2GG5A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 81
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg5A00
4B28A 3S6BA 1KQ9A 2BWWA 4Z7MA 2B3KA 2HOWA 3PKAA 2GG2A 1M35A 2GA2A 2GG3A 2Q92A 3IU9A 2Q94A 2BHAA 2GG0A 5CE6A 1WL9A 2GG8A 4FO7A 5JHUA 2Q93A 1YW7A 2EVMA 2BB7A 4FLKA 4IKUA 4U6CA 4ZNGA 1BN5A 2P99A 1R5GA 2GG5A 4RZYA 3TB5A 1XGSA 2BHCA 4OOKA 1QXWA 2GU4A 5JFRA 4EGEA 2GGCA 1R58A 1O0XA 1WY2A 4S01A 5CLSA 2EVOA 2V3ZA 4U71A 1C22A 4U6WA 3RVAA 2ZSGA 4FKCA 1W7VA 3FM3A 1WKMA 4U70A 5FCFA 2BN7A 1KQ0A 2BH3A 2Q8KA 3CB6A 2V3YA 3PKEA 3PKCA 4RZZA 5CNXA 3FMQA 2BHDA 4PV4A 3PKBA 5CIKA 3D27A 1YW9A 3BITA 1WBQA 2BWXA 3RORA 4A6VA 1WN1A 1JAWA 4PNCA 3FMRA 4IF7A 4FLLA 1WLRA 1QXZA 2GZ5A 5CDEA 1XGNA 5FCHA 2MATA 1KP0A 2G6PA 2BWTA 4FUKA 5CDLA 2B3HA 2EA2A 4HXXA 2NQ7A 2DFIA 1XGOA 4U75A 2GGBA 4KM3A 4U6EA 4IDYA 3MX6A 4IU6A 1PV9A 3BIPA 4U73A 3CB5A 2B3LA 1YW8A 1CHMA 4U6ZA 4RGZ1 2P9AA 2GU6A 1YVMA 1QXYA 2GG9A 2V6CA 1C27A 4ZWUA 3L7GA 4IECA 1N51A 2BWYA 2OAZA 2P98A 3L24A 2GU7A 5D6FA 1XGMA 2BWSA 4ZWPA 3IU7A 2Q95A 4IKSA 3CTZA 4S00A 4FLIA 2IW2A 3PKDA 2NQ6A 3IU8A 1YJ3A 1Y1NA 1B59A 4S2RP 1XNZA 4S2TP 3MR1A 4U76A 4MATA 1C23A 1C21A 3TAVA 1QZYA 2BWUA 4R60A 4A6WA 2ADUA 1WL6A 2GTXA 4U1BA 3MATA 1BOAA 5D6EA 1R5HA 1C24A 4QR8A 5E5BA 4JUQA 3Q6DA 2EA4A 4ZWOA 4U69A 4IPAA 4FO8A 4IKTA 4FLJA 2BWVA 2GU5A 2OKNA 2GG7A 3IG4A 1A16A 2BHBA 1MATA 1B6AA 5CDVA 1W2MA 5JI6A 2EVCA 4U6JA 2Q96A 4IKRA 3BIQA 2V3XA
chains in the Genus database with same CATH superfamily
4B28A 3S6BA 1KQ9A 2BWWA 4Z7MA 2B3KA 2HOWA 3PKAA 2GG2A 1M35A 2GA2A 2GG3A 2Q92A 3IU9A 2Q94A 2BHAA 2GG0A 5CE6A 1WL9A 2GG8A 4FO7A 5JHUA 2Q93A 1YW7A 2EVMA 2BB7A 4FLKA 4IKUA 4U6CA 4ZNGA 1BN5A 2P99A 1R5GA 2GG5A 4RZYA 3TB5A 1XGSA 2BHCA 4OOKA 1QXWA 2GU4A 5JFRA 4EGEA 2GGCA 1R58A 1O0XA 1WY2A 4S01A 5CLSA 2EVOA 2V3ZA 4U71A 1C22A 4U6WA 3RVAA 2ZSGA 4FKCA 1W7VA 3FM3A 1WKMA 4U70A 5FCFA 2BN7A 1KQ0A 2BH3A 2Q8KA 3CB6A 2V3YA 3PKEA 3PKCA 4RZZA 5CNXA 3FMQA 2BHDA 4PV4A 3PKBA 5CIKA 3D27A 1YW9A 3BITA 1WBQA 2BWXA 3RORA 4A6VA 1WN1A 1JAWA 4PNCA 3FMRA 4IF7A 