4HXXA

Pyridinylpyrimidines selectively inhibit human methionine aminopeptidase-1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Pyridinylpyrimidines selectively inhibit human methionine aminopeptidase-1.
pubmed doi rcsb
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4hxxA00
1YW7A 2DFIA 4IU6A 4PNCA 3BIQA 1R58A 3IU9A 2NQ6A 4U73A 1XGSA 2OAZA 2Q96A 4IKRA 2Q95A 1KQ9A 4KM3A 2GG3A 4U6EA 2GU4A 4ZNGA 1XGNA 4ZWUA 4PV4A 3BITA 2ZSGA 4U75A 3RVAA 4U76A 1XGOA 1QXWA 1R5HA 4S01A 1CHMA 2EVOA 1C24A 5D6FA 5CIKA 4S00A 2ADUA 3PKDA 4IF7A 2G6PA 4FO8A 1YW9A 4S2TP 4FLIA 2BWUA 1C23A 2GGCA 4JUQA 3BIPA 5CE6A 2B3LA 3CB5A 4U70A 4U69A 3S6BA 1M35A 2Q92A 4U71A 4ZWPA 1BN5A 4FO7A 4B28A 4U6CA 1YW8A 1BOAA 1WY2A 3CB6A 4U6JA 2GA2A 1YJ3A 2GG5A 2BWSA 2GG0A 2BB7A 2GU6A 4FLJA 4ZWOA 2GG9A 2Q94A 2BHAA 3MATA 4FLLA 4U1BA 3MR1A 1YVMA 3FMRA 4A6VA 2BHDA 3PKBA 4IECA 1KQ0A 3IG4A 2IW2A 2V3YA 2Q8KA 3FM3A 3L24A 2GU5A 4RZYA 1A16A 4U6WA 2BHCA 4IDYA 3TB5A 2BHBA 2BWVA 2BWYA 5CDEA 4HXXA 2OKNA 5CNXA 4FKCA 1Y1NA 5CDLA 2Q93A 1C21A 2BWWA 3D27A 5JHUA 1O0XA 4EGEA 1WLRA 4R60A 5FCHA 4QR8A 3TAVA 1W2MA 5FCFA 2GG7A 5JFRA 2B3HA 2GU7A 2P9AA 2GG8A 3Q6DA 3RORA 1C27A 4MATA 1W7VA 1WKMA 1R5GA 1JAWA 2GZ5A 1B6AA 4FLKA 2V6CA 5CLSA 4Z7MA 3PKCA 4A6WA 4IKTA 1QZYA 4IKSA 2EA4A 1XNZA 4FUKA 2GG2A 1C22A 4IKUA 3IU7A 2B3KA 1MATA 2P99A 2GTXA 2GGBA 1WN1A 2V3ZA 3FMQA 4OOKA 2BWXA 5CDVA 2BN7A 4RZZA 1B59A 3PKAA 4U6ZA 2HOWA 1N51A 1WBQA 1WL9A 5JI6A 2BWTA 3IU8A 1PV9A 1KP0A 1QXYA 2EA2A 5E5BA 1WL6A 3MX6A 3L7GA 2V3XA 2MATA 2EVCA 3CTZA 5D6EA 4RGZ1 1QXZA 3PKEA 2EVMA 2P98A 4S2RP 1XGMA 2BH3A 2NQ7A 4IPAA
chains in the Genus database with same CATH superfamily
1YW7A 2DFIA 4IU6A 4PNCA 3BIQA 1R58A 3IU9A 2NQ6A 4U73A 1XGSA 2OAZA 2Q96A 4IKRA 2Q95A 1KQ9A 4KM3A 2GG3A 4U6EA 2GU4A 4ZNGA 1XGNA 4ZWUA 4PV4A 3BITA 2ZSGA 4U75A 3RVAA 4U76A 1XGOA 1QXWA 1R5HA 4S01A 1CHMA 2EVOA 1C24A 5D6FA 5CIKA 4S00A 2ADUA 3PKDA 4IF7A 2G6PA 4FO8A 1YW9A 4S2TP 4FLIA 2BWUA 1C23A 2GGCA 4JUQA 3BIPA 5CE6A 2B3LA 3CB5A 4U70A 4U69A 3S6BA 1M35A 2Q92A 4U71A 4ZWPA 1BN5A 4FO7A 4B28A 4U6CA 1YW8A 1BOAA 