4HXXA

Pyridinylpyrimidines selectively inhibit human methionine aminopeptidase-1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Pyridinylpyrimidines selectively inhibit human methionine aminopeptidase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4hxxA00
2Q96A 2GU7A 4S01A 3Q6DA 2GG0A 2GG7A 2GTXA 4FLKA 3CB5A 5D6EA 5CE6A 2GG5A 1XGSA 4U76A 5E5BA 1M35A 2Q92A 1W7VA 1Y1NA 4ZWUA 1N51A 1QXZA 3RVAA 4IKTA 4KM3A 1BN5A 4U6JA 2EA2A 4FKCA 2GGCA 2BWUA 1B59A 1W2MA 5JHUA 1WBQA 3CTZA 2EVMA 1KP0A 1KQ9A 2IW2A 3L7GA 1YVMA 2DFIA 5JI6A 1QZYA 2V3XA 3MX6A 5CNXA 2BWVA 2BWTA 2GG2A 1XGMA 4S2RP 2BWSA 2B3KA 4U70A 5JFRA 2BHDA 1WY2A 1C21A 3PKEA 1WKMA 4Z7MA 4U73A 2BWWA 3L24A 4U75A 2GU4A 1CHMA 1C24A 1QXWA 4FO8A 1WL6A 2Q8KA 3S6BA 4JUQA 3TB5A 5FCFA 4U6CA 2BHAA 4S00A 2BHBA 2GG9A 2V3YA 4FLIA 3BIQA 2GZ5A 1A16A 5CDLA 2OKNA 4ZWOA 2P98A 4A6WA 3RORA 1JAWA 3TAVA 1R58A 3FMQA 3IG4A 4B28A 1B6AA 2Q95A 2BWYA 2HOWA 2EA4A 2GG3A 4OOKA 4IKUA 4RGZ1 1C22A 4RZYA 2BHCA 2GU6A 4U6ZA 3FM3A 3BITA 2BH3A 4U1BA 1C23A 3PKDA 1XNZA 4FLJA 4ZWPA 5FCHA 4S2TP 2B3LA 4IPAA 4MATA 3PKBA 2EVOA 2V6CA 2ZSGA 3PKCA 4IECA 2Q93A 1YW7A 4U71A 4ZNGA 3MATA 5CLSA 1BOAA 2BN7A 2NQ6A 4PNCA 1WLRA 2GU5A 2P9AA 4HXXA 4IKSA 3D27A 1PV9A 3PKAA 4IDYA 4A6VA 1YW9A 4PV4A 1YW8A 2GGBA 4QR8A 4FUKA 4U6WA 4EGEA 3CB6A 4IKRA 1WL9A 2GG8A 1O0XA 2NQ7A 2B3HA 2OAZA 5CDEA 1MATA 2MATA 2V3ZA 5CIKA 1WN1A 3MR1A 4FO7A 2GA2A 3IU9A 4IU6A 3IU8A 1KQ0A 2G6PA 4FLLA 3IU7A 1XGOA 1R5HA 3BIPA 1C27A 5CDVA 1QXYA 4U6EA 2BWXA 2BB7A 4IF7A 5D6FA 3FMRA 4U69A 4R60A 2EVCA 4RZZA 1XGNA 2P99A 2Q94A 2ADUA 1R5GA 1YJ3A
chains in the Genus database with same CATH superfamily
2Q96A 2GU7A 4S01A 3Q6DA 2GG0A 2GG7A 2GTXA 4FLKA 3CB5A 5D6EA 5CE6A 2GG5A 1XGSA 4U76A 5E5BA 1M35A 2Q92A 1W7VA 1Y1NA 4ZWUA 1N51A 1QXZA 3RVAA 4IKTA 4KM3A 1BN5A 4U6JA 2EA2A 4FKCA 2GGCA 2BWUA 1B59A 1W2MA 5JHUA 1WBQA 3CTZA 2EVMA 1KP0A 1KQ9A 2IW2A 3L7GA 1YVMA 2DFIA 5JI6A 1QZYA 2V3XA 3MX6A 5CNXA 2BWVA 2BWTA 2GG2A 1XGMA 4S2RP 2BWSA 2B3KA 4U70A 5JFRA 2BHDA 1WY2A 1C21A 3PKEA 1WKMA 4Z7MA 4U73A 2BWWA 3L24A 4U75A 2GU4A 1CHMA 1C24A 