4FLLA 1WLRA 1QXZA 2GZ5A 5CDEA 1XGNA 5FCHA 2MATA 1KP0A 2G6PA 2BWTA 4FUKA 5CDLA 2B3HA 2EA2A 4HXXA 2NQ7A 2DFIA 1XGOA 4U75A 2GGBA 4KM3A 4U6EA 4IDYA 3MX6A 4IU6A 1PV9A 3BIPA 4U73A 3CB5A 2B3LA 1YW8A 1CHMA 4U6ZA 4RGZ1 2P9AA 2GU6A 1YVMA 1QXYA 2GG9A 2V6CA 1C27A 4ZWUA 3L7GA 4IECA 1N51A 2BWYA 2OAZA 2P98A 3L24A 2GU7A 5D6FA 1XGMA 2BWSA 4ZWPA 3IU7A 2Q95A 4IKSA 3CTZA 4S00A 4FLIA 2IW2A 3PKDA 2NQ6A 3IU8A 1YJ3A 1Y1NA 1B59A 4S2RP 1XNZA 4S2TP 3MR1A 4U76A 4MATA 1C23A 1C21A 3TAVA 1QZYA 2BWUA 4R60A 4A6WA 2ADUA 1WL6A 2GTXA 4U1BA 3MATA 1BOAA 5D6EA 1R5HA 1C24A 4QR8A 5E5BA 4JUQA 3Q6DA 2EA4A 4ZWOA 4U69A 4IPAA 4FO8A 4IKTA 4FLJA 2BWVA 2GU5A 2OKNA 2GG7A 3IG4A 1A16A 2BHBA 1MATA 1B6AA 5CDVA 1W2MA 5JI6A 2EVCA 4U6JA 2Q96A 4IKRA 3BIQA 2V3XA
chains in the Genus database with same CATH topology
4B28A 3S6BA 1KQ9A 2BWWA 4Z7MA 2B3KA 2HOWA 3PKAA 2GG2A 1M35A 2GA2A 2GG3A 2Q92A 3IU9A 2Q94A 2BHAA 2GG0A 5CE6A 1WL9A 2GG8A 4FO7A 5JHUA 2Q93A 1YW7A 2EVMA 2BB7A 4FLKA 4IKUA 4U6CA 4ZNGA 1BN5A 2P99A 1R5GA 2GG5A 4RZYA 3TB5A 1XGSA 2BHCA 4OOKA 1QXWA 2GU4A 5JFRA 4EGEA 2GGCA 1R58A 1O0XA 1WY2A 4S01A 5CLSA 2EVOA 2V3ZA 4U71A 1C22A 4U6WA 3RVAA 2ZSGA 4FKCA 1W7VA 3FM3A 1WKMA 4U70A 5FCFA 2BN7A 1KQ0A 2BH3A 2Q8KA 3CB6A 2V3YA 3PKEA 3PKCA 4RZZA 5CNXA 3FMQA 2BHDA 4PV4A 3PKBA 5CIKA 3D27A 1YW9A 3BITA 1WBQA 2BWXA 3RORA 4A6VA 1WN1A 1JAWA 4PNCA 3FMRA 4IF7A 4FLLA 1WLRA 1QXZA 2GZ5A 5CDEA 1XGNA 5FCHA 2MATA 1KP0A 2G6PA 2BWTA 4FUKA 5CDLA 2B3HA 2EA2A 4HXXA 2NQ7A 2DFIA 1XGOA 4U75A 2GGBA 4KM3A 4U6EA 4IDYA 3MX6A 4IU6A 1PV9A 3BIPA 4U73A 3CB5A 2B3LA 1YW8A 1CHMA 4U6ZA 4RGZ1 2P9AA 2GU6A 1YVMA 1QXYA 2GG9A 2V6CA 1C27A 4ZWUA 3L7GA 4IECA 1N51A 2BWYA 2OAZA 2P98A 3L24A 2GU7A 5D6FA 1XGMA 2BWSA 4ZWPA 3IU7A 2Q95A 4IKSA 3CTZA 4S00A 4FLIA 2IW2A 3PKDA 2NQ6A 3IU8A 1YJ3A 1Y1NA 1B59A 4S2RP 1XNZA 4S2TP 3MR1A 4U76A 4MATA 1C23A 1C21A 3TAVA 1QZYA 2BWUA 4R60A 4A6WA 2ADUA 1WL6A 2GTXA 4U1BA 3MATA 1BOAA 5D6EA 1R5HA 1C24A 4QR8A 5E5BA 4JUQA 3Q6DA 2EA4A 4ZWOA 4U69A 4IPAA 4FO8A 4IKTA 4FLJA 2BWVA 2GU5A 2OKNA 2GG7A 3IG4A 1A16A 2BHBA 1MATA 1B6AA 