2GG5A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 81
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg5A00
4PNCA 1WY2A 1QZYA 4EGEA 2Q94A 4A6WA 5FCFA 4U73A 4S00A 3TAVA 2OAZA 2P99A 2Q93A 1YW7A 3IG4A 2GG2A 2BWSA 3PKEA 3RORA 1R5GA 3PKAA 3BIPA 3FMQA 2Q8KA 1XGNA 4ZNGA 2EA2A 2P98A 4U6CA 4IKSA 3CTZA 2GG3A 4S01A 4KM3A 2GA2A 2B3KA 3IU8A 3FMRA 1C21A 1XNZA 2BWTA 2IW2A 4RZYA 3MR1A 4R60A 2OKNA 4MATA 1YW8A 2Q96A 3D27A 5CE6A 3L24A 3FM3A 4IF7A 2EVMA 4FLKA 4S2RP 5JFRA 2GU7A 5CDVA 5CDLA 5JHUA 1YJ3A 4RGZ1 1C24A 2GGBA 4RZZA 4IKTA 2GG7A 1QXWA 1BN5A 2NQ7A 2V6CA 2V3YA 4U70A 2ZSGA 1WKMA 3L7GA 4IU6A 3BITA 2G6PA 4U69A 2HOWA 5CNXA 2BB7A 1PV9A 3PKCA 5D6EA 4FLJA 4FLLA 3MATA 4FLIA 1YVMA 1B6AA 1YW9A 3MX6A 2DFIA 2V3ZA 1WL6A 1WL9A 2BHDA 1R58A 2Q92A 4U71A 4ZWOA 1KP0A 3RVAA 3PKDA 3IU7A 4S2TP 4U6JA 4U76A 2BWYA 1XGSA 2GG8A 4IKUA 4U75A 5JI6A 2EVCA 2BHAA 3BIQA 2P9AA 2NQ6A 2BWVA 2V3XA 1W7VA 2Q95A 4U6ZA 1N51A 2EA4A 2GG5A 4ZWUA 1XGOA 2BWWA 2GU4A 1KQ0A 1XGMA 1C23A 1C22A 1MATA 2EVOA 1WLRA 2GG9A 1C27A 3PKBA 2BWUA 3Q6DA 1QXZA 5D6FA 5E5BA 3S6BA 2B3HA 4FKCA 4PV4A 4Z7MA 1BOAA 4IDYA 2BHBA 3CB5A 1Y1NA 2BH3A 5CLSA 4QR8A 1B59A 4ZWPA 1O0XA 2B3LA 2GTXA 4U6EA 2BWXA 4B28A 1CHMA 4U1BA 3IU9A 1JAWA 1M35A 4FUKA 1R5HA 4IKRA 2BHCA 1A16A 2MATA 3CB6A 2GU5A 1WBQA 4FO7A 1W2MA 4OOKA 4U6WA 3TB5A 1KQ9A 4IECA 1QXYA 4IPAA 2GG0A 5CIKA 2BN7A 4HXXA 4JUQA 4FO8A 1WN1A 4A6VA 2GGCA 2GU6A 5FCHA 2GZ5A 2ADUA 5CDEA
chains in the Genus database with same CATH superfamily
4PNCA 1WY2A 1QZYA 4EGEA 2Q94A 4A6WA 5FCFA 4U73A 4S00A 3TAVA 2OAZA 2P99A 2Q93A 1YW7A 3IG4A 2GG2A 2BWSA 3PKEA 3RORA 1R5GA 3PKAA 3BIPA 3FMQA 2Q8KA 1XGNA 4ZNGA 2EA2A 2P98A 4U6CA 4IKSA 3CTZA 2GG3A 4S01A 4KM3A 2GA2A 2B3KA 3IU8A 3FMRA 1C21A 1XNZA 2BWTA 2IW2A 4RZYA 3MR1A 4R60A 2OKNA 4MATA 1YW8A 2Q96A 3D27A 5CE6A 3L24A 3FM3A 4IF7A 2EVMA 4FLKA 4S2RP 5JFRA 2GU7A 5CDVA 5CDLA 5JHUA 1YJ3A 4RGZ1 1C24A 2GGBA 4RZZA 4IKTA 2GG7A 1QXWA 1BN5A 2NQ7A 2V6CA 2V3YA 4U70A 2ZSGA 1WKMA 3L7GA 4IU6A 3BITA 2G6PA 4U69A 2HOWA 5CNXA 2BB7A 1PV9A 3PKCA 5D6EA 4FLJA 