1QXWA 4FO8A 1WL6A 2Q8KA 3S6BA 4JUQA 3TB5A 5FCFA 4U6CA 2BHAA 4S00A 2BHBA 2GG9A 2V3YA 4FLIA 3BIQA 2GZ5A 1A16A 5CDLA 2OKNA 4ZWOA 2P98A 4A6WA 3RORA 1JAWA 3TAVA 1R58A 3FMQA 3IG4A 4B28A 1B6AA 2Q95A 2BWYA 2HOWA 2EA4A 2GG3A 4OOKA 4IKUA 4RGZ1 1C22A 4RZYA 2BHCA 2GU6A 4U6ZA 3FM3A 3BITA 2BH3A 4U1BA 1C23A 3PKDA 1XNZA 4FLJA 4ZWPA 5FCHA 4S2TP 2B3LA 4IPAA 4MATA 3PKBA 2EVOA 2V6CA 2ZSGA 3PKCA 4IECA 2Q93A 1YW7A 4U71A 4ZNGA 3MATA 5CLSA 1BOAA 2BN7A 2NQ6A 4PNCA 1WLRA 2GU5A 2P9AA 4HXXA 4IKSA 3D27A 1PV9A 3PKAA 4IDYA 4A6VA 1YW9A 4PV4A 1YW8A 2GGBA 4QR8A 4FUKA 4U6WA 4EGEA 3CB6A 4IKRA 1WL9A 2GG8A 1O0XA 2NQ7A 2B3HA 2OAZA 5CDEA 1MATA 2MATA 2V3ZA 5CIKA 1WN1A 3MR1A 4FO7A 2GA2A 3IU9A 4IU6A 3IU8A 1KQ0A 2G6PA 4FLLA 3IU7A 1XGOA 1R5HA 3BIPA 1C27A 5CDVA 1QXYA 4U6EA 2BWXA 2BB7A 4IF7A 5D6FA 3FMRA 4U69A 4R60A 2EVCA 4RZZA 1XGNA 2P99A 2Q94A 2ADUA 1R5GA 1YJ3A
chains in the Genus database with same CATH topology
2Q96A 2GU7A 4S01A 3Q6DA 2GG0A 2GG7A 2GTXA 4FLKA 3CB5A 5D6EA 5CE6A 2GG5A 1XGSA 4U76A 5E5BA 1M35A 2Q92A 1W7VA 1Y1NA 4ZWUA 1N51A 1QXZA 3RVAA 4IKTA 4KM3A 1BN5A 4U6JA 2EA2A 4FKCA 2GGCA 2BWUA 1B59A 1W2MA 5JHUA 1WBQA 3CTZA 2EVMA 1KP0A 1KQ9A 2IW2A 3L7GA 1YVMA 2DFIA 5JI6A 1QZYA 2V3XA 3MX6A 5CNXA 2BWVA 2BWTA 2GG2A 1XGMA 4S2RP 2BWSA 2B3KA 4U70A 5JFRA 2BHDA 1WY2A 1C21A 3PKEA 1WKMA 4Z7MA 4U73A 2BWWA 3L24A 4U75A 2GU4A 1CHMA 1C24A 1QXWA 4FO8A 1WL6A 2Q8KA 3S6BA 4JUQA 3TB5A 5FCFA 4U6CA 2BHAA 4S00A 2BHBA 2GG9A 2V3YA 4FLIA 3BIQA 2GZ5A 1A16A 5CDLA 2OKNA 4ZWOA 2P98A 4A6WA 3RORA 1JAWA 3TAVA 1R58A 3FMQA 3IG4A 4B28A 1B6AA 2Q95A 2BWYA 2HOWA 2EA4A 2GG3A 4OOKA 4IKUA 4RGZ1 1C22A 4RZYA 2BHCA 2GU6A 4U6ZA 3FM3A 3BITA 2BH3A 4U1BA 1C23A 3PKDA 1XNZA 4FLJA 4ZWPA 5FCHA 4S2TP 2B3LA 4IPAA 4MATA 3PKBA 2EVOA 2V6CA 2ZSGA 3PKCA 4IECA 2Q93A 1YW7A 4U71A 4ZNGA 3MATA 5CLSA 1BOAA 2BN7A 2NQ6A 4PNCA 1WLRA 2GU5A 2P9AA 4HXXA 4IKSA 3D27A 1PV9A 3PKAA 4IDYA 4A6VA 1YW9A 4PV4A 1YW8A 2GGBA 4QR8A 4FUKA 4U6WA 4EGEA 3CB6A 4IKRA 1WL9A 2GG8A 1O0XA 2NQ7A 2B3HA 2OAZA 5CDEA 1MATA 2MATA 2V3ZA 5CIKA 1WN1A 3MR1A 4FO7A 2GA2A 3IU9A 4IU6A 3IU8A 1KQ0A 2G6PA 