5CDVA 1W2MA 5JI6A 2EVCA 4U6JA 2Q96A 4IKRA 3BIQA 2V3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B28 A;  3S6B A;  1KQ9 A;  2BWW A;  4Z7M A;  2B3K A;  2HOW A;  3PKA A;  2GG2 A;  1M35 A;  2GA2 A;  2GG3 A;  2Q92 A;  3IU9 A;  2Q94 A;  2BHA A;  2GG0 A;  5CE6 A;  1WL9 A;  2GG8 A;  4FO7 A;  5JHU A;  2Q93 A;  1YW7 A;  2EVM A;  2BB7 A;  4FLK A;  4IKU A;  4U6C A;  4ZNG A;  1BN5 A;  2P99 A;  1R5G A;  2GG5 A;  4RZY A;  3TB5 A;  1XGS A;  2BHC A;  4OOK A;  1QXW A;  2GU4 A;  5JFR A;  4EGE A;  2GGC A;  1R58 A;  1O0X A;  1WY2 A;  4S01 A;  5CLS A;  2EVO A;  2V3Z A;  4U71 A;  1C22 A;  4U6W A;  3RVA A;  2ZSG A;  4FKC A;  1W7V A;  3FM3 A;  1WKM A;  4U70 A;  5FCF A;  2BN7 A;  1KQ0 A;  2BH3 A;  2Q8K A;  3CB6 A;  2V3Y A;  3PKE A;  3PKC A;  4RZZ A;  5CNX A;  3FMQ A;  2BHD A;  4PV4 A;  3PKB A;  5CIK A;  3D27 A;  1YW9 A;  3BIT A;  1WBQ A;  2BWX A;  3ROR A;  4A6V A;  1WN1 A;  1JAW A;  4PNC A;  3FMR A;  4IF7 A;  4FLL A;  1WLR A;  1QXZ A;  2GZ5 A;  5CDE A;  1XGN A;  5FCH A;  2MAT A;  1KP0 A;  2G6P A;  2BWT A;  4FUK A;  5CDL A;  2B3H A;  2EA2 A;  4HXX A;  2NQ7 A;  2DFI A;  1XGO A;  4U75 A;  2GGB A;  4KM3 A;  4U6E A;  4IDY A;  3MX6 A;  4IU6 A;  1PV9 A;  3BIP A;  4U73 A;  3CB5 A;  2B3L A;  1YW8 A;  1CHM A;  4U6Z A;  4RGZ 1;  2P9A A;  2GU6 A;  1YVM A;  1QXY A;  2GG9 A;  2V6C A;  1C27 A;  4ZWU A;  3L7G A;  4IEC A;  1N51 A;  2BWY A;  2OAZ A;  2P98 A;  3L24 A;  2GU7 A;  5D6F A;  1XGM A;  2BWS A;  4ZWP A;  3IU7 A;  2Q95 A;  4IKS A;  3CTZ A;  4S00 A;  4FLI A;  2IW2 A;  3PKD A;  2NQ6 A;  3IU8 A;  1YJ3 A;  1Y1N A;  1B59 A;  4S2R P;  1XNZ A;  4S2T P;  3MR1 A;  4U76 A;  4MAT A;  1C23 A;  1C21 A;  3TAV A;  1QZY A;  2BWU A;  4R60 A;  4A6W A;  2ADU A;  1WL6 A;  2GTX A;  4U1B A;  3MAT A;  1BOA A;  5D6E A;  1R5H A;  1C24 A;  4QR8 A;  5E5B A;  4JUQ A;  3Q6D A;  2EA4 A;  4ZWO A;  4U69 A;  4IPA A;  4FO8 A;  4IKT A;  4FLJ A;  2BWV A;  2GU5 A;  2OKN A;  2GG7 A;  3IG4 A;  1A16 A;  2BHB A;  1MAT A;  1B6A A;  5CDV A;  1W2M A;  5JI6 A;  2EVC A;  4U6J A;  2Q96 A;  4IKR A;  3BIQ A;  2V3X A; 
