4HXXA

Pyridinylpyrimidines selectively inhibit human methionine aminopeptidase-1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyridinylpyrimidines selectively inhibit human methionine aminopeptidase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4hxxA00
3D27A 4MATA 5CDLA 1C27A 2V3YA 1JAWA 1C23A 1Y1NA 5E5BA 3PKEA 1WLRA 1C21A 1C24A 1R5GA 2DFIA 2EVMA 2Q93A 3CB5A 4IKRA 4RZYA 1CHMA 1XNZA 5CLSA 1WBQA 3IU9A 1YW7A 2OAZA 4A6VA 4IECA 1QXWA 2ADUA 5CDVA 4U1BA 1YW8A 1BN5A 2Q8KA 1QXZA 4FLLA 2BWWA 2V3ZA 2GU6A 1WL6A 2GTXA 2NQ7A 2BWXA 2V6CA 3BIQA 3PKBA 3BITA 4JUQA 4IKSA 4B28A 2BHCA 3Q6DA 4IKUA 1QXYA 2HOWA 1XGMA 1MATA 2GU7A 1YVMA 1R58A 2BH3A 3PKCA 4FUKA 4U69A 5FCHA 1B6AA 2BWSA 3BIPA 1BOAA 2GG3A 4U71A 4IU6A 5D6EA 3S6BA 5JHUA 4FO7A 1KP0A 1R5HA 1O0XA 2Q96A 2NQ6A 2P9AA 4U6WA 2B3LA 3L24A 1B59A 3IU8A 3TAVA 1N51A 2GU4A 2BB7A 4U70A 1WN1A 3IG4A 4FLIA 5D6FA 2G6PA 4FLJA 4U6JA 2EVCA 3TB5A 1KQ0A 4A6WA 2BHDA 4FKCA 2BHAA 2EVOA 3MX6A 4IPAA 2EA2A 1WL9A 3L7GA 3PKAA 2GG8A 4FLKA 4R60A 4Z7MA 3RVAA 2GG9A 5JI6A 3CTZA 2OKNA 1PV9A 3FMQA 4KM3A 4U76A 2BWYA 2P99A 2EA4A 4RGZ1 4U6CA 3FM3A 5CDEA 3IU7A 2BHBA 3MATA 4S2RP 5JFRA 4U75A 1M35A 4PV4A 2GG7A 4IDYA 1A16A 2GG2A 3PKDA 1KQ9A 1XGSA 2BN7A 2GU5A 2GGCA 2ZSGA 4ZNGA 4QR8A 2GGBA 2GG5A 5CNXA 2BWVA 4S2TP 3MR1A 1XGNA 1QZYA 1W7VA 4S00A 4ZWPA 4S01A 2Q92A 2GZ5A 2MATA 2B3HA 4FO8A 1WKMA 4IF7A 4U6ZA 4U73A 4ZWUA 5CE6A 4OOKA 4EGEA 1YW9A 4PNCA 1XGOA 2GA2A 2GG0A 4IKTA 1W2MA 4HXXA 2IW2A 3FMRA 2Q95A 1C22A 2B3KA 5CIKA 2V3XA 3RORA 5FCFA 2Q94A 2BWTA 4RZZA 4ZWOA 2P98A 1WY2A 2BWUA 4U6EA 1YJ3A 3CB6A
chains in the Genus database with same CATH superfamily
3D27A 4MATA 5CDLA 1C27A 2V3YA 1JAWA 1C23A 1Y1NA 5E5BA 3PKEA 1WLRA 1C21A 1C24A 1R5GA 2DFIA 2EVMA 2Q93A 3CB5A 4IKRA 4RZYA 1CHMA 1XNZA 5CLSA 1WBQA 3IU9A 1YW7A 2OAZA 4A6VA 4IECA 1QXWA 2ADUA 5CDVA 4U1BA 1YW8A 1BN5A 2Q8KA 1QXZA 4FLLA 2BWWA 2V3ZA 2GU6A 1WL6A 2GTXA 2NQ7A 2BWXA 2V6CA 3BIQA 3PKBA 3BITA 4JUQA 4IKSA 4B28A 2BHCA 3Q6DA 4IKUA 1QXYA 2HOWA 1XGMA 1MATA 2GU7A 1YVMA 1R58A 2BH3A 3PKCA 4FUKA 4U69A 5FCHA 1B6AA 2BWSA 3BIPA 