4HXXA

Pyridinylpyrimidines selectively inhibit human methionine aminopeptidase-1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
publication title Pyridinylpyrimidines selectively inhibit human methionine aminopeptidase-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4hxxA00
3TAVA 5E5BA 3PKEA 1N51A 4FLKA 1W7VA 4U71A 4U6WA 1C23A 4IKRA 2EVMA 4IECA 2HOWA 3MATA 2B3KA 3MR1A 2GU5A 4RGZ1 1QZYA 2Q8KA 1BN5A 1WL6A 1JAWA 2Q92A 5CE6A 3S6BA 1XGNA 2BWSA 3BITA 2V3ZA 3BIQA 3L24A 4RZYA 1YJ3A 5D6FA 1M35A 2B3LA 2BWXA 1WKMA 1C21A 2GG9A 4KM3A 3Q6DA 1BOAA 3CTZA 1WY2A 2EA2A 1KP0A 4RZZA 1MATA 2MATA 1R5HA 2GU6A 2OAZA 1WN1A 4A6WA 4ZWPA 2GU4A 1PV9A 1C24A 4U1BA 2ZSGA 4HXXA 3IU8A 4IF7A 4QR8A 1QXZA 5JFRA 1O0XA 5FCFA 2Q95A 2BHDA 2BWVA 4IKSA 4FLLA 4ZNGA 2DFIA 4IKTA 3FMRA 2GG2A 2GG0A 2V3XA 4Z7MA 1YW9A 3FM3A 2P99A 1CHMA 1XGMA 4U6JA 4IDYA 5CIKA 4FLJA 2BHBA 1R5GA 1YW7A 4FKCA 2BWWA 5CLSA 2GU7A 1XGOA 2V6CA 2GA2A 2BHAA 2BH3A 2Q96A 2NQ7A 1R58A 1YVMA 2GGCA 3TB5A 2P98A 5CNXA 4PNCA 3L7GA 4U76A 1A16A 4IKUA 4U75A 5JI6A 1B6AA 2GG8A 3CB5A 2V3YA 2BHCA 1WLRA 4ZWOA 3RVAA 2Q93A 4U6CA 5CDLA 1WBQA 1QXYA 4JUQA 3CB6A 4FUKA 2OKNA 3MX6A 2BB7A 2EVOA 4FO7A 1WL9A 4MATA 1YW8A 4IPAA 2GG7A 4U6ZA 2GG5A 2Q94A 2G6PA 4U69A 2BWYA 1KQ9A 3FMQA 5D6EA 2BWTA 3PKBA 4U6EA 2GGBA 3BIPA 3PKDA 2EA4A 2EVCA 4S00A 2IW2A 4OOKA 4A6VA 1QXWA 2P9AA 2GZ5A 4U70A 4IU6A 1B59A 5CDEA 4B28A 2ADUA 3PKAA 3IG4A 1C27A 5JHUA 4S2TP 1KQ0A 2GTXA 1XNZA 2NQ6A 1XGSA 4ZWUA 4S01A 3IU7A 4EGEA 1Y1NA 5FCHA 3PKCA 2BWUA 3IU9A 2GG3A 1C22A 4FLIA 4R60A 2B3HA 2BN7A 1W2MA 4PV4A 4FO8A 4S2RP 3RORA 3D27A 5CDVA 4U73A
chains in the Genus database with same CATH superfamily
3TAVA 5E5BA 3PKEA 1N51A 4FLKA 1W7VA 4U71A 4U6WA 1C23A 4IKRA 2EVMA 4IECA 2HOWA 3MATA 2B3KA 3MR1A 2GU5A 4RGZ1 1QZYA 2Q8KA 1BN5A 1WL6A 1JAWA 2Q92A 5CE6A 3S6BA 1XGNA 2BWSA 3BITA 2V3ZA 3BIQA 3L24A 4RZYA 1YJ3A 5D6FA 1M35A 2B3LA 2BWXA 1WKMA 1C21A 2GG9A 4KM3A 3Q6DA 1BOAA 3CTZA 1WY2A 2EA2A 1KP0A 4RZZA 1MATA 2MATA 1R5HA 2GU6A 2OAZA 1WN1A 4A6WA 4ZWPA 2GU4A 1PV9A 1C24A 4U1BA 2ZSGA 4HXXA 3IU8A 4IF7A 4QR8A 1QXZA 