4HXXA

Pyridinylpyrimidines selectively inhibit human methionine aminopeptidase-1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyridinylpyrimidines selectively inhibit human methionine aminopeptidase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4hxxA00
2BHAA 1R58A 1C23A 1W7VA 3PKEA 3CB5A 3PKAA 2Q96A 1MATA 4FO7A 4IF7A 4U73A 2BB7A 1BN5A 3TB5A 1QXYA 2ZSGA 3RVAA 2NQ7A 4EGEA 2Q8KA 2P99A 4U75A 4S2RP 2BHCA 1A16A 4HXXA 5JHUA 1C22A 1QXZA 4JUQA 1XGOA 2BWVA 3L7GA 4U1BA 1XGNA 2GU6A 3MATA 5D6EA 2NQ6A 2G6PA 2V6CA 3IU9A 4IDYA 1YW9A 2V3XA 3BIQA 5JFRA 2GG0A 4IU6A 2EVOA 2BWSA 2GG3A 1WN1A 4ZWUA 3BIPA 4PV4A 4S01A 1N51A 4FLLA 1WBQA 4U6ZA 5CDVA 4U6JA 2GGBA 1YW8A 5E5BA 2ADUA 1WY2A 2GU5A 4A6VA 1YJ3A 4U70A 2EA4A 4IKSA 1PV9A 4A6WA 1B6AA 5CDLA 4ZWPA 4RGZ1 4Z7MA 4FLJA 4FO8A 1CHMA 1XGMA 4ZNGA 1XGSA 4FKCA 4U69A 2GU4A 2GG2A 2Q95A 2BWWA 2GTXA 3PKBA 2EVMA 2BHDA 2B3KA 2EVCA 1QZYA 3FM3A 1Y1NA 3PKDA 1C24A 1YVMA 4RZYA 2GG7A 4IKTA 4U6EA 4IKRA 3CTZA 4R60A 2BH3A 3RORA 2BWYA 5CLSA 3IG4A 2MATA 2BN7A 2GG8A 2B3LA 2B3HA 4FUKA 2Q93A 2DFIA 2BWUA 2V3YA 4MATA 2OAZA 5CNXA 3FMQA 1C21A 3BITA 2BHBA 1WLRA 2OKNA 3MR1A 4FLKA 3S6BA 4PNCA 2BWXA 2EA2A 3D27A 3IU8A 1W2MA 1WL6A 5CIKA 3L24A 5CE6A 5FCFA 4FLIA 4U6WA 2Q92A 4QR8A 1B59A 1R5HA 1R5GA 5JI6A 2IW2A 2GG5A 5D6FA 4U76A 2HOWA 2GG9A 4IECA 1KQ9A 1WKMA 4IPAA 3IU7A 1JAWA 4B28A 2P98A 2V3ZA 4U71A 3CB6A 1C27A 2Q94A 1BOAA 2P9AA 4S00A 5CDEA 1YW7A 5FCHA 4RZZA 4IKUA 4OOKA 1KQ0A 4KM3A 1QXWA 3TAVA 1XNZA 2GU7A 4ZWOA 4S2TP 3PKCA 2GA2A 1KP0A 2GZ5A 3Q6DA 2BWTA 4U6CA 1M35A 3MX6A 1WL9A 3FMRA 1O0XA 2GGCA
chains in the Genus database with same CATH superfamily
2BHAA 1R58A 1C23A 1W7VA 3PKEA 3CB5A 3PKAA 2Q96A 1MATA 4FO7A 4IF7A 4U73A 2BB7A 1BN5A 3TB5A 1QXYA 2ZSGA 3RVAA 2NQ7A 4EGEA 2Q8KA 2P99A 4U75A 4S2RP 2BHCA 1A16A 4HXXA 5JHUA 1C22A 1QXZA 4JUQA 1XGOA 2BWVA 3L7GA 4U1BA 1XGNA 2GU6A 3MATA 5D6EA 2NQ6A 2G6PA 2V6CA 3IU9A 4IDYA 1YW9A 2V3XA 3BIQA 5JFRA 2GG0A 4IU6A 2EVOA 2BWSA 2GG3A 1WN1A 4ZWUA 3BIPA 4PV4A 4S01A 1N51A 4FLLA 1WBQA 4U6ZA 5CDVA 4U6JA 2GGBA 1YW8A 5E5BA 2ADUA 1WY2A 2GU5A 