1BOAA 2GG3A 4U71A 4IU6A 5D6EA 3S6BA 5JHUA 4FO7A 1KP0A 1R5HA 1O0XA 2Q96A 2NQ6A 2P9AA 4U6WA 2B3LA 3L24A 1B59A 3IU8A 3TAVA 1N51A 2GU4A 2BB7A 4U70A 1WN1A 3IG4A 4FLIA 5D6FA 2G6PA 4FLJA 4U6JA 2EVCA 3TB5A 1KQ0A 4A6WA 2BHDA 4FKCA 2BHAA 2EVOA 3MX6A 4IPAA 2EA2A 1WL9A 3L7GA 3PKAA 2GG8A 4FLKA 4R60A 4Z7MA 3RVAA 2GG9A 5JI6A 3CTZA 2OKNA 1PV9A 3FMQA 4KM3A 4U76A 2BWYA 2P99A 2EA4A 4RGZ1 4U6CA 3FM3A 5CDEA 3IU7A 2BHBA 3MATA 4S2RP 5JFRA 4U75A 1M35A 4PV4A 2GG7A 4IDYA 1A16A 2GG2A 3PKDA 1KQ9A 1XGSA 2BN7A 2GU5A 2GGCA 2ZSGA 4ZNGA 4QR8A 2GGBA 2GG5A 5CNXA 2BWVA 4S2TP 3MR1A 1XGNA 1QZYA 1W7VA 4S00A 4ZWPA 4S01A 2Q92A 2GZ5A 2MATA 2B3HA 4FO8A 1WKMA 4IF7A 4U6ZA 4U73A 4ZWUA 5CE6A 4OOKA 4EGEA 1YW9A 4PNCA 1XGOA 2GA2A 2GG0A 4IKTA 1W2MA 4HXXA 2IW2A 3FMRA 2Q95A 1C22A 2B3KA 5CIKA 2V3XA 3RORA 5FCFA 2Q94A 2BWTA 4RZZA 4ZWOA 2P98A 1WY2A 2BWUA 4U6EA 1YJ3A 3CB6A
chains in the Genus database with same CATH topology
3D27A 4MATA 5CDLA 1C27A 2V3YA 1JAWA 1C23A 1Y1NA 5E5BA 3PKEA 1WLRA 1C21A 1C24A 1R5GA 2DFIA 2EVMA 2Q93A 3CB5A 4IKRA 4RZYA 1CHMA 1XNZA 5CLSA 1WBQA 3IU9A 1YW7A 2OAZA 4A6VA 4IECA 1QXWA 2ADUA 5CDVA 4U1BA 1YW8A 1BN5A 2Q8KA 1QXZA 4FLLA 2BWWA 2V3ZA 2GU6A 1WL6A 2GTXA 2NQ7A 2BWXA 2V6CA 3BIQA 3PKBA 3BITA 4JUQA 4IKSA 4B28A 2BHCA 3Q6DA 4IKUA 1QXYA 2HOWA 1XGMA 1MATA 2GU7A 1YVMA 1R58A 2BH3A 3PKCA 4FUKA 4U69A 5FCHA 1B6AA 2BWSA 3BIPA 1BOAA 2GG3A 4U71A 4IU6A 5D6EA 3S6BA 5JHUA 4FO7A 1KP0A 1R5HA 1O0XA 2Q96A 2NQ6A 2P9AA 4U6WA 2B3LA 3L24A 1B59A 3IU8A 3TAVA 1N51A 2GU4A 2BB7A 4U70A 1WN1A 3IG4A 4FLIA 5D6FA 2G6PA 4FLJA 4U6JA 2EVCA 3TB5A 1KQ0A 4A6WA 2BHDA 4FKCA 2BHAA 2EVOA 3MX6A 4IPAA 2EA2A 1WL9A 3L7GA 3PKAA 2GG8A 4FLKA 4R60A 4Z7MA 3RVAA 2GG9A 5JI6A 3CTZA 2OKNA 1PV9A 3FMQA 4KM3A 4U76A 2BWYA 2P99A 2EA4A 4RGZ1 4U6CA 3FM3A 5CDEA 3IU7A 2BHBA 3MATA 4S2RP 5JFRA 4U75A 1M35A 4PV4A 2GG7A 4IDYA 1A16A 2GG2A 3PKDA 1KQ9A 1XGSA 2BN7A 2GU5A 2GGCA 2ZSGA 4ZNGA 4QR8A 2GGBA 2GG5A 5CNXA 2BWVA 4S2TP 3MR1A 1XGNA 1QZYA 1W7VA 4S00A 4ZWPA 4S01A 2Q92A 2GZ5A 2MATA 2B3HA 4FO8A 1WKMA 4IF7A 4U6ZA 4U73A 4ZWUA 5CE6A 4OOKA 4EGEA 1YW9A 4PNCA 1XGOA 