4FLLA 3MATA 4FLIA 1YVMA 1B6AA 1YW9A 3MX6A 2DFIA 2V3ZA 1WL6A 1WL9A 2BHDA 1R58A 2Q92A 4U71A 4ZWOA 1KP0A 3RVAA 3PKDA 3IU7A 4S2TP 4U6JA 4U76A 2BWYA 1XGSA 2GG8A 4IKUA 4U75A 5JI6A 2EVCA 2BHAA 3BIQA 2P9AA 2NQ6A 2BWVA 2V3XA 1W7VA 2Q95A 4U6ZA 1N51A 2EA4A 2GG5A 4ZWUA 1XGOA 2BWWA 2GU4A 1KQ0A 1XGMA 1C23A 1C22A 1MATA 2EVOA 1WLRA 2GG9A 1C27A 3PKBA 2BWUA 3Q6DA 1QXZA 5D6FA 5E5BA 3S6BA 2B3HA 4FKCA 4PV4A 4Z7MA 1BOAA 4IDYA 2BHBA 3CB5A 1Y1NA 2BH3A 5CLSA 4QR8A 1B59A 4ZWPA 1O0XA 2B3LA 2GTXA 4U6EA 2BWXA 4B28A 1CHMA 4U1BA 3IU9A 1JAWA 1M35A 4FUKA 1R5HA 4IKRA 2BHCA 1A16A 2MATA 3CB6A 2GU5A 1WBQA 4FO7A 1W2MA 4OOKA 4U6WA 3TB5A 1KQ9A 4IECA 1QXYA 4IPAA 2GG0A 5CIKA 2BN7A 4HXXA 4JUQA 4FO8A 1WN1A 4A6VA 2GGCA 2GU6A 5FCHA 2GZ5A 2ADUA 5CDEA
chains in the Genus database with same CATH topology
4PNCA 1WY2A 1QZYA 4EGEA 2Q94A 4A6WA 5FCFA 4U73A 4S00A 3TAVA 2OAZA 2P99A 2Q93A 1YW7A 3IG4A 2GG2A 2BWSA 3PKEA 3RORA 1R5GA 3PKAA 3BIPA 3FMQA 2Q8KA 1XGNA 4ZNGA 2EA2A 2P98A 4U6CA 4IKSA 3CTZA 2GG3A 4S01A 4KM3A 2GA2A 2B3KA 3IU8A 3FMRA 1C21A 1XNZA 2BWTA 2IW2A 4RZYA 3MR1A 4R60A 2OKNA 4MATA 1YW8A 2Q96A 3D27A 5CE6A 3L24A 3FM3A 4IF7A 2EVMA 4FLKA 4S2RP 5JFRA 2GU7A 5CDVA 5CDLA 5JHUA 1YJ3A 4RGZ1 1C24A 2GGBA 4RZZA 4IKTA 2GG7A 1QXWA 1BN5A 2NQ7A 2V6CA 2V3YA 4U70A 2ZSGA 1WKMA 3L7GA 4IU6A 3BITA 2G6PA 4U69A 2HOWA 5CNXA 2BB7A 1PV9A 3PKCA 5D6EA 4FLJA 4FLLA 3MATA 4FLIA 1YVMA 1B6AA 1YW9A 3MX6A 2DFIA 2V3ZA 1WL6A 1WL9A 2BHDA 1R58A 2Q92A 4U71A 4ZWOA 1KP0A 3RVAA 3PKDA 3IU7A 4S2TP 4U6JA 4U76A 2BWYA 1XGSA 2GG8A 4IKUA 4U75A 5JI6A 2EVCA 2BHAA 3BIQA 2P9AA 2NQ6A 2BWVA 2V3XA 1W7VA 2Q95A 4U6ZA 1N51A 2EA4A 2GG5A 4ZWUA 1XGOA 2BWWA 2GU4A 1KQ0A 1XGMA 1C23A 1C22A 1MATA 2EVOA 1WLRA 2GG9A 1C27A 3PKBA 2BWUA 3Q6DA 1QXZA 5D6FA 5E5BA 3S6BA 2B3HA 4FKCA 4PV4A 4Z7MA 1BOAA 4IDYA 2BHBA 3CB5A 1Y1NA 2BH3A 5CLSA 4QR8A 1B59A 4ZWPA 1O0XA 2B3LA 2GTXA 4U6EA 2BWXA 4B28A 1CHMA 4U1BA 3IU9A 1JAWA 1M35A 4FUKA 1R5HA 4IKRA 2BHCA 1A16A 2MATA 3CB6A 2GU5A 1WBQA 4FO7A 1W2MA 4OOKA 4U6WA 3TB5A 1KQ9A 4IECA 1QXYA 4IPAA 2GG0A 5CIKA 2BN7A 4HXXA 4JUQA 