2EVOA

Crystal structure of methionine amino peptidase in complex with n-cyclopentyl-n-(thiazol-2-yl)oxalamide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
260
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evoA00
4PV4A 5CDVA 1QXWA 4A6WA 4FLKA 4RZZA 3S6BA 3RORA 1R5HA 3CTZA 1M35A 3IU7A 1WN1A 1YW8A 3BIQA 3L7GA 5CDEA 4IF7A 3TB5A 3MATA 4S00A 2EA2A 1QZYA 2GGCA 2EA4A 2ADUA 1PV9A 4FLJA 2BWXA 2BWWA 4FO8A 4FLLA 4Z7MA 4U70A 1R5GA 3BIPA 4FO7A 1WBQA 1WKMA 2P9AA 4IKRA 4MATA 1W7VA 5CE6A 1BN5A 2Q96A 1WLRA 4IECA 2BH3A 2BWYA 3PKCA 4S2TP 4U71A 2BWSA 2DFIA 2P99A 2V6CA 2EVMA 2EVCA 3PKAA 4IKTA 2GG8A 5JI6A 1KQ0A 2OAZA 2HOWA 3BITA 3IU9A 4ZWPA 5JHUA 2P98A 3PKEA 2NQ7A 1QXYA 1Y1NA 2Q93A 2Q94A 2GZ5A 5D6FA 4U6CA 1YVMA 2OKNA 4IU6A 1C24A 1WY2A 1YJ3A 5CDLA 4KM3A 2BHDA 3IG4A 5CNXA 5FCFA 3FM3A 1A16A 4ZWUA 2GG3A 1MATA 4U69A 4HXXA 1BOAA 3L24A 4FLIA 2BN7A 2ZSGA 2V3XA 4ZNGA 4U6WA 2BB7A 1W2MA 1XGSA 1R58A 2GG0A 2GU7A 2BHBA 4S2RP 4U6EA 1XGOA 4PNCA 5E5BA 2GG7A 2Q92A 4ZWOA 3TAVA 1C21A 1XGMA 2Q95A 4IKUA 5FCHA 4IKSA 2B3HA 4IDYA 2BHCA 5D6EA 2BWUA 3MX6A 2GG2A 3FMRA 2B3KA 1N51A 4R60A 2V3ZA 1JAWA 2MATA 3CB6A 2GTXA 3Q6DA 1B59A 4OOKA 2GG9A 1XGNA 2EVOA 2Q8KA 1B6AA 2BWVA 2V3YA 4U6ZA 3RVAA 2IW2A 1WL6A 4B28A 1O0XA 1CHMA 2GU6A 4S01A 4U1BA 4JUQA 4U73A 5CLSA 2GA2A 1WL9A 5JFRA 4A6VA 4RGZ1 4QR8A 4FKCA 2B3LA 4U75A 5CIKA 1C23A 2GGBA 4RZYA 2GU4A 4EGEA 2G6PA 3PKDA 2GU5A 4U6JA 1C22A 2GG5A 1QXZA 3CB5A 3D27A 1YW9A 4FUKA 2NQ6A 3IU8A 4IPAA 3PKBA 1KP0A 2BHAA 1C27A 4U76A 1XNZA 1YW7A 3FMQA 1KQ9A 2BWTA 3MR1A
chains in the Genus database with same CATH superfamily
4PV4A 5CDVA 1QXWA 4A6WA 4FLKA 4RZZA 3S6BA 3RORA 1R5HA 3CTZA 1M35A 3IU7A 1WN1A 1YW8A 3BIQA 3L7GA 5CDEA 4IF7A 3TB5A 3MATA 4S00A 2EA2A 1QZYA 2GGCA 2EA4A 2ADUA 1PV9A 4FLJA 2BWXA 2BWWA 4FO8A 4FLLA 4Z7MA 4U70A 1R5GA 3BIPA 4FO7A 1WBQA 1WKMA 2P9AA 4IKRA 4MATA 1W7VA 5CE6A 1BN5A 2Q96A 1WLRA 4IECA 2BH3A 2BWYA 3PKCA 4S2TP 4U71A 2BWSA 2DFIA 2P99A 2V6CA 2EVMA 2EVCA 3PKAA 4IKTA 2GG8A 5JI6A 1KQ0A 2OAZA 2HOWA 3BITA 3IU9A 4ZWPA 5JHUA 2P98A 3PKEA 2NQ7A 1QXYA 1Y1NA 