2GG5A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 81
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg5A00
3FM3A 1WKMA 5E5BA 2BB7A 2BN7A 4FUKA 1C24A 3RVAA 1C27A 2BWYA 3L24A 2EVMA 4U76A 1QXWA 2OKNA 2GZ5A 2B3HA 2B3LA 2V3XA 4U69A 2BWXA 1QXZA 5CLSA 4R60A 2V3ZA 4RZYA 2BHAA 4B28A 2BWWA 1BN5A 1QZYA 2DFIA 4FO7A 4U6CA 1O0XA 4S2RP 2EA2A 1WBQA 4RGZ1 4IU6A 1M35A 2OAZA 4U73A 1CHMA 4KM3A 1WY2A 2P99A 1YVMA 4RZZA 1A16A 4PV4A 1XGSA 4S2TP 2B3KA 5CNXA 2GA2A 4IECA 2P98A 1B59A 2BWSA 1XGMA 3FMRA 4ZNGA 3BIQA 1YW9A 2Q96A 4U1BA 4U6WA 1C22A 2Q94A 5CDLA 4OOKA 4U6JA 2NQ6A 1JAWA 4S01A 2BHBA 2GGCA 3PKBA 2Q8KA 2GG3A 4JUQA 3IU8A 2BWVA 3D27A 5FCFA 3MATA 1B6AA 1KQ0A 4ZWOA 3IG4A 3TAVA 2Q93A 2ZSGA 1QXYA 1MATA 1N51A 4IKUA 2GU6A 3RORA 4FLLA 1Y1NA 3MX6A 5JHUA 1XNZA 4FO8A 2GU7A 4IPAA 2HOWA 3IU9A 4PNCA 1C21A 4IKSA 2V6CA 3IU7A 2P9AA 1YJ3A 4IKTA 3PKDA 1W7VA 2BWUA 2MATA 4HXXA 4FLIA 2V3YA 4A6WA 5JFRA 4U70A 2ADUA 1KQ9A 4QR8A 3MR1A 5CDVA 1R5GA 4U71A 4IF7A 1R58A 1YW7A 1C23A 4S00A 4FKCA 4U6EA 4IKRA 4IDYA 1PV9A 1WN1A 4Z7MA 4U6ZA 2BHCA 4U75A 5CDEA 1WLRA 2GU4A 1WL9A 2GTXA 3CB5A 5CIKA 5D6FA 2GU5A 3PKCA 3Q6DA 5JI6A 1XGOA 1XGNA 2BWTA 2EVCA 5FCHA 2NQ7A 3TB5A 4FLJA 2EVOA 3BITA 2Q95A 1R5HA 4A6VA 3CTZA 4EGEA 3FMQA 2G6PA 1YW8A 2GGBA 4MATA 2GG7A 3PKEA 2GG0A 3CB6A 2EA4A 2GG8A 4ZWUA 2GG9A 2BH3A 1BOAA 2BHDA 1WL6A 5D6EA 1KP0A 3PKAA 1W2MA 3S6BA 2Q92A 5CE6A 2GG5A 2IW2A 3BIPA 3L7GA 4ZWPA 4FLKA 2GG2A
chains in the Genus database with same CATH superfamily
3FM3A 1WKMA 5E5BA 2BB7A 2BN7A 4FUKA 1C24A 3RVAA 1C27A 2BWYA 3L24A 2EVMA 4U76A 1QXWA 2OKNA 2GZ5A 2B3HA 2B3LA 2V3XA 4U69A 2BWXA 1QXZA 5CLSA 4R60A 2V3ZA 4RZYA 2BHAA 4B28A 2BWWA 1BN5A 1QZYA 2DFIA 4FO7A 4U6CA 1O0XA 4S2RP 2EA2A 1WBQA 4RGZ1 4IU6A 1M35A 2OAZA 4U73A 1CHMA 4KM3A 1WY2A 2P99A 1YVMA 4RZZA 1A16A 4PV4A 1XGSA 4S2TP 2B3KA 5CNXA 2GA2A 4IECA 2P98A 1B59A 2BWSA 1XGMA 3FMRA 4ZNGA 3BIQA 1YW9A 2Q96A 4U1BA 4U6WA 1C22A 2Q94A 5CDLA 4OOKA 4U6JA 2NQ6A 1JAWA 4S01A 2BHBA 2GGCA 3PKBA 2Q8KA 2GG3A 4JUQA 3IU8A 2BWVA 3D27A 5FCFA 3MATA 1B6AA 1KQ0A 