2EVOA

Crystal structure of methionine amino peptidase in complex with n-cyclopentyl-n-(thiazol-2-yl)oxalamide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
260
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evoA00
1QXZA 1N51A 4ZWOA 1C22A 2B3HA 1WLRA 4IKRA 4IKUA 5CDEA 3IG4A 3IU7A 2NQ6A 4S01A 4IECA 1XGOA 1XGSA 1YW8A 2V3YA 2GGBA 4RZYA 1R5HA 2DFIA 2P98A 2EA2A 2GA2A 1BN5A 2B3KA 2V3XA 2GG5A 4ZWUA 2GZ5A 3PKDA 3Q6DA 3FMRA 2GU5A 4IF7A 1WL9A 3CB6A 4U6CA 4ZNGA 2OAZA 2BB7A 1QXYA 4FLKA 2EA4A 3L24A 1O0XA 4U6WA 1YVMA 4A6VA 1PV9A 2BWWA 2NQ7A 2BHDA 4ZWPA 2BWYA 4U76A 3IU9A 4FO7A 4JUQA 5JHUA 5D6FA 2Q93A 3MX6A 4FO8A 3TAVA 1MATA 4IU6A 4IKSA 4FLJA 3TB5A 2GG2A 1KQ0A 5D6EA 2EVMA 4FLIA 4U73A 5FCFA 2EVCA 1C21A 4U70A 2Q95A 3FM3A 2V6CA 4PV4A 1B6AA 2BWXA 4IKTA 3BIPA 4U1BA 1W2MA 3D27A 2B3LA 3PKEA 1YW9A 2MATA 1M35A 4U6EA 1WY2A 5CIKA 5FCHA 1A16A 2BWUA 2BH3A 2GG0A 3MATA 4S00A 3BITA 4IDYA 3L7GA 4FUKA 1C23A 1CHMA 3PKAA 4RGZ1 2BWSA 5CNXA 4A6WA 2OKNA 5CDVA 2Q92A 1C24A 1QXWA 4OOKA 2ADUA 2GU4A 4U75A 2GG9A 4S2TP 4QR8A 4U71A 1KP0A 1XGNA 2Q8KA 4R60A 5E5BA 4Z7MA 1C27A 4FKCA 1YW7A 2GGCA 2GTXA 2EVOA 1WKMA 3PKCA 3IU8A 2P9AA 1WN1A 4HXXA 2GU7A 2G6PA 3RORA 5JI6A 5CLSA 1XGMA 4RZZA 1Y1NA 1BOAA 1WL6A 2P99A 2Q96A 1JAWA 1R58A 4EGEA 1WBQA 2BHCA 3PKBA 1W7VA 4IPAA 3FMQA 4FLLA 3S6BA 1B59A 1XNZA 2GG3A 2V3ZA 2BWVA 3BIQA 2BHAA 3CTZA 2GG7A 4U6ZA 2GU6A 3RVAA 5CE6A 1YJ3A 2ZSGA 3MR1A 5CDLA 1KQ9A 3CB5A 2BWTA 5JFRA 2BN7A 4U6JA 1R5GA 4KM3A 4PNCA 4S2RP 2GG8A 4U69A 2IW2A 1QZYA 2Q94A 2HOWA 2BHBA 4B28A 4MATA
chains in the Genus database with same CATH superfamily
1QXZA 1N51A 4ZWOA 1C22A 2B3HA 1WLRA 4IKRA 4IKUA 5CDEA 3IG4A 3IU7A 2NQ6A 4S01A 4IECA 1XGOA 1XGSA 1YW8A 2V3YA 2GGBA 4RZYA 1R5HA 2DFIA 2P98A 2EA2A 2GA2A 1BN5A 2B3KA 2V3XA 2GG5A 4ZWUA 2GZ5A 3PKDA 3Q6DA 3FMRA 2GU5A 4IF7A 1WL9A 3CB6A 4U6CA 4ZNGA 2OAZA 2BB7A 1QXYA 4FLKA 2EA4A 3L24A 1O0XA 4U6WA 1YVMA 4A6VA 1PV9A 