2Q93A 2Q94A 2GZ5A 5D6FA 4U6CA 1YVMA 2OKNA 4IU6A 1C24A 1WY2A 1YJ3A 5CDLA 4KM3A 2BHDA 3IG4A 5CNXA 5FCFA 3FM3A 1A16A 4ZWUA 2GG3A 1MATA 4U69A 4HXXA 1BOAA 3L24A 4FLIA 2BN7A 2ZSGA 2V3XA 4ZNGA 4U6WA 2BB7A 1W2MA 1XGSA 1R58A 2GG0A 2GU7A 2BHBA 4S2RP 4U6EA 1XGOA 4PNCA 5E5BA 2GG7A 2Q92A 4ZWOA 3TAVA 1C21A 1XGMA 2Q95A 4IKUA 5FCHA 4IKSA 2B3HA 4IDYA 2BHCA 5D6EA 2BWUA 3MX6A 2GG2A 3FMRA 2B3KA 1N51A 4R60A 2V3ZA 1JAWA 2MATA 3CB6A 2GTXA 3Q6DA 1B59A 4OOKA 2GG9A 1XGNA 2EVOA 2Q8KA 1B6AA 2BWVA 2V3YA 4U6ZA 3RVAA 2IW2A 1WL6A 4B28A 1O0XA 1CHMA 2GU6A 4S01A 4U1BA 4JUQA 4U73A 5CLSA 2GA2A 1WL9A 5JFRA 4A6VA 4RGZ1 4QR8A 4FKCA 2B3LA 4U75A 5CIKA 1C23A 2GGBA 4RZYA 2GU4A 4EGEA 2G6PA 3PKDA 2GU5A 4U6JA 1C22A 2GG5A 1QXZA 3CB5A 3D27A 1YW9A 4FUKA 2NQ6A 3IU8A 4IPAA 3PKBA 1KP0A 2BHAA 1C27A 4U76A 1XNZA 1YW7A 3FMQA 1KQ9A 2BWTA 3MR1A
chains in the Genus database with same CATH topology
4PV4A 5CDVA 1QXWA 4A6WA 4FLKA 4RZZA 3S6BA 3RORA 1R5HA 3CTZA 1M35A 3IU7A 1WN1A 1YW8A 3BIQA 3L7GA 5CDEA 4IF7A 3TB5A 3MATA 4S00A 2EA2A 1QZYA 2GGCA 2EA4A 2ADUA 1PV9A 4FLJA 2BWXA 2BWWA 4FO8A 4FLLA 4Z7MA 4U70A 1R5GA 3BIPA 4FO7A 1WBQA 1WKMA 2P9AA 4IKRA 4MATA 1W7VA 5CE6A 1BN5A 2Q96A 1WLRA 4IECA 2BH3A 2BWYA 3PKCA 4S2TP 4U71A 2BWSA 2DFIA 2P99A 2V6CA 2EVMA 2EVCA 3PKAA 4IKTA 2GG8A 5JI6A 1KQ0A 2OAZA 2HOWA 3BITA 3IU9A 4ZWPA 5JHUA 2P98A 3PKEA 2NQ7A 1QXYA 1Y1NA 2Q93A 2Q94A 2GZ5A 5D6FA 4U6CA 1YVMA 2OKNA 4IU6A 1C24A 1WY2A 1YJ3A 5CDLA 4KM3A 2BHDA 3IG4A 5CNXA 5FCFA 3FM3A 1A16A 4ZWUA 2GG3A 1MATA 4U69A 4HXXA 1BOAA 3L24A 4FLIA 2BN7A 2ZSGA 2V3XA 4ZNGA 4U6WA 2BB7A 1W2MA 1XGSA 1R58A 2GG0A 2GU7A 2BHBA 4S2RP 4U6EA 1XGOA 4PNCA 5E5BA 2GG7A 2Q92A 4ZWOA 3TAVA 1C21A 1XGMA 2Q95A 4IKUA 5FCHA 4IKSA 2B3HA 4IDYA 2BHCA 5D6EA 2BWUA 3MX6A 2GG2A 3FMRA 2B3KA 1N51A 4R60A 2V3ZA 1JAWA 2MATA 3CB6A 2GTXA 3Q6DA 1B59A 4OOKA 2GG9A 1XGNA 2EVOA 2Q8KA 1B6AA 2BWVA 2V3YA 4U6ZA 3RVAA 2IW2A 1WL6A 4B28A 1O0XA 1CHMA 2GU6A 4S01A 4U1BA 4JUQA 4U73A 5CLSA 2GA2A 1WL9A 5JFRA 4A6VA 4RGZ1 4QR8A 4FKCA 2B3LA 4U75A 5CIKA 1C23A 2GGBA 4RZYA 2GU4A 4EGEA 2G6PA 3PKDA 2GU5A 4U6JA 1C22A 