2GA2A 2GG0A 4IKTA 1W2MA 4HXXA 2IW2A 3FMRA 2Q95A 1C22A 2B3KA 5CIKA 2V3XA 3RORA 5FCFA 2Q94A 2BWTA 4RZZA 4ZWOA 2P98A 1WY2A 2BWUA 4U6EA 1YJ3A 3CB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D27 A;  4MAT A;  5CDL A;  1C27 A;  2V3Y A;  1JAW A;  1C23 A;  1Y1N A;  5E5B A;  3PKE A;  1WLR A;  1C21 A;  1C24 A;  1R5G A;  2DFI A;  2EVM A;  2Q93 A;  3CB5 A;  4IKR A;  4RZY A;  1CHM A;  1XNZ A;  5CLS A;  1WBQ A;  3IU9 A;  1YW7 A;  2OAZ A;  4A6V A;  4IEC A;  1QXW A;  2ADU A;  5CDV A;  4U1B A;  1YW8 A;  1BN5 A;  2Q8K A;  1QXZ A;  4FLL A;  2BWW A;  2V3Z A;  2GU6 A;  1WL6 A;  2GTX A;  2NQ7 A;  2BWX A;  2V6C A;  3BIQ A;  3PKB A;  3BIT A;  4JUQ A;  4IKS A;  4B28 A;  2BHC A;  3Q6D A;  4IKU A;  1QXY A;  2HOW A;  1XGM A;  1MAT A;  2GU7 A;  1YVM A;  1R58 A;  2BH3 A;  3PKC A;  4FUK A;  4U69 A;  5FCH A;  1B6A A;  2BWS A;  3BIP A;  1BOA A;  2GG3 A;  4U71 A;  4IU6 A;  5D6E A;  3S6B A;  5JHU A;  4FO7 A;  1KP0 A;  1R5H A;  1O0X A;  2Q96 A;  2NQ6 A;  2P9A A;  4U6W A;  2B3L A;  3L24 A;  1B59 A;  3IU8 A;  3TAV A;  1N51 A;  2GU4 A;  2BB7 A;  4U70 A;  1WN1 A;  3IG4 A;  4FLI A;  5D6F A;  2G6P A;  4FLJ A;  4U6J A;  2EVC A;  3TB5 A;  1KQ0 A;  4A6W A;  2BHD A;  4FKC A;  2BHA A;  2EVO A;  3MX6 A;  4IPA A;  2EA2 A;  1WL9 A;  3L7G A;  3PKA A;  2GG8 A;  4FLK A;  4R60 A;  4Z7M A;  3RVA A;  2GG9 A;  5JI6 A;  3CTZ A;  2OKN A;  1PV9 A;  3FMQ A;  4KM3 A;  4U76 A;  2BWY A;  2P99 A;  2EA4 A;  4RGZ 1;  4U6C A;  3FM3 A;  5CDE A;  3IU7 A;  2BHB A;  3MAT A;  4S2R P;  5JFR A;  4U75 A;  1M35 A;  4PV4 A;  2GG7 A;  4IDY A;  1A16 A;  2GG2 A;  3PKD A;  1KQ9 A;  1XGS A;  2BN7 A;  2GU5 A;  2GGC A;  2ZSG A;  4ZNG A;  4QR8 A;  2GGB A;  2GG5 A;  5CNX A;  2BWV A;  4S2T P;  3MR1 A;  1XGN A;  1QZY A;  1W7V A;  4S00 A;  4ZWP A;  4S01 A;  2Q92 A;  2GZ5 A;  2MAT A;  2B3H A;  4FO8 A;  1WKM A;  4IF7 A;  4U6Z A;  4U73 A;  4ZWU A;  5CE6 A;  4OOK A;  4EGE A;  1YW9 A;  4PNC A;  1XGO A;  2GA2 A;  2GG0 A;  4IKT A;  1W2M A;  4HXX A;  2IW2 A;  3FMR A;  2Q95 A;  1C22 A;  2B3K A;  5CIK A;  2V3X A;  3ROR A;  5FCF A;  2Q94 A;  2BWT A;  4RZZ A;  4ZWO A;  2P98 A;  1WY2 A;  2BWU A;  4U6E A;  1YJ3 A;  3CB6 A; 