4ZWOA 3IG4A 3TAVA 2Q93A 2ZSGA 1QXYA 1MATA 1N51A 4IKUA 2GU6A 3RORA 4FLLA 1Y1NA 3MX6A 5JHUA 1XNZA 4FO8A 2GU7A 4IPAA 2HOWA 3IU9A 4PNCA 1C21A 4IKSA 2V6CA 3IU7A 2P9AA 1YJ3A 4IKTA 3PKDA 1W7VA 2BWUA 2MATA 4HXXA 4FLIA 2V3YA 4A6WA 5JFRA 4U70A 2ADUA 1KQ9A 4QR8A 3MR1A 5CDVA 1R5GA 4U71A 4IF7A 1R58A 1YW7A 1C23A 4S00A 4FKCA 4U6EA 4IKRA 4IDYA 1PV9A 1WN1A 4Z7MA 4U6ZA 2BHCA 4U75A 5CDEA 1WLRA 2GU4A 1WL9A 2GTXA 3CB5A 5CIKA 5D6FA 2GU5A 3PKCA 3Q6DA 5JI6A 1XGOA 1XGNA 2BWTA 2EVCA 5FCHA 2NQ7A 3TB5A 4FLJA 2EVOA 3BITA 2Q95A 1R5HA 4A6VA 3CTZA 4EGEA 3FMQA 2G6PA 1YW8A 2GGBA 4MATA 2GG7A 3PKEA 2GG0A 3CB6A 2EA4A 2GG8A 4ZWUA 2GG9A 2BH3A 1BOAA 2BHDA 1WL6A 5D6EA 1KP0A 3PKAA 1W2MA 3S6BA 2Q92A 5CE6A 2GG5A 2IW2A 3BIPA 3L7GA 4ZWPA 4FLKA 2GG2A
chains in the Genus database with same CATH topology
3FM3A 1WKMA 5E5BA 2BB7A 2BN7A 4FUKA 1C24A 3RVAA 1C27A 2BWYA 3L24A 2EVMA 4U76A 1QXWA 2OKNA 2GZ5A 2B3HA 2B3LA 2V3XA 4U69A 2BWXA 1QXZA 5CLSA 4R60A 2V3ZA 4RZYA 2BHAA 4B28A 2BWWA 1BN5A 1QZYA 2DFIA 4FO7A 4U6CA 1O0XA 4S2RP 2EA2A 1WBQA 4RGZ1 4IU6A 1M35A 2OAZA 4U73A 1CHMA 4KM3A 1WY2A 2P99A 1YVMA 4RZZA 1A16A 4PV4A 1XGSA 4S2TP 2B3KA 5CNXA 2GA2A 4IECA 2P98A 1B59A 2BWSA 1XGMA 3FMRA 4ZNGA 3BIQA 1YW9A 2Q96A 4U1BA 4U6WA 1C22A 2Q94A 5CDLA 4OOKA 4U6JA 2NQ6A 1JAWA 4S01A 2BHBA 2GGCA 3PKBA 2Q8KA 2GG3A 4JUQA 3IU8A 2BWVA 3D27A 5FCFA 3MATA 1B6AA 1KQ0A 4ZWOA 3IG4A 3TAVA 2Q93A 2ZSGA 1QXYA 1MATA 1N51A 4IKUA 2GU6A 3RORA 4FLLA 1Y1NA 3MX6A 5JHUA 1XNZA 4FO8A 2GU7A 4IPAA 2HOWA 3IU9A 4PNCA 1C21A 4IKSA 2V6CA 3IU7A 2P9AA 1YJ3A 4IKTA 3PKDA 1W7VA 2BWUA 2MATA 4HXXA 4FLIA 2V3YA 4A6WA 5JFRA 4U70A 2ADUA 1KQ9A 4QR8A 3MR1A 5CDVA 1R5GA 4U71A 4IF7A 1R58A 1YW7A 1C23A 4S00A 4FKCA 4U6EA 4IKRA 4IDYA 1PV9A 1WN1A 4Z7MA 4U6ZA 2BHCA 4U75A 5CDEA 1WLRA 2GU4A 1WL9A 2GTXA 3CB5A 5CIKA 5D6FA 2GU5A 3PKCA 3Q6DA 5JI6A 1XGOA 1XGNA 2BWTA 2EVCA 5FCHA 2NQ7A 3TB5A 4FLJA 2EVOA 3BITA 2Q95A 1R5HA 4A6VA 3CTZA 4EGEA 3FMQA 2G6PA 1YW8A 2GGBA 4MATA 2GG7A 3PKEA 2GG0A 3CB6A 2EA4A 2GG8A 4ZWUA 2GG9A 2BH3A 1BOAA 2BHDA 1WL6A 5D6EA 1KP0A 3PKAA 1W2MA 3S6BA 