4A6VA 1YJ3A 4U70A 2EA4A 4IKSA 1PV9A 4A6WA 1B6AA 5CDLA 4ZWPA 4RGZ1 4Z7MA 4FLJA 4FO8A 1CHMA 1XGMA 4ZNGA 1XGSA 4FKCA 4U69A 2GU4A 2GG2A 2Q95A 2BWWA 2GTXA 3PKBA 2EVMA 2BHDA 2B3KA 2EVCA 1QZYA 3FM3A 1Y1NA 3PKDA 1C24A 1YVMA 4RZYA 2GG7A 4IKTA 4U6EA 4IKRA 3CTZA 4R60A 2BH3A 3RORA 2BWYA 5CLSA 3IG4A 2MATA 2BN7A 2GG8A 2B3LA 2B3HA 4FUKA 2Q93A 2DFIA 2BWUA 2V3YA 4MATA 2OAZA 5CNXA 3FMQA 1C21A 3BITA 2BHBA 1WLRA 2OKNA 3MR1A 4FLKA 3S6BA 4PNCA 2BWXA 2EA2A 3D27A 3IU8A 1W2MA 1WL6A 5CIKA 3L24A 5CE6A 5FCFA 4FLIA 4U6WA 2Q92A 4QR8A 1B59A 1R5HA 1R5GA 5JI6A 2IW2A 2GG5A 5D6FA 4U76A 2HOWA 2GG9A 4IECA 1KQ9A 1WKMA 4IPAA 3IU7A 1JAWA 4B28A 2P98A 2V3ZA 4U71A 3CB6A 1C27A 2Q94A 1BOAA 2P9AA 4S00A 5CDEA 1YW7A 5FCHA 4RZZA 4IKUA 4OOKA 1KQ0A 4KM3A 1QXWA 3TAVA 1XNZA 2GU7A 4ZWOA 4S2TP 3PKCA 2GA2A 1KP0A 2GZ5A 3Q6DA 2BWTA 4U6CA 1M35A 3MX6A 1WL9A 3FMRA 1O0XA 2GGCA
chains in the Genus database with same CATH topology
2BHAA 1R58A 1C23A 1W7VA 3PKEA 3CB5A 3PKAA 2Q96A 1MATA 4FO7A 4IF7A 4U73A 2BB7A 1BN5A 3TB5A 1QXYA 2ZSGA 3RVAA 2NQ7A 4EGEA 2Q8KA 2P99A 4U75A 4S2RP 2BHCA 1A16A 4HXXA 5JHUA 1C22A 1QXZA 4JUQA 1XGOA 2BWVA 3L7GA 4U1BA 1XGNA 2GU6A 3MATA 5D6EA 2NQ6A 2G6PA 2V6CA 3IU9A 4IDYA 1YW9A 2V3XA 3BIQA 5JFRA 2GG0A 4IU6A 2EVOA 2BWSA 2GG3A 1WN1A 4ZWUA 3BIPA 4PV4A 4S01A 1N51A 4FLLA 1WBQA 4U6ZA 5CDVA 4U6JA 2GGBA 1YW8A 5E5BA 2ADUA 1WY2A 2GU5A 4A6VA 1YJ3A 4U70A 2EA4A 4IKSA 1PV9A 4A6WA 1B6AA 5CDLA 4ZWPA 4RGZ1 4Z7MA 4FLJA 4FO8A 1CHMA 1XGMA 4ZNGA 1XGSA 4FKCA 4U69A 2GU4A 2GG2A 2Q95A 2BWWA 2GTXA 3PKBA 2EVMA 2BHDA 2B3KA 2EVCA 1QZYA 3FM3A 1Y1NA 3PKDA 1C24A 1YVMA 4RZYA 2GG7A 4IKTA 4U6EA 4IKRA 3CTZA 4R60A 2BH3A 3RORA 2BWYA 5CLSA 3IG4A 2MATA 2BN7A 2GG8A 2B3LA 2B3HA 4FUKA 2Q93A 2DFIA 2BWUA 2V3YA 4MATA 2OAZA 5CNXA 3FMQA 1C21A 3BITA 2BHBA 1WLRA 2OKNA 3MR1A 4FLKA 3S6BA 4PNCA 2BWXA 2EA2A 3D27A 3IU8A 1W2MA 1WL6A 5CIKA 3L24A 5CE6A 5FCFA 4FLIA 4U6WA 2Q92A 4QR8A 1B59A 1R5HA 1R5GA 5JI6A 2IW2A 2GG5A 5D6FA 4U76A 2HOWA 2GG9A 4IECA 1KQ9A 1WKMA 4IPAA 3IU7A 1JAWA 4B28A 2P98A 2V3ZA 4U71A 3CB6A 1C27A 2Q94A 1BOAA 2P9AA 4S00A 5CDEA 1YW7A 5FCHA 