#chains in the Genus database with same CATH topology
 3D27 A;  4MAT A;  5CDL A;  1C27 A;  2V3Y A;  1JAW A;  1C23 A;  1Y1N A;  5E5B A;  3PKE A;  1WLR A;  1C21 A;  1C24 A;  1R5G A;  2DFI A;  2EVM A;  2Q93 A;  3CB5 A;  4IKR A;  4RZY A;  1CHM A;  1XNZ A;  5CLS A;  1WBQ A;  3IU9 A;  1YW7 A;  2OAZ A;  4A6V A;  4IEC A;  1QXW A;  2ADU A;  5CDV A;  4U1B A;  1YW8 A;  1BN5 A;  2Q8K A;  1QXZ A;  4FLL A;  2BWW A;  2V3Z A;  2GU6 A;  1WL6 A;  2GTX A;  2NQ7 A;  2BWX A;  2V6C A;  3BIQ A;  3PKB A;  3BIT A;  4JUQ A;  4IKS A;  4B28 A;  2BHC A;  3Q6D A;  4IKU A;  1QXY A;  2HOW A;  1XGM A;  1MAT A;  2GU7 A;  1YVM A;  1R58 A;  2BH3 A;  3PKC A;  4FUK A;  4U69 A;  5FCH A;  1B6A A;  2BWS A;  3BIP A;  1BOA A;  2GG3 A;  4U71 A;  4IU6 A;  5D6E A;  3S6B A;  5JHU A;  4FO7 A;  1KP0 A;  1R5H A;  1O0X A;  2Q96 A;  2NQ6 A;  2P9A A;  4U6W A;  2B3L A;  3L24 A;  1B59 A;  3IU8 A;  3TAV A;  1N51 A;  2GU4 A;  2BB7 A;  4U70 A;  1WN1 A;  3IG4 A;  4FLI A;  5D6F A;  2G6P A;  4FLJ A;  4U6J A;  2EVC A;  3TB5 A;  1KQ0 A;  4A6W A;  2BHD A;  4FKC A;  2BHA A;  2EVO A;  3MX6 A;  4IPA A;  2EA2 A;  1WL9 A;  3L7G A;  3PKA A;  2GG8 A;  4FLK A;  4R60 A;  4Z7M A;  3RVA A;  2GG9 A;  5JI6 A;  3CTZ A;  2OKN A;  1PV9 A;  3FMQ A;  4KM3 A;  4U76 A;  2BWY A;  2P99 A;  2EA4 A;  4RGZ 1;  4U6C A;  3FM3 A;  5CDE A;  3IU7 A;  2BHB A;  3MAT A;  4S2R P;  5JFR A;  4U75 A;  1M35 A;  4PV4 A;  2GG7 A;  4IDY A;  1A16 A;  2GG2 A;  3PKD A;  1KQ9 A;  1XGS A;  2BN7 A;  2GU5 A;  2GGC A;  2ZSG A;  4ZNG A;  4QR8 A;  2GGB A;  2GG5 A;  5CNX A;  2BWV A;  4S2T P;  3MR1 A;  1XGN A;  1QZY A;  1W7V A;  4S00 A;  4ZWP A;  4S01 A;  2Q92 A;  2GZ5 A;  2MAT A;  2B3H A;  4FO8 A;  1WKM A;  4IF7 A;  4U6Z A;  4U73 A;  4ZWU A;  5CE6 A;  4OOK A;  4EGE A;  1YW9 A;  4PNC A;  1XGO A;  2GA2 A;  2GG0 A;  4IKT A;  1W2M A;  4HXX A;  2IW2 A;  3FMR A;  2Q95 A;  1C22 A;  2B3K A;  5CIK A;  2V3X A;  3ROR A;  5FCF A;  2Q94 A;  2BWT A;  4RZZ A;  4ZWO A;  2P98 A;  1WY2 A;  2BWU A;  4U6E A;  1YJ3 A;  3CB6 A; 