#chains in the Genus database with same CATH topology
 4B28 A;  3S6B A;  1KQ9 A;  2BWW A;  4Z7M A;  2B3K A;  2HOW A;  3PKA A;  2GG2 A;  1M35 A;  2GA2 A;  2GG3 A;  2Q92 A;  3IU9 A;  2Q94 A;  2BHA A;  2GG0 A;  5CE6 A;  1WL9 A;  2GG8 A;  4FO7 A;  5JHU A;  2Q93 A;  1YW7 A;  2EVM A;  2BB7 A;  4FLK A;  4IKU A;  4U6C A;  4ZNG A;  1BN5 A;  2P99 A;  1R5G A;  2GG5 A;  4RZY A;  3TB5 A;  1XGS A;  2BHC A;  4OOK A;  1QXW A;  2GU4 A;  5JFR A;  4EGE A;  2GGC A;  1R58 A;  1O0X A;  1WY2 A;  4S01 A;  5CLS A;  2EVO A;  2V3Z A;  4U71 A;  1C22 A;  4U6W A;  3RVA A;  2ZSG A;  4FKC A;  1W7V A;  3FM3 A;  1WKM A;  4U70 A;  5FCF A;  2BN7 A;  1KQ0 A;  2BH3 A;  2Q8K A;  3CB6 A;  2V3Y A;  3PKE A;  3PKC A;  4RZZ A;  5CNX A;  3FMQ A;  2BHD A;  4PV4 A;  3PKB A;  5CIK A;  3D27 A;  1YW9 A;  3BIT A;  1WBQ A;  2BWX A;  3ROR A;  4A6V A;  1WN1 A;  1JAW A;  4PNC A;  3FMR A;  4IF7 A;  4FLL A;  1WLR A;  1QXZ A;  2GZ5 A;  5CDE A;  1XGN A;  5FCH A;  2MAT A;  1KP0 A;  2G6P A;  2BWT A;  4FUK A;  5CDL A;  2B3H A;  2EA2 A;  4HXX A;  2NQ7 A;  2DFI A;  1XGO A;  4U75 A;  2GGB A;  4KM3 A;  4U6E A;  4IDY A;  3MX6 A;  4IU6 A;  1PV9 A;  3BIP A;  4U73 A;  3CB5 A;  2B3L A;  1YW8 A;  1CHM A;  4U6Z A;  4RGZ 1;  2P9A A;  2GU6 A;  1YVM A;  1QXY A;  2GG9 A;  2V6C A;  1C27 A;  4ZWU A;  3L7G A;  4IEC A;  1N51 A;  2BWY A;  2OAZ A;  2P98 A;  3L24 A;  2GU7 A;  5D6F A;  1XGM A;  2BWS A;  4ZWP A;  3IU7 A;  2Q95 A;  4IKS A;  3CTZ A;  4S00 A;  4FLI A;  2IW2 A;  3PKD A;  2NQ6 A;  3IU8 A;  1YJ3 A;  1Y1N A;  1B59 A;  4S2R P;  1XNZ A;  4S2T P;  3MR1 A;  4U76 A;  4MAT A;  1C23 A;  1C21 A;  3TAV A;  1QZY A;  2BWU A;  4R60 A;  4A6W A;  2ADU A;  1WL6 A;  2GTX A;  4U1B A;  3MAT A;  1BOA A;  5D6E A;  1R5H A;  1C24 A;  4QR8 A;  5E5B A;  4JUQ A;  3Q6D A;  2EA4 A;  4ZWO A;  4U69 A;  4IPA A;  4FO8 A;  4IKT A;  4FLJ A;  2BWV A;  2GU5 A;  2OKN A;  2GG7 A;  3IG4 A;  1A16 A;  2BHB A;  1MAT A;  1B6A A;  5CDV A;  1W2M A;  5JI6 A;  2EVC A;  4U6J A;  2Q96 A;  4IKR A;  3BIQ A;  2V3X A; 