4RZZA 4IKUA 4OOKA 1KQ0A 4KM3A 1QXWA 3TAVA 1XNZA 2GU7A 4ZWOA 4S2TP 3PKCA 2GA2A 1KP0A 2GZ5A 3Q6DA 2BWTA 4U6CA 1M35A 3MX6A 1WL9A 3FMRA 1O0XA 2GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHA A;  1R58 A;  1C23 A;  1W7V A;  3PKE A;  3CB5 A;  3PKA A;  2Q96 A;  1MAT A;  4FO7 A;  4IF7 A;  4U73 A;  2BB7 A;  1BN5 A;  3TB5 A;  1QXY A;  2ZSG A;  3RVA A;  2NQ7 A;  4EGE A;  2Q8K A;  2P99 A;  4U75 A;  4S2R P;  2BHC A;  1A16 A;  4HXX A;  5JHU A;  1C22 A;  1QXZ A;  4JUQ A;  1XGO A;  2BWV A;  3L7G A;  4U1B A;  1XGN A;  2GU6 A;  3MAT A;  5D6E A;  2NQ6 A;  2G6P A;  2V6C A;  3IU9 A;  4IDY A;  1YW9 A;  2V3X A;  3BIQ A;  5JFR A;  2GG0 A;  4IU6 A;  2EVO A;  2BWS A;  2GG3 A;  1WN1 A;  4ZWU A;  3BIP A;  4PV4 A;  4S01 A;  1N51 A;  4FLL A;  1WBQ A;  4U6Z A;  5CDV A;  4U6J A;  2GGB A;  1YW8 A;  5E5B A;  2ADU A;  1WY2 A;  2GU5 A;  4A6V A;  1YJ3 A;  4U70 A;  2EA4 A;  4IKS A;  1PV9 A;  4A6W A;  1B6A A;  5CDL A;  4ZWP A;  4RGZ 1;  4Z7M A;  4FLJ A;  4FO8 A;  1CHM A;  1XGM A;  4ZNG A;  1XGS A;  4FKC A;  4U69 A;  2GU4 A;  2GG2 A;  2Q95 A;  2BWW A;  2GTX A;  3PKB A;  2EVM A;  2BHD A;  2B3K A;  2EVC A;  1QZY A;  3FM3 A;  1Y1N A;  3PKD A;  1C24 A;  1YVM A;  4RZY A;  2GG7 A;  4IKT A;  4U6E A;  4IKR A;  3CTZ A;  4R60 A;  2BH3 A;  3ROR A;  2BWY A;  5CLS A;  3IG4 A;  2MAT A;  2BN7 A;  2GG8 A;  2B3L A;  2B3H A;  4FUK A;  2Q93 A;  2DFI A;  2BWU A;  2V3Y A;  4MAT A;  2OAZ A;  5CNX A;  3FMQ A;  1C21 A;  3BIT A;  2BHB A;  1WLR A;  2OKN A;  3MR1 A;  4FLK A;  3S6B A;  4PNC A;  2BWX A;  2EA2 A;  3D27 A;  3IU8 A;  1W2M A;  1WL6 A;  5CIK A;  3L24 A;  5CE6 A;  5FCF A;  4FLI A;  4U6W A;  2Q92 A;  4QR8 A;  1B59 A;  1R5H A;  1R5G A;  5JI6 A;  2IW2 A;  2GG5 A;  5D6F A;  4U76 A;  2HOW A;  2GG9 A;  4IEC A;  1KQ9 A;  1WKM A;  4IPA A;  3IU7 A;  1JAW A;  4B28 A;  2P98 A;  2V3Z A;  4U71 A;  3CB6 A;  1C27 A;  2Q94 A;  1BOA A;  2P9A A;  4S00 A;  5CDE A;  1YW7 A;  5FCH A;  4RZZ A;  4IKU A;  4OOK A;  1KQ0 A;  4KM3 A;  1QXW A;  3TAV A;  1XNZ A;  2GU7 A;  4ZWO A;  4S2T P;  3PKC A;  2GA2 A;  1KP0 A;  2GZ5 A;  3Q6D A;  2BWT A;  4U6C A;  1M35 A;  3MX6 A;  1WL9 A;  3FMR A;  1O0X A;  2GGC A; 