#chains in the Genus database with same CATH homology
 3D27 A;  4MAT A;  5CDL A;  1C27 A;  2V3Y A;  1JAW A;  1C23 A;  1Y1N A;  5E5B A;  3PKE A;  1WLR A;  1C21 A;  1C24 A;  1R5G A;  2DFI A;  2EVM A;  2Q93 A;  3CB5 A;  4IKR A;  4RZY A;  1CHM A;  1XNZ A;  5CLS A;  1WBQ A;  3IU9 A;  1YW7 A;  2OAZ A;  4A6V A;  4IEC A;  1QXW A;  2ADU A;  5CDV A;  4U1B A;  1YW8 A;  1BN5 A;  2Q8K A;  1QXZ A;  4FLL A;  2BWW A;  2V3Z A;  2GU6 A;  1WL6 A;  2GTX A;  2NQ7 A;  2BWX A;  2V6C A;  3BIQ A;  3PKB A;  3BIT A;  4JUQ A;  4IKS A;  4B28 A;  2BHC A;  3Q6D A;  4IKU A;  1QXY A;  2HOW A;  1XGM A;  1MAT A;  2GU7 A;  1YVM A;  1R58 A;  2BH3 A;  3PKC A;  4FUK A;  4U69 A;  5FCH A;  1B6A A;  2BWS A;  3BIP A;  1BOA A;  2GG3 A;  4U71 A;  4IU6 A;  5D6E A;  3S6B A;  5JHU A;  4FO7 A;  1KP0 A;  1R5H A;  1O0X A;  2Q96 A;  2NQ6 A;  2P9A A;  4U6W A;  2B3L A;  3L24 A;  1B59 A;  3IU8 A;  3TAV A;  1N51 A;  2GU4 A;  2BB7 A;  4U70 A;  1WN1 A;  3IG4 A;  4FLI A;  5D6F A;  2G6P A;  4FLJ A;  4U6J A;  2EVC A;  3TB5 A;  1KQ0 A;  4A6W A;  2BHD A;  4FKC A;  2BHA A;  2EVO A;  3MX6 A;  4IPA A;  2EA2 A;  1WL9 A;  3L7G A;  3PKA A;  2GG8 A;  4FLK A;  4R60 A;  4Z7M A;  3RVA A;  2GG9 A;  5JI6 A;  3CTZ A;  2OKN A;  1PV9 A;  3FMQ A;  4KM3 A;  4U76 A;  2BWY A;  2P99 A;  2EA4 A;  4RGZ 1;  4U6C A;  3FM3 A;  5CDE A;  3IU7 A;  2BHB A;  3MAT A;  4S2R P;  5JFR A;  4U75 A;  1M35 A;  4PV4 A;  2GG7 A;  4IDY A;  1A16 A;  2GG2 A;  3PKD A;  1KQ9 A;  1XGS A;  2BN7 A;  2GU5 A;  2GGC A;  2ZSG A;  4ZNG A;  4QR8 A;  2GGB A;  2GG5 A;  5CNX A;  2BWV A;  4S2T P;  3MR1 A;  1XGN A;  1QZY A;  1W7V A;  4S00 A;  4ZWP A;  4S01 A;  2Q92 A;  2GZ5 A;  2MAT A;  2B3H A;  4FO8 A;  1WKM A;  4IF7 A;  4U6Z A;  4U73 A;  4ZWU A;  5CE6 A;  4OOK A;  4EGE A;  1YW9 A;  4PNC A;  1XGO A;  2GA2 A;  2GG0 A;  4IKT A;  1W2M A;  4HXX A;  2IW2 A;  3FMR A;  2Q95 A;  1C22 A;  2B3K A;  5CIK A;  2V3X A;  3ROR A;  5FCF A;  2Q94 A;  2BWT A;  4RZZ A;  4ZWO A;  2P98 A;  1WY2 A;  2BWU A;  4U6E A;  1YJ3 A;  3CB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...