1WY2A 3CB6A 4U6JA 2GA2A 1YJ3A 2GG5A 2BWSA 2GG0A 2BB7A 2GU6A 4FLJA 4ZWOA 2GG9A 2Q94A 2BHAA 3MATA 4FLLA 4U1BA 3MR1A 1YVMA 3FMRA 4A6VA 2BHDA 3PKBA 4IECA 1KQ0A 3IG4A 2IW2A 2V3YA 2Q8KA 3FM3A 3L24A 2GU5A 4RZYA 1A16A 4U6WA 2BHCA 4IDYA 3TB5A 2BHBA 2BWVA 2BWYA 5CDEA 4HXXA 2OKNA 5CNXA 4FKCA 1Y1NA 5CDLA 2Q93A 1C21A 2BWWA 3D27A 5JHUA 1O0XA 4EGEA 1WLRA 4R60A 5FCHA 4QR8A 3TAVA 1W2MA 5FCFA 2GG7A 5JFRA 2B3HA 2GU7A 2P9AA 2GG8A 3Q6DA 3RORA 1C27A 4MATA 1W7VA 1WKMA 1R5GA 1JAWA 2GZ5A 1B6AA 4FLKA 2V6CA 5CLSA 4Z7MA 3PKCA 4A6WA 4IKTA 1QZYA 4IKSA 2EA4A 1XNZA 4FUKA 2GG2A 1C22A 4IKUA 3IU7A 2B3KA 1MATA 2P99A 2GTXA 2GGBA 1WN1A 2V3ZA 3FMQA 4OOKA 2BWXA 5CDVA 2BN7A 4RZZA 1B59A 3PKAA 4U6ZA 2HOWA 1N51A 1WBQA 1WL9A 5JI6A 2BWTA 3IU8A 1PV9A 1KP0A 1QXYA 2EA2A 5E5BA 1WL6A 3MX6A 3L7GA 2V3XA 2MATA 2EVCA 3CTZA 5D6EA 4RGZ1 1QXZA 3PKEA 2EVMA 2P98A 4S2RP 1XGMA 2BH3A 2NQ7A 4IPAA
chains in the Genus database with same CATH topology
1YW7A 2DFIA 4IU6A 4PNCA 3BIQA 1R58A 3IU9A 2NQ6A 4U73A 1XGSA 2OAZA 2Q96A 4IKRA 2Q95A 1KQ9A 4KM3A 2GG3A 4U6EA 2GU4A 4ZNGA 1XGNA 4ZWUA 4PV4A 3BITA 2ZSGA 4U75A 3RVAA 4U76A 1XGOA 1QXWA 1R5HA 4S01A 1CHMA 2EVOA 1C24A 5D6FA 5CIKA 4S00A 2ADUA 3PKDA 4IF7A 2G6PA 4FO8A 1YW9A 4S2TP 4FLIA 2BWUA 1C23A 2GGCA 4JUQA 3BIPA 5CE6A 2B3LA 3CB5A 4U70A 4U69A 3S6BA 1M35A 2Q92A 4U71A 4ZWPA 1BN5A 4FO7A 4B28A 4U6CA 1YW8A 1BOAA 1WY2A 3CB6A 4U6JA 2GA2A 1YJ3A 2GG5A 2BWSA 2GG0A 2BB7A 2GU6A 4FLJA 4ZWOA 2GG9A 2Q94A 2BHAA 3MATA 4FLLA 4U1BA 3MR1A 1YVMA 3FMRA 4A6VA 2BHDA 3PKBA 4IECA 1KQ0A 3IG4A 2IW2A 2V3YA 2Q8KA 3FM3A 3L24A 2GU5A 4RZYA 1A16A 4U6WA 2BHCA 4IDYA 3TB5A 2BHBA 2BWVA 2BWYA 5CDEA 4HXXA 2OKNA 5CNXA 4FKCA 1Y1NA 5CDLA 2Q93A 1C21A 2BWWA 3D27A 5JHUA 1O0XA 4EGEA 1WLRA 4R60A 5FCHA 4QR8A 3TAVA 1W2MA 5FCFA 2GG7A 5JFRA 2B3HA 2GU7A 2P9AA 2GG8A 3Q6DA 3RORA 1C27A 4MATA 1W7VA 1WKMA 1R5GA 1JAWA 2GZ5A 1B6AA 4FLKA 2V6CA 5CLSA 4Z7MA 3PKCA 4A6WA 4IKTA 1QZYA 4IKSA 2EA4A 1XNZA 4FUKA 2GG2A 1C22A 4IKUA 3IU7A 2B3KA 1MATA 2P99A 2GTXA 2GGBA 1WN1A 2V3ZA 3FMQA 4OOKA 2BWXA 5CDVA 2BN7A 4RZZA 1B59A 3PKAA 4U6ZA 2HOWA 1N51A 1WBQA 1WL9A 