5JFRA 1O0XA 5FCFA 2Q95A 2BHDA 2BWVA 4IKSA 4FLLA 4ZNGA 2DFIA 4IKTA 3FMRA 2GG2A 2GG0A 2V3XA 4Z7MA 1YW9A 3FM3A 2P99A 1CHMA 1XGMA 4U6JA 4IDYA 5CIKA 4FLJA 2BHBA 1R5GA 1YW7A 4FKCA 2BWWA 5CLSA 2GU7A 1XGOA 2V6CA 2GA2A 2BHAA 2BH3A 2Q96A 2NQ7A 1R58A 1YVMA 2GGCA 3TB5A 2P98A 5CNXA 4PNCA 3L7GA 4U76A 1A16A 4IKUA 4U75A 5JI6A 1B6AA 2GG8A 3CB5A 2V3YA 2BHCA 1WLRA 4ZWOA 3RVAA 2Q93A 4U6CA 5CDLA 1WBQA 1QXYA 4JUQA 3CB6A 4FUKA 2OKNA 3MX6A 2BB7A 2EVOA 4FO7A 1WL9A 4MATA 1YW8A 4IPAA 2GG7A 4U6ZA 2GG5A 2Q94A 2G6PA 4U69A 2BWYA 1KQ9A 3FMQA 5D6EA 2BWTA 3PKBA 4U6EA 2GGBA 3BIPA 3PKDA 2EA4A 2EVCA 4S00A 2IW2A 4OOKA 4A6VA 1QXWA 2P9AA 2GZ5A 4U70A 4IU6A 1B59A 5CDEA 4B28A 2ADUA 3PKAA 3IG4A 1C27A 5JHUA 4S2TP 1KQ0A 2GTXA 1XNZA 2NQ6A 1XGSA 4ZWUA 4S01A 3IU7A 4EGEA 1Y1NA 5FCHA 3PKCA 2BWUA 3IU9A 2GG3A 1C22A 4FLIA 4R60A 2B3HA 2BN7A 1W2MA 4PV4A 4FO8A 4S2RP 3RORA 3D27A 5CDVA 4U73A
chains in the Genus database with same CATH topology
3TAVA 5E5BA 3PKEA 1N51A 4FLKA 1W7VA 4U71A 4U6WA 1C23A 4IKRA 2EVMA 4IECA 2HOWA 3MATA 2B3KA 3MR1A 2GU5A 4RGZ1 1QZYA 2Q8KA 1BN5A 1WL6A 1JAWA 2Q92A 5CE6A 3S6BA 1XGNA 2BWSA 3BITA 2V3ZA 3BIQA 3L24A 4RZYA 1YJ3A 5D6FA 1M35A 2B3LA 2BWXA 1WKMA 1C21A 2GG9A 4KM3A 3Q6DA 1BOAA 3CTZA 1WY2A 2EA2A 1KP0A 4RZZA 1MATA 2MATA 1R5HA 2GU6A 2OAZA 1WN1A 4A6WA 4ZWPA 2GU4A 1PV9A 1C24A 4U1BA 2ZSGA 4HXXA 3IU8A 4IF7A 4QR8A 1QXZA 5JFRA 1O0XA 5FCFA 2Q95A 2BHDA 2BWVA 4IKSA 4FLLA 4ZNGA 2DFIA 4IKTA 3FMRA 2GG2A 2GG0A 2V3XA 4Z7MA 1YW9A 3FM3A 2P99A 1CHMA 1XGMA 4U6JA 4IDYA 5CIKA 4FLJA 2BHBA 1R5GA 1YW7A 4FKCA 2BWWA 5CLSA 2GU7A 1XGOA 2V6CA 2GA2A 2BHAA 2BH3A 2Q96A 2NQ7A 1R58A 1YVMA 2GGCA 3TB5A 2P98A 5CNXA 4PNCA 3L7GA 4U76A 1A16A 4IKUA 4U75A 5JI6A 1B6AA 2GG8A 3CB5A 2V3YA 2BHCA 1WLRA 4ZWOA 3RVAA 2Q93A 4U6CA 5CDLA 1WBQA 1QXYA 4JUQA 3CB6A 4FUKA 2OKNA 3MX6A 2BB7A 2EVOA 4FO7A 1WL9A 4MATA 1YW8A 4IPAA 2GG7A 4U6ZA 2GG5A 2Q94A 2G6PA 4U69A 2BWYA 1KQ9A 3FMQA 5D6EA 2BWTA 3PKBA 4U6EA 2GGBA 3BIPA 3PKDA 2EA4A 2EVCA 4S00A 2IW2A 4OOKA 4A6VA 1QXWA 2P9AA 2GZ5A 4U70A 4IU6A 1B59A 5CDEA 4B28A 2ADUA 3PKAA 3IG4A 1C27A 5JHUA 4S2TP 1KQ0A 2GTXA 