2Q92A 5CE6A 2GG5A 2IW2A 3BIPA 3L7GA 4ZWPA 4FLKA 2GG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM3 A;  1WKM A;  5E5B A;  2BB7 A;  2BN7 A;  4FUK A;  1C24 A;  3RVA A;  1C27 A;  2BWY A;  3L24 A;  2EVM A;  4U76 A;  1QXW A;  2OKN A;  2GZ5 A;  2B3H A;  2B3L A;  2V3X A;  4U69 A;  2BWX A;  1QXZ A;  5CLS A;  4R60 A;  2V3Z A;  4RZY A;  2BHA A;  4B28 A;  2BWW A;  1BN5 A;  1QZY A;  2DFI A;  4FO7 A;  4U6C A;  1O0X A;  4S2R P;  2EA2 A;  1WBQ A;  4RGZ 1;  4IU6 A;  1M35 A;  2OAZ A;  4U73 A;  1CHM A;  4KM3 A;  1WY2 A;  2P99 A;  1YVM A;  4RZZ A;  1A16 A;  4PV4 A;  1XGS A;  4S2T P;  2B3K A;  5CNX A;  2GA2 A;  4IEC A;  2P98 A;  1B59 A;  2BWS A;  1XGM A;  3FMR A;  4ZNG A;  3BIQ A;  1YW9 A;  2Q96 A;  4U1B A;  4U6W A;  1C22 A;  2Q94 A;  5CDL A;  4OOK A;  4U6J A;  2NQ6 A;  1JAW A;  4S01 A;  2BHB A;  2GGC A;  3PKB A;  2Q8K A;  2GG3 A;  4JUQ A;  3IU8 A;  2BWV A;  3D27 A;  5FCF A;  3MAT A;  1B6A A;  1KQ0 A;  4ZWO A;  3IG4 A;  3TAV A;  2Q93 A;  2ZSG A;  1QXY A;  1MAT A;  1N51 A;  4IKU A;  2GU6 A;  3ROR A;  4FLL A;  1Y1N A;  3MX6 A;  5JHU A;  1XNZ A;  4FO8 A;  2GU7 A;  4IPA A;  2HOW A;  3IU9 A;  4PNC A;  1C21 A;  4IKS A;  2V6C A;  3IU7 A;  2P9A A;  1YJ3 A;  4IKT A;  3PKD A;  1W7V A;  2BWU A;  2MAT A;  4HXX A;  4FLI A;  2V3Y A;  4A6W A;  5JFR A;  4U70 A;  2ADU A;  1KQ9 A;  4QR8 A;  3MR1 A;  5CDV A;  1R5G A;  4U71 A;  4IF7 A;  1R58 A;  1YW7 A;  1C23 A;  4S00 A;  4FKC A;  4U6E A;  4IKR A;  4IDY A;  1PV9 A;  1WN1 A;  4Z7M A;  4U6Z A;  2BHC A;  4U75 A;  5CDE A;  1WLR A;  2GU4 A;  1WL9 A;  2GTX A;  3CB5 A;  5CIK A;  5D6F A;  2GU5 A;  3PKC A;  3Q6D A;  5JI6 A;  1XGO A;  1XGN A;  2BWT A;  2EVC A;  5FCH A;  2NQ7 A;  3TB5 A;  4FLJ A;  2EVO A;  3BIT A;  2Q95 A;  1R5H A;  4A6V A;  3CTZ A;  4EGE A;  3FMQ A;  2G6P A;  1YW8 A;  2GGB A;  4MAT A;  2GG7 A;  3PKE A;  2GG0 A;  3CB6 A;  2EA4 A;  2GG8 A;  4ZWU A;  2GG9 A;  2BH3 A;  1BOA A;  2BHD A;  1WL6 A;  5D6E A;  1KP0 A;  3PKA A;  1W2M A;  3S6B A;  2Q92 A;  5CE6 A;  2GG5 A;  2IW2 A;  3BIP A;  3L7G A;  4ZWP A;  4FLK A;  2GG2 A; 