4FO8A 1WN1A 4A6VA 2GGCA 2GU6A 5FCHA 2GZ5A 2ADUA 5CDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNC A;  1WY2 A;  1QZY A;  4EGE A;  2Q94 A;  4A6W A;  5FCF A;  4U73 A;  4S00 A;  3TAV A;  2OAZ A;  2P99 A;  2Q93 A;  1YW7 A;  3IG4 A;  2GG2 A;  2BWS A;  3PKE A;  3ROR A;  1R5G A;  3PKA A;  3BIP A;  3FMQ A;  2Q8K A;  1XGN A;  4ZNG A;  2EA2 A;  2P98 A;  4U6C A;  4IKS A;  3CTZ A;  2GG3 A;  4S01 A;  4KM3 A;  2GA2 A;  2B3K A;  3IU8 A;  3FMR A;  1C21 A;  1XNZ A;  2BWT A;  2IW2 A;  4RZY A;  3MR1 A;  4R60 A;  2OKN A;  4MAT A;  1YW8 A;  2Q96 A;  3D27 A;  5CE6 A;  3L24 A;  3FM3 A;  4IF7 A;  2EVM A;  4FLK A;  4S2R P;  5JFR A;  2GU7 A;  5CDV A;  5CDL A;  5JHU A;  1YJ3 A;  4RGZ 1;  1C24 A;  2GGB A;  4RZZ A;  4IKT A;  2GG7 A;  1QXW A;  1BN5 A;  2NQ7 A;  2V6C A;  2V3Y A;  4U70 A;  2ZSG A;  1WKM A;  3L7G A;  4IU6 A;  3BIT A;  2G6P A;  4U69 A;  2HOW A;  5CNX A;  2BB7 A;  1PV9 A;  3PKC A;  5D6E A;  4FLJ A;  4FLL A;  3MAT A;  4FLI A;  1YVM A;  1B6A A;  1YW9 A;  3MX6 A;  2DFI A;  2V3Z A;  1WL6 A;  1WL9 A;  2BHD A;  1R58 A;  2Q92 A;  4U71 A;  4ZWO A;  1KP0 A;  3RVA A;  3PKD A;  3IU7 A;  4S2T P;  4U6J A;  4U76 A;  2BWY A;  1XGS A;  2GG8 A;  4IKU A;  4U75 A;  5JI6 A;  2EVC A;  2BHA A;  3BIQ A;  2P9A A;  2NQ6 A;  2BWV A;  2V3X A;  1W7V A;  2Q95 A;  4U6Z A;  1N51 A;  2EA4 A;  2GG5 A;  4ZWU A;  1XGO A;  2BWW A;  2GU4 A;  1KQ0 A;  1XGM A;  1C23 A;  1C22 A;  1MAT A;  2EVO A;  1WLR A;  2GG9 A;  1C27 A;  3PKB A;  2BWU A;  3Q6D A;  1QXZ A;  5D6F A;  5E5B A;  3S6B A;  2B3H A;  4FKC A;  4PV4 A;  4Z7M A;  1BOA A;  4IDY A;  2BHB A;  3CB5 A;  1Y1N A;  2BH3 A;  5CLS A;  4QR8 A;  1B59 A;  4ZWP A;  1O0X A;  2B3L A;  2GTX A;  4U6E A;  2BWX A;  4B28 A;  1CHM A;  4U1B A;  3IU9 A;  1JAW A;  1M35 A;  4FUK A;  1R5H A;  4IKR A;  2BHC A;  1A16 A;  2MAT A;  3CB6 A;  2GU5 A;  1WBQ A;  4FO7 A;  1W2M A;  4OOK A;  4U6W A;  3TB5 A;  1KQ9 A;  4IEC A;  1QXY A;  4IPA A;  2GG0 A;  5CIK A;  2BN7 A;  4HXX A;  4JUQ A;  4FO8 A;  1WN1 A;  4A6V A;  2GGC A;  2GU6 A;  5FCH A;  2GZ5 A;  2ADU A;  5CDE A; 