1XNZA 2NQ6A 1XGSA 4ZWUA 4S01A 3IU7A 4EGEA 1Y1NA 5FCHA 3PKCA 2BWUA 3IU9A 2GG3A 1C22A 4FLIA 4R60A 2B3HA 2BN7A 1W2MA 4PV4A 4FO8A 4S2RP 3RORA 3D27A 5CDVA 4U73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAV A;  5E5B A;  3PKE A;  1N51 A;  4FLK A;  1W7V A;  4U71 A;  4U6W A;  1C23 A;  4IKR A;  2EVM A;  4IEC A;  2HOW A;  3MAT A;  2B3K A;  3MR1 A;  2GU5 A;  4RGZ 1;  1QZY A;  2Q8K A;  1BN5 A;  1WL6 A;  1JAW A;  2Q92 A;  5CE6 A;  3S6B A;  1XGN A;  2BWS A;  3BIT A;  2V3Z A;  3BIQ A;  3L24 A;  4RZY A;  1YJ3 A;  5D6F A;  1M35 A;  2B3L A;  2BWX A;  1WKM A;  1C21 A;  2GG9 A;  4KM3 A;  3Q6D A;  1BOA A;  3CTZ A;  1WY2 A;  2EA2 A;  1KP0 A;  4RZZ A;  1MAT A;  2MAT A;  1R5H A;  2GU6 A;  2OAZ A;  1WN1 A;  4A6W A;  4ZWP A;  2GU4 A;  1PV9 A;  1C24 A;  4U1B A;  2ZSG A;  4HXX A;  3IU8 A;  4IF7 A;  4QR8 A;  1QXZ A;  5JFR A;  1O0X A;  5FCF A;  2Q95 A;  2BHD A;  2BWV A;  4IKS A;  4FLL A;  4ZNG A;  2DFI A;  4IKT A;  3FMR A;  2GG2 A;  2GG0 A;  2V3X A;  4Z7M A;  1YW9 A;  3FM3 A;  2P99 A;  1CHM A;  1XGM A;  4U6J A;  4IDY A;  5CIK A;  4FLJ A;  2BHB A;  1R5G A;  1YW7 A;  4FKC A;  2BWW A;  5CLS A;  2GU7 A;  1XGO A;  2V6C A;  2GA2 A;  2BHA A;  2BH3 A;  2Q96 A;  2NQ7 A;  1R58 A;  1YVM A;  2GGC A;  3TB5 A;  2P98 A;  5CNX A;  4PNC A;  3L7G A;  4U76 A;  1A16 A;  4IKU A;  4U75 A;  5JI6 A;  1B6A A;  2GG8 A;  3CB5 A;  2V3Y A;  2BHC A;  1WLR A;  4ZWO A;  3RVA A;  2Q93 A;  4U6C A;  5CDL A;  1WBQ A;  1QXY A;  4JUQ A;  3CB6 A;  4FUK A;  2OKN A;  3MX6 A;  2BB7 A;  2EVO A;  4FO7 A;  1WL9 A;  4MAT A;  1YW8 A;  4IPA A;  2GG7 A;  4U6Z A;  2GG5 A;  2Q94 A;  2G6P A;  4U69 A;  2BWY A;  1KQ9 A;  3FMQ A;  5D6E A;  2BWT A;  3PKB A;  4U6E A;  2GGB A;  3BIP A;  3PKD A;  2EA4 A;  2EVC A;  4S00 A;  2IW2 A;  4OOK A;  4A6V A;  1QXW A;  2P9A A;  2GZ5 A;  4U70 A;  4IU6 A;  1B59 A;  5CDE A;  4B28 A;  2ADU A;  3PKA A;  3IG4 A;  1C27 A;  5JHU A;  4S2T P;  1KQ0 A;  2GTX A;  1XNZ A;  2NQ6 A;  1XGS A;  4ZWU A;  4S01 A;  3IU7 A;  4EGE A;  1Y1N A;  5FCH A;  3PKC A;  2BWU A;  3IU9 A;  2GG3 A;  1C22 A;  4FLI A;  4R60 A;  2B3H A;  2BN7 A;  1W2M A;  4PV4 A;  4FO8 A;  4S2R P;  3ROR A;  3D27 A;  5CDV A;  4U73 A; 