#chains in the Genus database with same CATH topology
 3FM3 A;  1WKM A;  5E5B A;  2BB7 A;  2BN7 A;  4FUK A;  1C24 A;  3RVA A;  1C27 A;  2BWY A;  3L24 A;  2EVM A;  4U76 A;  1QXW A;  2OKN A;  2GZ5 A;  2B3H A;  2B3L A;  2V3X A;  4U69 A;  2BWX A;  1QXZ A;  5CLS A;  4R60 A;  2V3Z A;  4RZY A;  2BHA A;  4B28 A;  2BWW A;  1BN5 A;  1QZY A;  2DFI A;  4FO7 A;  4U6C A;  1O0X A;  4S2R P;  2EA2 A;  1WBQ A;  4RGZ 1;  4IU6 A;  1M35 A;  2OAZ A;  4U73 A;  1CHM A;  4KM3 A;  1WY2 A;  2P99 A;  1YVM A;  4RZZ A;  1A16 A;  4PV4 A;  1XGS A;  4S2T P;  2B3K A;  5CNX A;  2GA2 A;  4IEC A;  2P98 A;  1B59 A;  2BWS A;  1XGM A;  3FMR A;  4ZNG A;  3BIQ A;  1YW9 A;  2Q96 A;  4U1B A;  4U6W A;  1C22 A;  2Q94 A;  5CDL A;  4OOK A;  4U6J A;  2NQ6 A;  1JAW A;  4S01 A;  2BHB A;  2GGC A;  3PKB A;  2Q8K A;  2GG3 A;  4JUQ A;  3IU8 A;  2BWV A;  3D27 A;  5FCF A;  3MAT A;  1B6A A;  1KQ0 A;  4ZWO A;  3IG4 A;  3TAV A;  2Q93 A;  2ZSG A;  1QXY A;  1MAT A;  1N51 A;  4IKU A;  2GU6 A;  3ROR A;  4FLL A;  1Y1N A;  3MX6 A;  5JHU A;  1XNZ A;  4FO8 A;  2GU7 A;  4IPA A;  2HOW A;  3IU9 A;  4PNC A;  1C21 A;  4IKS A;  2V6C A;  3IU7 A;  2P9A A;  1YJ3 A;  4IKT A;  3PKD A;  1W7V A;  2BWU A;  2MAT A;  4HXX A;  4FLI A;  2V3Y A;  4A6W A;  5JFR A;  4U70 A;  2ADU A;  1KQ9 A;  4QR8 A;  3MR1 A;  5CDV A;  1R5G A;  4U71 A;  4IF7 A;  1R58 A;  1YW7 A;  1C23 A;  4S00 A;  4FKC A;  4U6E A;  4IKR A;  4IDY A;  1PV9 A;  1WN1 A;  4Z7M A;  4U6Z A;  2BHC A;  4U75 A;  5CDE A;  1WLR A;  2GU4 A;  1WL9 A;  2GTX A;  3CB5 A;  5CIK A;  5D6F A;  2GU5 A;  3PKC A;  3Q6D A;  5JI6 A;  1XGO A;  1XGN A;  2BWT A;  2EVC A;  5FCH A;  2NQ7 A;  3TB5 A;  4FLJ A;  2EVO A;  3BIT A;  2Q95 A;  1R5H A;  4A6V A;  3CTZ A;  4EGE A;  3FMQ A;  2G6P A;  1YW8 A;  2GGB A;  4MAT A;  2GG7 A;  3PKE A;  2GG0 A;  3CB6 A;  2EA4 A;  2GG8 A;  4ZWU A;  2GG9 A;  2BH3 A;  1BOA A;  2BHD A;  1WL6 A;  5D6E A;  1KP0 A;  3PKA A;  1W2M A;  3S6B A;  2Q92 A;  5CE6 A;  2GG5 A;  2IW2 A;  3BIP A;  3L7G A;  4ZWP A;  4FLK A;  2GG2 A; 