4FLLA 3IU7A 1XGOA 1R5HA 3BIPA 1C27A 5CDVA 1QXYA 4U6EA 2BWXA 2BB7A 4IF7A 5D6FA 3FMRA 4U69A 4R60A 2EVCA 4RZZA 1XGNA 2P99A 2Q94A 2ADUA 1R5GA 1YJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q96 A;  2GU7 A;  4S01 A;  3Q6D A;  2GG0 A;  2GG7 A;  2GTX A;  4FLK A;  3CB5 A;  5D6E A;  5CE6 A;  2GG5 A;  1XGS A;  4U76 A;  5E5B A;  1M35 A;  2Q92 A;  1W7V A;  1Y1N A;  4ZWU A;  1N51 A;  1QXZ A;  3RVA A;  4IKT A;  4KM3 A;  1BN5 A;  4U6J A;  2EA2 A;  4FKC A;  2GGC A;  2BWU A;  1B59 A;  1W2M A;  5JHU A;  1WBQ A;  3CTZ A;  2EVM A;  1KP0 A;  1KQ9 A;  2IW2 A;  3L7G A;  1YVM A;  2DFI A;  5JI6 A;  1QZY A;  2V3X A;  3MX6 A;  5CNX A;  2BWV A;  2BWT A;  2GG2 A;  1XGM A;  4S2R P;  2BWS A;  2B3K A;  4U70 A;  5JFR A;  2BHD A;  1WY2 A;  1C21 A;  3PKE A;  1WKM A;  4Z7M A;  4U73 A;  2BWW A;  3L24 A;  4U75 A;  2GU4 A;  1CHM A;  1C24 A;  1QXW A;  4FO8 A;  1WL6 A;  2Q8K A;  3S6B A;  4JUQ A;  3TB5 A;  5FCF A;  4U6C A;  2BHA A;  4S00 A;  2BHB A;  2GG9 A;  2V3Y A;  4FLI A;  3BIQ A;  2GZ5 A;  1A16 A;  5CDL A;  2OKN A;  4ZWO A;  2P98 A;  4A6W A;  3ROR A;  1JAW A;  3TAV A;  1R58 A;  3FMQ A;  3IG4 A;  4B28 A;  1B6A A;  2Q95 A;  2BWY A;  2HOW A;  2EA4 A;  2GG3 A;  4OOK A;  4IKU A;  4RGZ 1;  1C22 A;  4RZY A;  2BHC A;  2GU6 A;  4U6Z A;  3FM3 A;  3BIT A;  2BH3 A;  4U1B A;  1C23 A;  3PKD A;  1XNZ A;  4FLJ A;  4ZWP A;  5FCH A;  4S2T P;  2B3L A;  4IPA A;  4MAT A;  3PKB A;  2EVO A;  2V6C A;  2ZSG A;  3PKC A;  4IEC A;  2Q93 A;  1YW7 A;  4U71 A;  4ZNG A;  3MAT A;  5CLS A;  1BOA A;  2BN7 A;  2NQ6 A;  4PNC A;  1WLR A;  2GU5 A;  2P9A A;  4HXX A;  4IKS A;  3D27 A;  1PV9 A;  3PKA A;  4IDY A;  4A6V A;  1YW9 A;  4PV4 A;  1YW8 A;  2GGB A;  4QR8 A;  4FUK A;  4U6W A;  4EGE A;  3CB6 A;  4IKR A;  1WL9 A;  2GG8 A;  1O0X A;  2NQ7 A;  2B3H A;  2OAZ A;  5CDE A;  1MAT A;  2MAT A;  2V3Z A;  5CIK A;  1WN1 A;  3MR1 A;  4FO7 A;  2GA2 A;  3IU9 A;  4IU6 A;  3IU8 A;  1KQ0 A;  2G6P A;  4FLL A;  3IU7 A;  1XGO A;  1R5H A;  3BIP A;  1C27 A;  5CDV A;  1QXY A;  4U6E A;  2BWX A;  2BB7 A;  4IF7 A;  5D6F A;  3FMR A;  4U69 A;  4R60 A;  2EVC A;  4RZZ A;  1XGN A;  2P99 A;  2Q94 A;  2ADU A;  1R5G A;  1YJ3 A; 