#chains in the Genus database with same CATH topology
 3TAV A;  5E5B A;  3PKE A;  1N51 A;  4FLK A;  1W7V A;  4U71 A;  4U6W A;  1C23 A;  4IKR A;  2EVM A;  4IEC A;  2HOW A;  3MAT A;  2B3K A;  3MR1 A;  2GU5 A;  4RGZ 1;  1QZY A;  2Q8K A;  1BN5 A;  1WL6 A;  1JAW A;  2Q92 A;  5CE6 A;  3S6B A;  1XGN A;  2BWS A;  3BIT A;  2V3Z A;  3BIQ A;  3L24 A;  4RZY A;  1YJ3 A;  5D6F A;  1M35 A;  2B3L A;  2BWX A;  1WKM A;  1C21 A;  2GG9 A;  4KM3 A;  3Q6D A;  1BOA A;  3CTZ A;  1WY2 A;  2EA2 A;  1KP0 A;  4RZZ A;  1MAT A;  2MAT A;  1R5H A;  2GU6 A;  2OAZ A;  1WN1 A;  4A6W A;  4ZWP A;  2GU4 A;  1PV9 A;  1C24 A;  4U1B A;  2ZSG A;  4HXX A;  3IU8 A;  4IF7 A;  4QR8 A;  1QXZ A;  5JFR A;  1O0X A;  5FCF A;  2Q95 A;  2BHD A;  2BWV A;  4IKS A;  4FLL A;  4ZNG A;  2DFI A;  4IKT A;  3FMR A;  2GG2 A;  2GG0 A;  2V3X A;  4Z7M A;  1YW9 A;  3FM3 A;  2P99 A;  1CHM A;  1XGM A;  4U6J A;  4IDY A;  5CIK A;  4FLJ A;  2BHB A;  1R5G A;  1YW7 A;  4FKC A;  2BWW A;  5CLS A;  2GU7 A;  1XGO A;  2V6C A;  2GA2 A;  2BHA A;  2BH3 A;  2Q96 A;  2NQ7 A;  1R58 A;  1YVM A;  2GGC A;  3TB5 A;  2P98 A;  5CNX A;  4PNC A;  3L7G A;  4U76 A;  1A16 A;  4IKU A;  4U75 A;  5JI6 A;  1B6A A;  2GG8 A;  3CB5 A;  2V3Y A;  2BHC A;  1WLR A;  4ZWO A;  3RVA A;  2Q93 A;  4U6C A;  5CDL A;  1WBQ A;  1QXY A;  4JUQ A;  3CB6 A;  4FUK A;  2OKN A;  3MX6 A;  2BB7 A;  2EVO A;  4FO7 A;  1WL9 A;  4MAT A;  1YW8 A;  4IPA A;  2GG7 A;  4U6Z A;  2GG5 A;  2Q94 A;  2G6P A;  4U69 A;  2BWY A;  1KQ9 A;  3FMQ A;  5D6E A;  2BWT A;  3PKB A;  4U6E A;  2GGB A;  3BIP A;  3PKD A;  2EA4 A;  2EVC A;  4S00 A;  2IW2 A;  4OOK A;  4A6V A;  1QXW A;  2P9A A;  2GZ5 A;  4U70 A;  4IU6 A;  1B59 A;  5CDE A;  4B28 A;  2ADU A;  3PKA A;  3IG4 A;  1C27 A;  5JHU A;  4S2T P;  1KQ0 A;  2GTX A;  1XNZ A;  2NQ6 A;  1XGS A;  4ZWU A;  4S01 A;  3IU7 A;  4EGE A;  1Y1N A;  5FCH A;  3PKC A;  2BWU A;  3IU9 A;  2GG3 A;  1C22 A;  4FLI A;  4R60 A;  2B3H A;  2BN7 A;  1W2M A;  4PV4 A;  4FO8 A;  4S2R P;  3ROR A;  3D27 A;  5CDV A;  4U73 A; 