#chains in the Genus database with same CATH topology
 2BHA A;  1R58 A;  1C23 A;  1W7V A;  3PKE A;  3CB5 A;  3PKA A;  2Q96 A;  1MAT A;  4FO7 A;  4IF7 A;  4U73 A;  2BB7 A;  1BN5 A;  3TB5 A;  1QXY A;  2ZSG A;  3RVA A;  2NQ7 A;  4EGE A;  2Q8K A;  2P99 A;  4U75 A;  4S2R P;  2BHC A;  1A16 A;  4HXX A;  5JHU A;  1C22 A;  1QXZ A;  4JUQ A;  1XGO A;  2BWV A;  3L7G A;  4U1B A;  1XGN A;  2GU6 A;  3MAT A;  5D6E A;  2NQ6 A;  2G6P A;  2V6C A;  3IU9 A;  4IDY A;  1YW9 A;  2V3X A;  3BIQ A;  5JFR A;  2GG0 A;  4IU6 A;  2EVO A;  2BWS A;  2GG3 A;  1WN1 A;  4ZWU A;  3BIP A;  4PV4 A;  4S01 A;  1N51 A;  4FLL A;  1WBQ A;  4U6Z A;  5CDV A;  4U6J A;  2GGB A;  1YW8 A;  5E5B A;  2ADU A;  1WY2 A;  2GU5 A;  4A6V A;  1YJ3 A;  4U70 A;  2EA4 A;  4IKS A;  1PV9 A;  4A6W A;  1B6A A;  5CDL A;  4ZWP A;  4RGZ 1;  4Z7M A;  4FLJ A;  4FO8 A;  1CHM A;  1XGM A;  4ZNG A;  1XGS A;  4FKC A;  4U69 A;  2GU4 A;  2GG2 A;  2Q95 A;  2BWW A;  2GTX A;  3PKB A;  2EVM A;  2BHD A;  2B3K A;  2EVC A;  1QZY A;  3FM3 A;  1Y1N A;  3PKD A;  1C24 A;  1YVM A;  4RZY A;  2GG7 A;  4IKT A;  4U6E A;  4IKR A;  3CTZ A;  4R60 A;  2BH3 A;  3ROR A;  2BWY A;  5CLS A;  3IG4 A;  2MAT A;  2BN7 A;  2GG8 A;  2B3L A;  2B3H A;  4FUK A;  2Q93 A;  2DFI A;  2BWU A;  2V3Y A;  4MAT A;  2OAZ A;  5CNX A;  3FMQ A;  1C21 A;  3BIT A;  2BHB A;  1WLR A;  2OKN A;  3MR1 A;  4FLK A;  3S6B A;  4PNC A;  2BWX A;  2EA2 A;  3D27 A;  3IU8 A;  1W2M A;  1WL6 A;  5CIK A;  3L24 A;  5CE6 A;  5FCF A;  4FLI A;  4U6W A;  2Q92 A;  4QR8 A;  1B59 A;  1R5H A;  1R5G A;  5JI6 A;  2IW2 A;  2GG5 A;  5D6F A;  4U76 A;  2HOW A;  2GG9 A;  4IEC A;  1KQ9 A;  1WKM A;  4IPA A;  3IU7 A;  1JAW A;  4B28 A;  2P98 A;  2V3Z A;  4U71 A;  3CB6 A;  1C27 A;  2Q94 A;  1BOA A;  2P9A A;  4S00 A;  5CDE A;  1YW7 A;  5FCH A;  4RZZ A;  4IKU A;  4OOK A;  1KQ0 A;  4KM3 A;  1QXW A;  3TAV A;  1XNZ A;  2GU7 A;  4ZWO A;  4S2T P;  3PKC A;  2GA2 A;  1KP0 A;  2GZ5 A;  3Q6D A;  2BWT A;  4U6C A;  1M35 A;  3MX6 A;  1WL9 A;  3FMR A;  1O0X A;  2GGC A; 
