN1 A;  4U6W A;  2EA4 A;  2GTX A;  2V3Y A;  2GG5 A;  4IKS A;  4IU6 A;  4FKC A;  1QXY A;  2BWT A;  2GU7 A;  1Y1N A;  1R58 A;  2GU4 A;  4MAT A;  4IF7 A;  1WKM A;  4IKR A;  3RVA A;  5CE6 A;  2GZ5 A;  4S2T P;  3FMR A;  2Q8K A;  2GG9 A;  2ZSG A;  4A6W A;  4U71 A;  1WL6 A;  2GA2 A;  4U75 A;  2GU5 A;  1R5G A;  4RZY A;  2NQ7 A;  1QXZ A;  2Q94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...