#chains in the Genus database with same CATH homology
 3TAV A;  5E5B A;  3PKE A;  1N51 A;  4FLK A;  1W7V A;  4U71 A;  4U6W A;  1C23 A;  4IKR A;  2EVM A;  4IEC A;  2HOW A;  3MAT A;  2B3K A;  3MR1 A;  2GU5 A;  4RGZ 1;  1QZY A;  2Q8K A;  1BN5 A;  1WL6 A;  1JAW A;  2Q92 A;  5CE6 A;  3S6B A;  1XGN A;  2BWS A;  3BIT A;  2V3Z A;  3BIQ A;  3L24 A;  4RZY A;  1YJ3 A;  5D6F A;  1M35 A;  2B3L A;  2BWX A;  1WKM A;  1C21 A;  2GG9 A;  4KM3 A;  3Q6D A;  1BOA A;  3CTZ A;  1WY2 A;  2EA2 A;  1KP0 A;  4RZZ A;  1MAT A;  2MAT A;  1R5H A;  2GU6 A;  2OAZ A;  1WN1 A;  4A6W A;  4ZWP A;  2GU4 A;  1PV9 A;  1C24 A;  4U1B A;  2ZSG A;  4HXX A;  3IU8 A;  4IF7 A;  4QR8 A;  1QXZ A;  5JFR A;  1O0X A;  5FCF A;  2Q95 A;  2BHD A;  2BWV A;  4IKS A;  4FLL A;  4ZNG A;  2DFI A;  4IKT A;  3FMR A;  2GG2 A;  2GG0 A;  2V3X A;  4Z7M A;  1YW9 A;  3FM3 A;  2P99 A;  1CHM A;  1XGM A;  4U6J A;  4IDY A;  5CIK A;  4FLJ A;  2BHB A;  1R5G A;  1YW7 A;  4FKC A;  2BWW A;  5CLS A;  2GU7 A;  1XGO A;  2V6C A;  2GA2 A;  2BHA A;  2BH3 A;  2Q96 A;  2NQ7 A;  1R58 A;  1YVM A;  2GGC A;  3TB5 A;  2P98 A;  5CNX A;  4PNC A;  3L7G A;  4U76 A;  1A16 A;  4IKU A;  4U75 A;  5JI6 A;  1B6A A;  2GG8 A;  3CB5 A;  2V3Y A;  2BHC A;  1WLR A;  4ZWO A;  3RVA A;  2Q93 A;  4U6C A;  5CDL A;  1WBQ A;  1QXY A;  4JUQ A;  3CB6 A;  4FUK A;  2OKN A;  3MX6 A;  2BB7 A;  2EVO A;  4FO7 A;  1WL9 A;  4MAT A;  1YW8 A;  4IPA A;  2GG7 A;  4U6Z A;  2GG5 A;  2Q94 A;  2G6P A;  4U69 A;  2BWY A;  1KQ9 A;  3FMQ A;  5D6E A;  2BWT A;  3PKB A;  4U6E A;  2GGB A;  3BIP A;  3PKD A;  2EA4 A;  2EVC A;  4S00 A;  2IW2 A;  4OOK A;  4A6V A;  1QXW A;  2P9A A;  2GZ5 A;  4U70 A;  4IU6 A;  1B59 A;  5CDE A;  4B28 A;  2ADU A;  3PKA A;  3IG4 A;  1C27 A;  5JHU A;  4S2T P;  1KQ0 A;  2GTX A;  1XNZ A;  2NQ6 A;  1XGS A;  4ZWU A;  4S01 A;  3IU7 A;  4EGE A;  1Y1N A;  5FCH A;  3PKC A;  2BWU A;  3IU9 A;  2GG3 A;  1C22 A;  4FLI A;  4R60 A;  2B3H A;  2BN7 A;  1W2M A;  4PV4 A;  4FO8 A;  4S2R P;  3ROR A;  3D27 A;  5CDV A;  4U73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...