5JI6A 2BWTA 3IU8A 1PV9A 1KP0A 1QXYA 2EA2A 5E5BA 1WL6A 3MX6A 3L7GA 2V3XA 2MATA 2EVCA 3CTZA 5D6EA 4RGZ1 1QXZA 3PKEA 2EVMA 2P98A 4S2RP 1XGMA 2BH3A 2NQ7A 4IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW7 A;  2DFI A;  4IU6 A;  4PNC A;  3BIQ A;  1R58 A;  3IU9 A;  2NQ6 A;  4U73 A;  1XGS A;  2OAZ A;  2Q96 A;  4IKR A;  2Q95 A;  1KQ9 A;  4KM3 A;  2GG3 A;  4U6E A;  2GU4 A;  4ZNG A;  1XGN A;  4ZWU A;  4PV4 A;  3BIT A;  2ZSG A;  4U75 A;  3RVA A;  4U76 A;  1XGO A;  1QXW A;  1R5H A;  4S01 A;  1CHM A;  2EVO A;  1C24 A;  5D6F A;  5CIK A;  4S00 A;  2ADU A;  3PKD A;  4IF7 A;  2G6P A;  4FO8 A;  1YW9 A;  4S2T P;  4FLI A;  2BWU A;  1C23 A;  2GGC A;  4JUQ A;  3BIP A;  5CE6 A;  2B3L A;  3CB5 A;  4U70 A;  4U69 A;  3S6B A;  1M35 A;  2Q92 A;  4U71 A;  4ZWP A;  1BN5 A;  4FO7 A;  4B28 A;  4U6C A;  1YW8 A;  1BOA A;  1WY2 A;  3CB6 A;  4U6J A;  2GA2 A;  1YJ3 A;  2GG5 A;  2BWS A;  2GG0 A;  2BB7 A;  2GU6 A;  4FLJ A;  4ZWO A;  2GG9 A;  2Q94 A;  2BHA A;  3MAT A;  4FLL A;  4U1B A;  3MR1 A;  1YVM A;  3FMR A;  4A6V A;  2BHD A;  3PKB A;  4IEC A;  1KQ0 A;  3IG4 A;  2IW2 A;  2V3Y A;  2Q8K A;  3FM3 A;  3L24 A;  2GU5 A;  4RZY A;  1A16 A;  4U6W A;  2BHC A;  4IDY A;  3TB5 A;  2BHB A;  2BWV A;  2BWY A;  5CDE A;  4HXX A;  2OKN A;  5CNX A;  4FKC A;  1Y1N A;  5CDL A;  2Q93 A;  1C21 A;  2BWW A;  3D27 A;  5JHU A;  1O0X A;  4EGE A;  1WLR A;  4R60 A;  5FCH A;  4QR8 A;  3TAV A;  1W2M A;  5FCF A;  2GG7 A;  5JFR A;  2B3H A;  2GU7 A;  2P9A A;  2GG8 A;  3Q6D A;  3ROR A;  1C27 A;  4MAT A;  1W7V A;  1WKM A;  1R5G A;  1JAW A;  2GZ5 A;  1B6A A;  4FLK A;  2V6C A;  5CLS A;  4Z7M A;  3PKC A;  4A6W A;  4IKT A;  1QZY A;  4IKS A;  2EA4 A;  1XNZ A;  4FUK A;  2GG2 A;  1C22 A;  4IKU A;  3IU7 A;  2B3K A;  1MAT A;  2P99 A;  2GTX A;  2GGB A;  1WN1 A;  2V3Z A;  3FMQ A;  4OOK A;  2BWX A;  5CDV A;  2BN7 A;  4RZZ A;  1B59 A;  3PKA A;  4U6Z A;  2HOW A;  1N51 A;  1WBQ A;  1WL9 A;  5JI6 A;  2BWT A;  3IU8 A;  1PV9 A;  1KP0 A;  1QXY A;  2EA2 A;  5E5B A;  1WL6 A;  3MX6 A;  3L7G A;  2V3X A;  2MAT A;  2EVC A;  3CTZ A;  5D6E A;  4RGZ 1;  1QXZ A;  3PKE A;  2EVM A;  2P98 A;  4S2R P;  1XGM A;  2BH3 A;  2NQ7 A;  4IPA A; 