2GG5A 1QXZA 3CB5A 3D27A 1YW9A 4FUKA 2NQ6A 3IU8A 4IPAA 3PKBA 1KP0A 2BHAA 1C27A 4U76A 1XNZA 1YW7A 3FMQA 1KQ9A 2BWTA 3MR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PV4 A;  5CDV A;  1QXW A;  4A6W A;  4FLK A;  4RZZ A;  3S6B A;  3ROR A;  1R5H A;  3CTZ A;  1M35 A;  3IU7 A;  1WN1 A;  1YW8 A;  3BIQ A;  3L7G A;  5CDE A;  4IF7 A;  3TB5 A;  3MAT A;  4S00 A;  2EA2 A;  1QZY A;  2GGC A;  2EA4 A;  2ADU A;  1PV9 A;  4FLJ A;  2BWX A;  2BWW A;  4FO8 A;  4FLL A;  4Z7M A;  4U70 A;  1R5G A;  3BIP A;  4FO7 A;  1WBQ A;  1WKM A;  2P9A A;  4IKR A;  4MAT A;  1W7V A;  5CE6 A;  1BN5 A;  2Q96 A;  1WLR A;  4IEC A;  2BH3 A;  2BWY A;  3PKC A;  4S2T P;  4U71 A;  2BWS A;  2DFI A;  2P99 A;  2V6C A;  2EVM A;  2EVC A;  3PKA A;  4IKT A;  2GG8 A;  5JI6 A;  1KQ0 A;  2OAZ A;  2HOW A;  3BIT A;  3IU9 A;  4ZWP A;  5JHU A;  2P98 A;  3PKE A;  2NQ7 A;  1QXY A;  1Y1N A;  2Q93 A;  2Q94 A;  2GZ5 A;  5D6F A;  4U6C A;  1YVM A;  2OKN A;  4IU6 A;  1C24 A;  1WY2 A;  1YJ3 A;  5CDL A;  4KM3 A;  2BHD A;  3IG4 A;  5CNX A;  5FCF A;  3FM3 A;  1A16 A;  4ZWU A;  2GG3 A;  1MAT A;  4U69 A;  4HXX A;  1BOA A;  3L24 A;  4FLI A;  2BN7 A;  2ZSG A;  2V3X A;  4ZNG A;  4U6W A;  2BB7 A;  1W2M A;  1XGS A;  1R58 A;  2GG0 A;  2GU7 A;  2BHB A;  4S2R P;  4U6E A;  1XGO A;  4PNC A;  5E5B A;  2GG7 A;  2Q92 A;  4ZWO A;  3TAV A;  1C21 A;  1XGM A;  2Q95 A;  4IKU A;  5FCH A;  4IKS A;  2B3H A;  4IDY A;  2BHC A;  5D6E A;  2BWU A;  3MX6 A;  2GG2 A;  3FMR A;  2B3K A;  1N51 A;  4R60 A;  2V3Z A;  1JAW A;  2MAT A;  3CB6 A;  2GTX A;  3Q6D A;  1B59 A;  4OOK A;  2GG9 A;  1XGN A;  2EVO A;  2Q8K A;  1B6A A;  2BWV A;  2V3Y A;  4U6Z A;  3RVA A;  2IW2 A;  1WL6 A;  4B28 A;  1O0X A;  1CHM A;  2GU6 A;  4S01 A;  4U1B A;  4JUQ A;  4U73 A;  5CLS A;  2GA2 A;  1WL9 A;  5JFR A;  4A6V A;  4RGZ 1;  4QR8 A;  4FKC A;  2B3L A;  4U75 A;  5CIK A;  1C23 A;  2GGB A;  4RZY A;  2GU4 A;  4EGE A;  2G6P A;  3PKD A;  2GU5 A;  4U6J A;  1C22 A;  2GG5 A;  1QXZ A;  3CB5 A;  3D27 A;  1YW9 A;  4FUK A;  2NQ6 A;  3IU8 A;  4IPA A;  3PKB A;  1KP0 A;  2BHA A;  1C27 A;  4U76 A;  1XNZ A;  1YW7 A;  3FMQ A;  1KQ9 A;  2BWT A;  3MR1 A; 