#chains in the Genus database with same CATH topology
 2Q96 A;  2GU7 A;  4S01 A;  3Q6D A;  2GG0 A;  2GG7 A;  2GTX A;  4FLK A;  3CB5 A;  5D6E A;  5CE6 A;  2GG5 A;  1XGS A;  4U76 A;  5E5B A;  1M35 A;  2Q92 A;  1W7V A;  1Y1N A;  4ZWU A;  1N51 A;  1QXZ A;  3RVA A;  4IKT A;  4KM3 A;  1BN5 A;  4U6J A;  2EA2 A;  4FKC A;  2GGC A;  2BWU A;  1B59 A;  1W2M A;  5JHU A;  1WBQ A;  3CTZ A;  2EVM A;  1KP0 A;  1KQ9 A;  2IW2 A;  3L7G A;  1YVM A;  2DFI A;  5JI6 A;  1QZY A;  2V3X A;  3MX6 A;  5CNX A;  2BWV A;  2BWT A;  2GG2 A;  1XGM A;  4S2R P;  2BWS A;  2B3K A;  4U70 A;  5JFR A;  2BHD A;  1WY2 A;  1C21 A;  3PKE A;  1WKM A;  4Z7M A;  4U73 A;  2BWW A;  3L24 A;  4U75 A;  2GU4 A;  1CHM A;  1C24 A;  1QXW A;  4FO8 A;  1WL6 A;  2Q8K A;  3S6B A;  4JUQ A;  3TB5 A;  5FCF A;  4U6C A;  2BHA A;  4S00 A;  2BHB A;  2GG9 A;  2V3Y A;  4FLI A;  3BIQ A;  2GZ5 A;  1A16 A;  5CDL A;  2OKN A;  4ZWO A;  2P98 A;  4A6W A;  3ROR A;  1JAW A;  3TAV A;  1R58 A;  3FMQ A;  3IG4 A;  4B28 A;  1B6A A;  2Q95 A;  2BWY A;  2HOW A;  2EA4 A;  2GG3 A;  4OOK A;  4IKU A;  4RGZ 1;  1C22 A;  4RZY A;  2BHC A;  2GU6 A;  4U6Z A;  3FM3 A;  3BIT A;  2BH3 A;  4U1B A;  1C23 A;  3PKD A;  1XNZ A;  4FLJ A;  4ZWP A;  5FCH A;  4S2T P;  2B3L A;  4IPA A;  4MAT A;  3PKB A;  2EVO A;  2V6C A;  2ZSG A;  3PKC A;  4IEC A;  2Q93 A;  1YW7 A;  4U71 A;  4ZNG A;  3MAT A;  5CLS A;  1BOA A;  2BN7 A;  2NQ6 A;  4PNC A;  1WLR A;  2GU5 A;  2P9A A;  4HXX A;  4IKS A;  3D27 A;  1PV9 A;  3PKA A;  4IDY A;  4A6V A;  1YW9 A;  4PV4 A;  1YW8 A;  2GGB A;  4QR8 A;  4FUK A;  4U6W A;  4EGE A;  3CB6 A;  4IKR A;  1WL9 A;  2GG8 A;  1O0X A;  2NQ7 A;  2B3H A;  2OAZ A;  5CDE A;  1MAT A;  2MAT A;  2V3Z A;  5CIK A;  1WN1 A;  3MR1 A;  4FO7 A;  2GA2 A;  3IU9 A;  4IU6 A;  3IU8 A;  1KQ0 A;  2G6P A;  4FLL A;  3IU7 A;  1XGO A;  1R5H A;  3BIP A;  1C27 A;  5CDV A;  1QXY A;  4U6E A;  2BWX A;  2BB7 A;  4IF7 A;  5D6F A;  3FMR A;  4U69 A;  4R60 A;  2EVC A;  4RZZ A;  1XGN A;  2P99 A;  2Q94 A;  2ADU A;  1R5G A;  1YJ3 A; 