#chains in the Genus database with same CATH homology
 3FM3 A;  1WKM A;  5E5B A;  2BB7 A;  2BN7 A;  4FUK A;  1C24 A;  3RVA A;  1C27 A;  2BWY A;  3L24 A;  2EVM A;  4U76 A;  1QXW A;  2OKN A;  2GZ5 A;  2B3H A;  2B3L A;  2V3X A;  4U69 A;  2BWX A;  1QXZ A;  5CLS A;  4R60 A;  2V3Z A;  4RZY A;  2BHA A;  4B28 A;  2BWW A;  1BN5 A;  1QZY A;  2DFI A;  4FO7 A;  4U6C A;  1O0X A;  4S2R P;  2EA2 A;  1WBQ A;  4RGZ 1;  4IU6 A;  1M35 A;  2OAZ A;  4U73 A;  1CHM A;  4KM3 A;  1WY2 A;  2P99 A;  1YVM A;  4RZZ A;  1A16 A;  4PV4 A;  1XGS A;  4S2T P;  2B3K A;  5CNX A;  2GA2 A;  4IEC A;  2P98 A;  1B59 A;  2BWS A;  1XGM A;  3FMR A;  4ZNG A;  3BIQ A;  1YW9 A;  2Q96 A;  4U1B A;  4U6W A;  1C22 A;  2Q94 A;  5CDL A;  4OOK A;  4U6J A;  2NQ6 A;  1JAW A;  4S01 A;  2BHB A;  2GGC A;  3PKB A;  2Q8K A;  2GG3 A;  4JUQ A;  3IU8 A;  2BWV A;  3D27 A;  5FCF A;  3MAT A;  1B6A A;  1KQ0 A;  4ZWO A;  3IG4 A;  3TAV A;  2Q93 A;  2ZSG A;  1QXY A;  1MAT A;  1N51 A;  4IKU A;  2GU6 A;  3ROR A;  4FLL A;  1Y1N A;  3MX6 A;  5JHU A;  1XNZ A;  4FO8 A;  2GU7 A;  4IPA A;  2HOW A;  3IU9 A;  4PNC A;  1C21 A;  4IKS A;  2V6C A;  3IU7 A;  2P9A A;  1YJ3 A;  4IKT A;  3PKD A;  1W7V A;  2BWU A;  2MAT A;  4HXX A;  4FLI A;  2V3Y A;  4A6W A;  5JFR A;  4U70 A;  2ADU A;  1KQ9 A;  4QR8 A;  3MR1 A;  5CDV A;  1R5G A;  4U71 A;  4IF7 A;  1R58 A;  1YW7 A;  1C23 A;  4S00 A;  4FKC A;  4U6E A;  4IKR A;  4IDY A;  1PV9 A;  1WN1 A;  4Z7M A;  4U6Z A;  2BHC A;  4U75 A;  5CDE A;  1WLR A;  2GU4 A;  1WL9 A;  2GTX A;  3CB5 A;  5CIK A;  5D6F A;  2GU5 A;  3PKC A;  3Q6D A;  5JI6 A;  1XGO A;  1XGN A;  2BWT A;  2EVC A;  5FCH A;  2NQ7 A;  3TB5 A;  4FLJ A;  2EVO A;  3BIT A;  2Q95 A;  1R5H A;  4A6V A;  3CTZ A;  4EGE A;  3FMQ A;  2G6P A;  1YW8 A;  2GGB A;  4MAT A;  2GG7 A;  3PKE A;  2GG0 A;  3CB6 A;  2EA4 A;  2GG8 A;  4ZWU A;  2GG9 A;  2BH3 A;  1BOA A;  2BHD A;  1WL6 A;  5D6E A;  1KP0 A;  3PKA A;  1W2M A;  3S6B A;  2Q92 A;  5CE6 A;  2GG5 A;  2IW2 A;  3BIP A;  3L7G A;  4ZWP A;  4FLK A;  2GG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...