#chains in the Genus database with same CATH homology
 4B28 A;  3S6B A;  1KQ9 A;  2BWW A;  4Z7M A;  2B3K A;  2HOW A;  3PKA A;  2GG2 A;  1M35 A;  2GA2 A;  2GG3 A;  2Q92 A;  3IU9 A;  2Q94 A;  2BHA A;  2GG0 A;  5CE6 A;  1WL9 A;  2GG8 A;  4FO7 A;  5JHU A;  2Q93 A;  1YW7 A;  2EVM A;  2BB7 A;  4FLK A;  4IKU A;  4U6C A;  4ZNG A;  1BN5 A;  2P99 A;  1R5G A;  2GG5 A;  4RZY A;  3TB5 A;  1XGS A;  2BHC A;  4OOK A;  1QXW A;  2GU4 A;  5JFR A;  4EGE A;  2GGC A;  1R58 A;  1O0X A;  1WY2 A;  4S01 A;  5CLS A;  2EVO A;  2V3Z A;  4U71 A;  1C22 A;  4U6W A;  3RVA A;  2ZSG A;  4FKC A;  1W7V A;  3FM3 A;  1WKM A;  4U70 A;  5FCF A;  2BN7 A;  1KQ0 A;  2BH3 A;  2Q8K A;  3CB6 A;  2V3Y A;  3PKE A;  3PKC A;  4RZZ A;  5CNX A;  3FMQ A;  2BHD A;  4PV4 A;  3PKB A;  5CIK A;  3D27 A;  1YW9 A;  3BIT A;  1WBQ A;  2BWX A;  3ROR A;  4A6V A;  1WN1 A;  1JAW A;  4PNC A;  3FMR A;  4IF7 A;  4FLL A;  1WLR A;  1QXZ A;  2GZ5 A;  5CDE A;  1XGN A;  5FCH A;  2MAT A;  1KP0 A;  2G6P A;  2BWT A;  4FUK A;  5CDL A;  2B3H A;  2EA2 A;  4HXX A;  2NQ7 A;  2DFI A;  1XGO A;  4U75 A;  2GGB A;  4KM3 A;  4U6E A;  4IDY A;  3MX6 A;  4IU6 A;  1PV9 A;  3BIP A;  4U73 A;  3CB5 A;  2B3L A;  1YW8 A;  1CHM A;  4U6Z A;  4RGZ 1;  2P9A A;  2GU6 A;  1YVM A;  1QXY A;  2GG9 A;  2V6C A;  1C27 A;  4ZWU A;  3L7G A;  4IEC A;  1N51 A;  2BWY A;  2OAZ A;  2P98 A;  3L24 A;  2GU7 A;  5D6F A;  1XGM A;  2BWS A;  4ZWP A;  3IU7 A;  2Q95 A;  4IKS A;  3CTZ A;  4S00 A;  4FLI A;  2IW2 A;  3PKD A;  2NQ6 A;  3IU8 A;  1YJ3 A;  1Y1N A;  1B59 A;  4S2R P;  1XNZ A;  4S2T P;  3MR1 A;  4U76 A;  4MAT A;  1C23 A;  1C21 A;  3TAV A;  1QZY A;  2BWU A;  4R60 A;  4A6W A;  2ADU A;  1WL6 A;  2GTX A;  4U1B A;  3MAT A;  1BOA A;  5D6E A;  1R5H A;  1C24 A;  4QR8 A;  5E5B A;  4JUQ A;  3Q6D A;  2EA4 A;  4ZWO A;  4U69 A;  4IPA A;  4FO8 A;  4IKT A;  4FLJ A;  2BWV A;  2GU5 A;  2OKN A;  2GG7 A;  3IG4 A;  1A16 A;  2BHB A;  1MAT A;  1B6A A;  5CDV A;  1W2M A;  5JI6 A;  2EVC A;  4U6J A;  2Q96 A;  4IKR A;  3BIQ A;  2V3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...