#chains in the Genus database with same CATH topology
 4PV4 A;  5CDV A;  1QXW A;  4A6W A;  4FLK A;  4RZZ A;  3S6B A;  3ROR A;  1R5H A;  3CTZ A;  1M35 A;  3IU7 A;  1WN1 A;  1YW8 A;  3BIQ A;  3L7G A;  5CDE A;  4IF7 A;  3TB5 A;  3MAT A;  4S00 A;  2EA2 A;  1QZY A;  2GGC A;  2EA4 A;  2ADU A;  1PV9 A;  4FLJ A;  2BWX A;  2BWW A;  4FO8 A;  4FLL A;  4Z7M A;  4U70 A;  1R5G A;  3BIP A;  4FO7 A;  1WBQ A;  1WKM A;  2P9A A;  4IKR A;  4MAT A;  1W7V A;  5CE6 A;  1BN5 A;  2Q96 A;  1WLR A;  4IEC A;  2BH3 A;  2BWY A;  3PKC A;  4S2T P;  4U71 A;  2BWS A;  2DFI A;  2P99 A;  2V6C A;  2EVM A;  2EVC A;  3PKA A;  4IKT A;  2GG8 A;  5JI6 A;  1KQ0 A;  2OAZ A;  2HOW A;  3BIT A;  3IU9 A;  4ZWP A;  5JHU A;  2P98 A;  3PKE A;  2NQ7 A;  1QXY A;  1Y1N A;  2Q93 A;  2Q94 A;  2GZ5 A;  5D6F A;  4U6C A;  1YVM A;  2OKN A;  4IU6 A;  1C24 A;  1WY2 A;  1YJ3 A;  5CDL A;  4KM3 A;  2BHD A;  3IG4 A;  5CNX A;  5FCF A;  3FM3 A;  1A16 A;  4ZWU A;  2GG3 A;  1MAT A;  4U69 A;  4HXX A;  1BOA A;  3L24 A;  4FLI A;  2BN7 A;  2ZSG A;  2V3X A;  4ZNG A;  4U6W A;  2BB7 A;  1W2M A;  1XGS A;  1R58 A;  2GG0 A;  2GU7 A;  2BHB A;  4S2R P;  4U6E A;  1XGO A;  4PNC A;  5E5B A;  2GG7 A;  2Q92 A;  4ZWO A;  3TAV A;  1C21 A;  1XGM A;  2Q95 A;  4IKU A;  5FCH A;  4IKS A;  2B3H A;  4IDY A;  2BHC A;  5D6E A;  2BWU A;  3MX6 A;  2GG2 A;  3FMR A;  2B3K A;  1N51 A;  4R60 A;  2V3Z A;  1JAW A;  2MAT A;  3CB6 A;  2GTX A;  3Q6D A;  1B59 A;  4OOK A;  2GG9 A;  1XGN A;  2EVO A;  2Q8K A;  1B6A A;  2BWV A;  2V3Y A;  4U6Z A;  3RVA A;  2IW2 A;  1WL6 A;  4B28 A;  1O0X A;  1CHM A;  2GU6 A;  4S01 A;  4U1B A;  4JUQ A;  4U73 A;  5CLS A;  2GA2 A;  1WL9 A;  5JFR A;  4A6V A;  4RGZ 1;  4QR8 A;  4FKC A;  2B3L A;  4U75 A;  5CIK A;  1C23 A;  2GGB A;  4RZY A;  2GU4 A;  4EGE A;  2G6P A;  3PKD A;  2GU5 A;  4U6J A;  1C22 A;  2GG5 A;  1QXZ A;  3CB5 A;  3D27 A;  1YW9 A;  4FUK A;  2NQ6 A;  3IU8 A;  4IPA A;  3PKB A;  1KP0 A;  2BHA A;  1C27 A;  4U76 A;  1XNZ A;  1YW7 A;  3FMQ A;  1KQ9 A;  2BWT A;  3MR1 A; 