#chains in the Genus database with same CATH homology
 2BHA A;  1R58 A;  1C23 A;  1W7V A;  3PKE A;  3CB5 A;  3PKA A;  2Q96 A;  1MAT A;  4FO7 A;  4IF7 A;  4U73 A;  2BB7 A;  1BN5 A;  3TB5 A;  1QXY A;  2ZSG A;  3RVA A;  2NQ7 A;  4EGE A;  2Q8K A;  2P99 A;  4U75 A;  4S2R P;  2BHC A;  1A16 A;  4HXX A;  5JHU A;  1C22 A;  1QXZ A;  4JUQ A;  1XGO A;  2BWV A;  3L7G A;  4U1B A;  1XGN A;  2GU6 A;  3MAT A;  5D6E A;  2NQ6 A;  2G6P A;  2V6C A;  3IU9 A;  4IDY A;  1YW9 A;  2V3X A;  3BIQ A;  5JFR A;  2GG0 A;  4IU6 A;  2EVO A;  2BWS A;  2GG3 A;  1WN1 A;  4ZWU A;  3BIP A;  4PV4 A;  4S01 A;  1N51 A;  4FLL A;  1WBQ A;  4U6Z A;  5CDV A;  4U6J A;  2GGB A;  1YW8 A;  5E5B A;  2ADU A;  1WY2 A;  2GU5 A;  4A6V A;  1YJ3 A;  4U70 A;  2EA4 A;  4IKS A;  1PV9 A;  4A6W A;  1B6A A;  5CDL A;  4ZWP A;  4RGZ 1;  4Z7M A;  4FLJ A;  4FO8 A;  1CHM A;  1XGM A;  4ZNG A;  1XGS A;  4FKC A;  4U69 A;  2GU4 A;  2GG2 A;  2Q95 A;  2BWW A;  2GTX A;  3PKB A;  2EVM A;  2BHD A;  2B3K A;  2EVC A;  1QZY A;  3FM3 A;  1Y1N A;  3PKD A;  1C24 A;  1YVM A;  4RZY A;  2GG7 A;  4IKT A;  4U6E A;  4IKR A;  3CTZ A;  4R60 A;  2BH3 A;  3ROR A;  2BWY A;  5CLS A;  3IG4 A;  2MAT A;  2BN7 A;  2GG8 A;  2B3L A;  2B3H A;  4FUK A;  2Q93 A;  2DFI A;  2BWU A;  2V3Y A;  4MAT A;  2OAZ A;  5CNX A;  3FMQ A;  1C21 A;  3BIT A;  2BHB A;  1WLR A;  2OKN A;  3MR1 A;  4FLK A;  3S6B A;  4PNC A;  2BWX A;  2EA2 A;  3D27 A;  3IU8 A;  1W2M A;  1WL6 A;  5CIK A;  3L24 A;  5CE6 A;  5FCF A;  4FLI A;  4U6W A;  2Q92 A;  4QR8 A;  1B59 A;  1R5H A;  1R5G A;  5JI6 A;  2IW2 A;  2GG5 A;  5D6F A;  4U76 A;  2HOW A;  2GG9 A;  4IEC A;  1KQ9 A;  1WKM A;  4IPA A;  3IU7 A;  1JAW A;  4B28 A;  2P98 A;  2V3Z A;  4U71 A;  3CB6 A;  1C27 A;  2Q94 A;  1BOA A;  2P9A A;  4S00 A;  5CDE A;  1YW7 A;  5FCH A;  4RZZ A;  4IKU A;  4OOK A;  1KQ0 A;  4KM3 A;  1QXW A;  3TAV A;  1XNZ A;  2GU7 A;  4ZWO A;  4S2T P;  3PKC A;  2GA2 A;  1KP0 A;  2GZ5 A;  3Q6D A;  2BWT A;  4U6C A;  1M35 A;  3MX6 A;  1WL9 A;  3FMR A;  1O0X A;  2GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...