#chains in the Genus database with same CATH homology
 2Q96 A;  2GU7 A;  4S01 A;  3Q6D A;  2GG0 A;  2GG7 A;  2GTX A;  4FLK A;  3CB5 A;  5D6E A;  5CE6 A;  2GG5 A;  1XGS A;  4U76 A;  5E5B A;  1M35 A;  2Q92 A;  1W7V A;  1Y1N A;  4ZWU A;  1N51 A;  1QXZ A;  3RVA A;  4IKT A;  4KM3 A;  1BN5 A;  4U6J A;  2EA2 A;  4FKC A;  2GGC A;  2BWU A;  1B59 A;  1W2M A;  5JHU A;  1WBQ A;  3CTZ A;  2EVM A;  1KP0 A;  1KQ9 A;  2IW2 A;  3L7G A;  1YVM A;  2DFI A;  5JI6 A;  1QZY A;  2V3X A;  3MX6 A;  5CNX A;  2BWV A;  2BWT A;  2GG2 A;  1XGM A;  4S2R P;  2BWS A;  2B3K A;  4U70 A;  5JFR A;  2BHD A;  1WY2 A;  1C21 A;  3PKE A;  1WKM A;  4Z7M A;  4U73 A;  2BWW A;  3L24 A;  4U75 A;  2GU4 A;  1CHM A;  1C24 A;  1QXW A;  4FO8 A;  1WL6 A;  2Q8K A;  3S6B A;  4JUQ A;  3TB5 A;  5FCF A;  4U6C A;  2BHA A;  4S00 A;  2BHB A;  2GG9 A;  2V3Y A;  4FLI A;  3BIQ A;  2GZ5 A;  1A16 A;  5CDL A;  2OKN A;  4ZWO A;  2P98 A;  4A6W A;  3ROR A;  1JAW A;  3TAV A;  1R58 A;  3FMQ A;  3IG4 A;  4B28 A;  1B6A A;  2Q95 A;  2BWY A;  2HOW A;  2EA4 A;  2GG3 A;  4OOK A;  4IKU A;  4RGZ 1;  1C22 A;  4RZY A;  2BHC A;  2GU6 A;  4U6Z A;  3FM3 A;  3BIT A;  2BH3 A;  4U1B A;  1C23 A;  3PKD A;  1XNZ A;  4FLJ A;  4ZWP A;  5FCH A;  4S2T P;  2B3L A;  4IPA A;  4MAT A;  3PKB A;  2EVO A;  2V6C A;  2ZSG A;  3PKC A;  4IEC A;  2Q93 A;  1YW7 A;  4U71 A;  4ZNG A;  3MAT A;  5CLS A;  1BOA A;  2BN7 A;  2NQ6 A;  4PNC A;  1WLR A;  2GU5 A;  2P9A A;  4HXX A;  4IKS A;  3D27 A;  1PV9 A;  3PKA A;  4IDY A;  4A6V A;  1YW9 A;  4PV4 A;  1YW8 A;  2GGB A;  4QR8 A;  4FUK A;  4U6W A;  4EGE A;  3CB6 A;  4IKR A;  1WL9 A;  2GG8 A;  1O0X A;  2NQ7 A;  2B3H A;  2OAZ A;  5CDE A;  1MAT A;  2MAT A;  2V3Z A;  5CIK A;  1WN1 A;  3MR1 A;  4FO7 A;  2GA2 A;  3IU9 A;  4IU6 A;  3IU8 A;  1KQ0 A;  2G6P A;  4FLL A;  3IU7 A;  1XGO A;  1R5H A;  3BIP A;  1C27 A;  5CDV A;  1QXY A;  4U6E A;  2BWX A;  2BB7 A;  4IF7 A;  5D6F A;  3FMR A;  4U69 A;  4R60 A;  2EVC A;  4RZZ A;  1XGN A;  2P99 A;  2Q94 A;  2ADU A;  1R5G A;  1YJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...