#chains in the Genus database with same CATH topology
 1YW7 A;  2DFI A;  4IU6 A;  4PNC A;  3BIQ A;  1R58 A;  3IU9 A;  2NQ6 A;  4U73 A;  1XGS A;  2OAZ A;  2Q96 A;  4IKR A;  2Q95 A;  1KQ9 A;  4KM3 A;  2GG3 A;  4U6E A;  2GU4 A;  4ZNG A;  1XGN A;  4ZWU A;  4PV4 A;  3BIT A;  2ZSG A;  4U75 A;  3RVA A;  4U76 A;  1XGO A;  1QXW A;  1R5H A;  4S01 A;  1CHM A;  2EVO A;  1C24 A;  5D6F A;  5CIK A;  4S00 A;  2ADU A;  3PKD A;  4IF7 A;  2G6P A;  4FO8 A;  1YW9 A;  4S2T P;  4FLI A;  2BWU A;  1C23 A;  2GGC A;  4JUQ A;  3BIP A;  5CE6 A;  2B3L A;  3CB5 A;  4U70 A;  4U69 A;  3S6B A;  1M35 A;  2Q92 A;  4U71 A;  4ZWP A;  1BN5 A;  4FO7 A;  4B28 A;  4U6C A;  1YW8 A;  1BOA A;  1WY2 A;  3CB6 A;  4U6J A;  2GA2 A;  1YJ3 A;  2GG5 A;  2BWS A;  2GG0 A;  2BB7 A;  2GU6 A;  4FLJ A;  4ZWO A;  2GG9 A;  2Q94 A;  2BHA A;  3MAT A;  4FLL A;  4U1B A;  3MR1 A;  1YVM A;  3FMR A;  4A6V A;  2BHD A;  3PKB A;  4IEC A;  1KQ0 A;  3IG4 A;  2IW2 A;  2V3Y A;  2Q8K A;  3FM3 A;  3L24 A;  2GU5 A;  4RZY A;  1A16 A;  4U6W A;  2BHC A;  4IDY A;  3TB5 A;  2BHB A;  2BWV A;  2BWY A;  5CDE A;  4HXX A;  2OKN A;  5CNX A;  4FKC A;  1Y1N A;  5CDL A;  2Q93 A;  1C21 A;  2BWW A;  3D27 A;  5JHU A;  1O0X A;  4EGE A;  1WLR A;  4R60 A;  5FCH A;  4QR8 A;  3TAV A;  1W2M A;  5FCF A;  2GG7 A;  5JFR A;  2B3H A;  2GU7 A;  2P9A A;  2GG8 A;  3Q6D A;  3ROR A;  1C27 A;  4MAT A;  1W7V A;  1WKM A;  1R5G A;  1JAW A;  2GZ5 A;  1B6A A;  4FLK A;  2V6C A;  5CLS A;  4Z7M A;  3PKC A;  4A6W A;  4IKT A;  1QZY A;  4IKS A;  2EA4 A;  1XNZ A;  4FUK A;  2GG2 A;  1C22 A;  4IKU A;  3IU7 A;  2B3K A;  1MAT A;  2P99 A;  2GTX A;  2GGB A;  1WN1 A;  2V3Z A;  3FMQ A;  4OOK A;  2BWX A;  5CDV A;  2BN7 A;  4RZZ A;  1B59 A;  3PKA A;  4U6Z A;  2HOW A;  1N51 A;  1WBQ A;  1WL9 A;  5JI6 A;  2BWT A;  3IU8 A;  1PV9 A;  1KP0 A;  1QXY A;  2EA2 A;  5E5B A;  1WL6 A;  3MX6 A;  3L7G A;  2V3X A;  2MAT A;  2EVC A;  3CTZ A;  5D6E A;  4RGZ 1;  1QXZ A;  3PKE A;  2EVM A;  2P98 A;  4S2R P;  1XGM A;  2BH3 A;  2NQ7 A;  4IPA A; 