#chains in the Genus database with same CATH topology
 4PNC A;  1WY2 A;  1QZY A;  4EGE A;  2Q94 A;  4A6W A;  5FCF A;  4U73 A;  4S00 A;  3TAV A;  2OAZ A;  2P99 A;  2Q93 A;  1YW7 A;  3IG4 A;  2GG2 A;  2BWS A;  3PKE A;  3ROR A;  1R5G A;  3PKA A;  3BIP A;  3FMQ A;  2Q8K A;  1XGN A;  4ZNG A;  2EA2 A;  2P98 A;  4U6C A;  4IKS A;  3CTZ A;  2GG3 A;  4S01 A;  4KM3 A;  2GA2 A;  2B3K A;  3IU8 A;  3FMR A;  1C21 A;  1XNZ A;  2BWT A;  2IW2 A;  4RZY A;  3MR1 A;  4R60 A;  2OKN A;  4MAT A;  1YW8 A;  2Q96 A;  3D27 A;  5CE6 A;  3L24 A;  3FM3 A;  4IF7 A;  2EVM A;  4FLK A;  4S2R P;  5JFR A;  2GU7 A;  5CDV A;  5CDL A;  5JHU A;  1YJ3 A;  4RGZ 1;  1C24 A;  2GGB A;  4RZZ A;  4IKT A;  2GG7 A;  1QXW A;  1BN5 A;  2NQ7 A;  2V6C A;  2V3Y A;  4U70 A;  2ZSG A;  1WKM A;  3L7G A;  4IU6 A;  3BIT A;  2G6P A;  4U69 A;  2HOW A;  5CNX A;  2BB7 A;  1PV9 A;  3PKC A;  5D6E A;  4FLJ A;  4FLL A;  3MAT A;  4FLI A;  1YVM A;  1B6A A;  1YW9 A;  3MX6 A;  2DFI A;  2V3Z A;  1WL6 A;  1WL9 A;  2BHD A;  1R58 A;  2Q92 A;  4U71 A;  4ZWO A;  1KP0 A;  3RVA A;  3PKD A;  3IU7 A;  4S2T P;  4U6J A;  4U76 A;  2BWY A;  1XGS A;  2GG8 A;  4IKU A;  4U75 A;  5JI6 A;  2EVC A;  2BHA A;  3BIQ A;  2P9A A;  2NQ6 A;  2BWV A;  2V3X A;  1W7V A;  2Q95 A;  4U6Z A;  1N51 A;  2EA4 A;  2GG5 A;  4ZWU A;  1XGO A;  2BWW A;  2GU4 A;  1KQ0 A;  1XGM A;  1C23 A;  1C22 A;  1MAT A;  2EVO A;  1WLR A;  2GG9 A;  1C27 A;  3PKB A;  2BWU A;  3Q6D A;  1QXZ A;  5D6F A;  5E5B A;  3S6B A;  2B3H A;  4FKC A;  4PV4 A;  4Z7M A;  1BOA A;  4IDY A;  2BHB A;  3CB5 A;  1Y1N A;  2BH3 A;  5CLS A;  4QR8 A;  1B59 A;  4ZWP A;  1O0X A;  2B3L A;  2GTX A;  4U6E A;  2BWX A;  4B28 A;  1CHM A;  4U1B A;  3IU9 A;  1JAW A;  1M35 A;  4FUK A;  1R5H A;  4IKR A;  2BHC A;  1A16 A;  2MAT A;  3CB6 A;  2GU5 A;  1WBQ A;  4FO7 A;  1W2M A;  4OOK A;  4U6W A;  3TB5 A;  1KQ9 A;  4IEC A;  1QXY A;  4IPA A;  2GG0 A;  5CIK A;  2BN7 A;  4HXX A;  4JUQ A;  4FO8 A;  1WN1 A;  4A6V A;  2GGC A;  2GU6 A;  5FCH A;  2GZ5 A;  2ADU A;  5CDE A; 