#chains in the Genus database with same CATH homology
 4PV4 A;  5CDV A;  1QXW A;  4A6W A;  4FLK A;  4RZZ A;  3S6B A;  3ROR A;  1R5H A;  3CTZ A;  1M35 A;  3IU7 A;  1WN1 A;  1YW8 A;  3BIQ A;  3L7G A;  5CDE A;  4IF7 A;  3TB5 A;  3MAT A;  4S00 A;  2EA2 A;  1QZY A;  2GGC A;  2EA4 A;  2ADU A;  1PV9 A;  4FLJ A;  2BWX A;  2BWW A;  4FO8 A;  4FLL A;  4Z7M A;  4U70 A;  1R5G A;  3BIP A;  4FO7 A;  1WBQ A;  1WKM A;  2P9A A;  4IKR A;  4MAT A;  1W7V A;  5CE6 A;  1BN5 A;  2Q96 A;  1WLR A;  4IEC A;  2BH3 A;  2BWY A;  3PKC A;  4S2T P;  4U71 A;  2BWS A;  2DFI A;  2P99 A;  2V6C A;  2EVM A;  2EVC A;  3PKA A;  4IKT A;  2GG8 A;  5JI6 A;  1KQ0 A;  2OAZ A;  2HOW A;  3BIT A;  3IU9 A;  4ZWP A;  5JHU A;  2P98 A;  3PKE A;  2NQ7 A;  1QXY A;  1Y1N A;  2Q93 A;  2Q94 A;  2GZ5 A;  5D6F A;  4U6C A;  1YVM A;  2OKN A;  4IU6 A;  1C24 A;  1WY2 A;  1YJ3 A;  5CDL A;  4KM3 A;  2BHD A;  3IG4 A;  5CNX A;  5FCF A;  3FM3 A;  1A16 A;  4ZWU A;  2GG3 A;  1MAT A;  4U69 A;  4HXX A;  1BOA A;  3L24 A;  4FLI A;  2BN7 A;  2ZSG A;  2V3X A;  4ZNG A;  4U6W A;  2BB7 A;  1W2M A;  1XGS A;  1R58 A;  2GG0 A;  2GU7 A;  2BHB A;  4S2R P;  4U6E A;  1XGO A;  4PNC A;  5E5B A;  2GG7 A;  2Q92 A;  4ZWO A;  3TAV A;  1C21 A;  1XGM A;  2Q95 A;  4IKU A;  5FCH A;  4IKS A;  2B3H A;  4IDY A;  2BHC A;  5D6E A;  2BWU A;  3MX6 A;  2GG2 A;  3FMR A;  2B3K A;  1N51 A;  4R60 A;  2V3Z A;  1JAW A;  2MAT A;  3CB6 A;  2GTX A;  3Q6D A;  1B59 A;  4OOK A;  2GG9 A;  1XGN A;  2EVO A;  2Q8K A;  1B6A A;  2BWV A;  2V3Y A;  4U6Z A;  3RVA A;  2IW2 A;  1WL6 A;  4B28 A;  1O0X A;  1CHM A;  2GU6 A;  4S01 A;  4U1B A;  4JUQ A;  4U73 A;  5CLS A;  2GA2 A;  1WL9 A;  5JFR A;  4A6V A;  4RGZ 1;  4QR8 A;  4FKC A;  2B3L A;  4U75 A;  5CIK A;  1C23 A;  2GGB A;  4RZY A;  2GU4 A;  4EGE A;  2G6P A;  3PKD A;  2GU5 A;  4U6J A;  1C22 A;  2GG5 A;  1QXZ A;  3CB5 A;  3D27 A;  1YW9 A;  4FUK A;  2NQ6 A;  3IU8 A;  4IPA A;  3PKB A;  1KP0 A;  2BHA A;  1C27 A;  4U76 A;  1XNZ A;  1YW7 A;  3FMQ A;  1KQ9 A;  2BWT A;  3MR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...