#chains in the Genus database with same CATH homology
 1YW7 A;  2DFI A;  4IU6 A;  4PNC A;  3BIQ A;  1R58 A;  3IU9 A;  2NQ6 A;  4U73 A;  1XGS A;  2OAZ A;  2Q96 A;  4IKR A;  2Q95 A;  1KQ9 A;  4KM3 A;  2GG3 A;  4U6E A;  2GU4 A;  4ZNG A;  1XGN A;  4ZWU A;  4PV4 A;  3BIT A;  2ZSG A;  4U75 A;  3RVA A;  4U76 A;  1XGO A;  1QXW A;  1R5H A;  4S01 A;  1CHM A;  2EVO A;  1C24 A;  5D6F A;  5CIK A;  4S00 A;  2ADU A;  3PKD A;  4IF7 A;  2G6P A;  4FO8 A;  1YW9 A;  4S2T P;  4FLI A;  2BWU A;  1C23 A;  2GGC A;  4JUQ A;  3BIP A;  5CE6 A;  2B3L A;  3CB5 A;  4U70 A;  4U69 A;  3S6B A;  1M35 A;  2Q92 A;  4U71 A;  4ZWP A;  1BN5 A;  4FO7 A;  4B28 A;  4U6C A;  1YW8 A;  1BOA A;  1WY2 A;  3CB6 A;  4U6J A;  2GA2 A;  1YJ3 A;  2GG5 A;  2BWS A;  2GG0 A;  2BB7 A;  2GU6 A;  4FLJ A;  4ZWO A;  2GG9 A;  2Q94 A;  2BHA A;  3MAT A;  4FLL A;  4U1B A;  3MR1 A;  1YVM A;  3FMR A;  4A6V A;  2BHD A;  3PKB A;  4IEC A;  1KQ0 A;  3IG4 A;  2IW2 A;  2V3Y A;  2Q8K A;  3FM3 A;  3L24 A;  2GU5 A;  4RZY A;  1A16 A;  4U6W A;  2BHC A;  4IDY A;  3TB5 A;  2BHB A;  2BWV A;  2BWY A;  5CDE A;  4HXX A;  2OKN A;  5CNX A;  4FKC A;  1Y1N A;  5CDL A;  2Q93 A;  1C21 A;  2BWW A;  3D27 A;  5JHU A;  1O0X A;  4EGE A;  1WLR A;  4R60 A;  5FCH A;  4QR8 A;  3TAV A;  1W2M A;  5FCF A;  2GG7 A;  5JFR A;  2B3H A;  2GU7 A;  2P9A A;  2GG8 A;  3Q6D A;  3ROR A;  1C27 A;  4MAT A;  1W7V A;  1WKM A;  1R5G A;  1JAW A;  2GZ5 A;  1B6A A;  4FLK A;  2V6C A;  5CLS A;  4Z7M A;  3PKC A;  4A6W A;  4IKT A;  1QZY A;  4IKS A;  2EA4 A;  1XNZ A;  4FUK A;  2GG2 A;  1C22 A;  4IKU A;  3IU7 A;  2B3K A;  1MAT A;  2P99 A;  2GTX A;  2GGB A;  1WN1 A;  2V3Z A;  3FMQ A;  4OOK A;  2BWX A;  5CDV A;  2BN7 A;  4RZZ A;  1B59 A;  3PKA A;  4U6Z A;  2HOW A;  1N51 A;  1WBQ A;  1WL9 A;  5JI6 A;  2BWT A;  3IU8 A;  1PV9 A;  1KP0 A;  1QXY A;  2EA2 A;  5E5B A;  1WL6 A;  3MX6 A;  3L7G A;  2V3X A;  2MAT A;  2EVC A;  3CTZ A;  5D6E A;  4RGZ 1;  1QXZ A;  3PKE A;  2EVM A;  2P98 A;  4S2R P;  1XGM A;  2BH3 A;  2NQ7 A;  4IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...