#chains in the Genus database with same CATH homology
 4PNC A;  1WY2 A;  1QZY A;  4EGE A;  2Q94 A;  4A6W A;  5FCF A;  4U73 A;  4S00 A;  3TAV A;  2OAZ A;  2P99 A;  2Q93 A;  1YW7 A;  3IG4 A;  2GG2 A;  2BWS A;  3PKE A;  3ROR A;  1R5G A;  3PKA A;  3BIP A;  3FMQ A;  2Q8K A;  1XGN A;  4ZNG A;  2EA2 A;  2P98 A;  4U6C A;  4IKS A;  3CTZ A;  2GG3 A;  4S01 A;  4KM3 A;  2GA2 A;  2B3K A;  3IU8 A;  3FMR A;  1C21 A;  1XNZ A;  2BWT A;  2IW2 A;  4RZY A;  3MR1 A;  4R60 A;  2OKN A;  4MAT A;  1YW8 A;  2Q96 A;  3D27 A;  5CE6 A;  3L24 A;  3FM3 A;  4IF7 A;  2EVM A;  4FLK A;  4S2R P;  5JFR A;  2GU7 A;  5CDV A;  5CDL A;  5JHU A;  1YJ3 A;  4RGZ 1;  1C24 A;  2GGB A;  4RZZ A;  4IKT A;  2GG7 A;  1QXW A;  1BN5 A;  2NQ7 A;  2V6C A;  2V3Y A;  4U70 A;  2ZSG A;  1WKM A;  3L7G A;  4IU6 A;  3BIT A;  2G6P A;  4U69 A;  2HOW A;  5CNX A;  2BB7 A;  1PV9 A;  3PKC A;  5D6E A;  4FLJ A;  4FLL A;  3MAT A;  4FLI A;  1YVM A;  1B6A A;  1YW9 A;  3MX6 A;  2DFI A;  2V3Z A;  1WL6 A;  1WL9 A;  2BHD A;  1R58 A;  2Q92 A;  4U71 A;  4ZWO A;  1KP0 A;  3RVA A;  3PKD A;  3IU7 A;  4S2T P;  4U6J A;  4U76 A;  2BWY A;  1XGS A;  2GG8 A;  4IKU A;  4U75 A;  5JI6 A;  2EVC A;  2BHA A;  3BIQ A;  2P9A A;  2NQ6 A;  2BWV A;  2V3X A;  1W7V A;  2Q95 A;  4U6Z A;  1N51 A;  2EA4 A;  2GG5 A;  4ZWU A;  1XGO A;  2BWW A;  2GU4 A;  1KQ0 A;  1XGM A;  1C23 A;  1C22 A;  1MAT A;  2EVO A;  1WLR A;  2GG9 A;  1C27 A;  3PKB A;  2BWU A;  3Q6D A;  1QXZ A;  5D6F A;  5E5B A;  3S6B A;  2B3H A;  4FKC A;  4PV4 A;  4Z7M A;  1BOA A;  4IDY A;  2BHB A;  3CB5 A;  1Y1N A;  2BH3 A;  5CLS A;  4QR8 A;  1B59 A;  4ZWP A;  1O0X A;  2B3L A;  2GTX A;  4U6E A;  2BWX A;  4B28 A;  1CHM A;  4U1B A;  3IU9 A;  1JAW A;  1M35 A;  4FUK A;  1R5H A;  4IKR A;  2BHC A;  1A16 A;  2MAT A;  3CB6 A;  2GU5 A;  1WBQ A;  4FO7 A;  1W2M A;  4OOK A;  4U6W A;  3TB5 A;  1KQ9 A;  4IEC A;  1QXY A;  4IPA A;  2GG0 A;  5CIK A;  2BN7 A;  4HXX A;  4JUQ A;  4FO8 A;  1WN1 A;  4A6V A;  2GGC A;  2GU6 A;  5FCH A;  2GZ5 A;  2ADU A;  5CDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...