2BWWA 2NQ7A 2BHDA 4ZWPA 2BWYA 4U76A 3IU9A 4FO7A 4JUQA 5JHUA 5D6FA 2Q93A 3MX6A 4FO8A 3TAVA 1MATA 4IU6A 4IKSA 4FLJA 3TB5A 2GG2A 1KQ0A 5D6EA 2EVMA 4FLIA 4U73A 5FCFA 2EVCA 1C21A 4U70A 2Q95A 3FM3A 2V6CA 4PV4A 1B6AA 2BWXA 4IKTA 3BIPA 4U1BA 1W2MA 3D27A 2B3LA 3PKEA 1YW9A 2MATA 1M35A 4U6EA 1WY2A 5CIKA 5FCHA 1A16A 2BWUA 2BH3A 2GG0A 3MATA 4S00A 3BITA 4IDYA 3L7GA 4FUKA 1C23A 1CHMA 3PKAA 4RGZ1 2BWSA 5CNXA 4A6WA 2OKNA 5CDVA 2Q92A 1C24A 1QXWA 4OOKA 2ADUA 2GU4A 4U75A 2GG9A 4S2TP 4QR8A 4U71A 1KP0A 1XGNA 2Q8KA 4R60A 5E5BA 4Z7MA 1C27A 4FKCA 1YW7A 2GGCA 2GTXA 2EVOA 1WKMA 3PKCA 3IU8A 2P9AA 1WN1A 4HXXA 2GU7A 2G6PA 3RORA 5JI6A 5CLSA 1XGMA 4RZZA 1Y1NA 1BOAA 1WL6A 2P99A 2Q96A 1JAWA 1R58A 4EGEA 1WBQA 2BHCA 3PKBA 1W7VA 4IPAA 3FMQA 4FLLA 3S6BA 1B59A 1XNZA 2GG3A 2V3ZA 2BWVA 3BIQA 2BHAA 3CTZA 2GG7A 4U6ZA 2GU6A 3RVAA 5CE6A 1YJ3A 2ZSGA 3MR1A 5CDLA 1KQ9A 3CB5A 2BWTA 5JFRA 2BN7A 4U6JA 1R5GA 4KM3A 4PNCA 4S2RP 2GG8A 4U69A 2IW2A 1QZYA 2Q94A 2HOWA 2BHBA 4B28A 4MATA
chains in the Genus database with same CATH topology
1QXZA 1N51A 4ZWOA 1C22A 2B3HA 1WLRA 4IKRA 4IKUA 5CDEA 3IG4A 3IU7A 2NQ6A 4S01A 4IECA 1XGOA 1XGSA 1YW8A 2V3YA 2GGBA 4RZYA 1R5HA 2DFIA 2P98A 2EA2A 2GA2A 1BN5A 2B3KA 2V3XA 2GG5A 4ZWUA 2GZ5A 3PKDA 3Q6DA 3FMRA 2GU5A 4IF7A 1WL9A 3CB6A 4U6CA 4ZNGA 2OAZA 2BB7A 1QXYA 4FLKA 2EA4A 3L24A 1O0XA 4U6WA 1YVMA 4A6VA 1PV9A 2BWWA 2NQ7A 2BHDA 4ZWPA 2BWYA 4U76A 3IU9A 4FO7A 4JUQA 5JHUA 5D6FA 2Q93A 3MX6A 4FO8A 3TAVA 1MATA 4IU6A 4IKSA 4FLJA 3TB5A 2GG2A 1KQ0A 5D6EA 2EVMA 4FLIA 4U73A 5FCFA 2EVCA 1C21A 4U70A 2Q95A 3FM3A 2V6CA 4PV4A 1B6AA 2BWXA 4IKTA 3BIPA 4U1BA 1W2MA 3D27A 2B3LA 3PKEA 1YW9A 2MATA 1M35A 4U6EA 1WY2A 5CIKA 5FCHA 1A16A 2BWUA 2BH3A 2GG0A 3MATA 4S00A 3BITA 4IDYA 3L7GA 4FUKA 1C23A 1CHMA 3PKAA 4RGZ1 2BWSA 5CNXA 4A6WA 2OKNA 5CDVA 2Q92A 1C24A 1QXWA 4OOKA 2ADUA 2GU4A 4U75A 2GG9A 4S2TP 4QR8A 4U71A 1KP0A 1XGNA 2Q8KA 4R60A 5E5BA 4Z7MA 1C27A 4FKCA 1YW7A 2GGCA 2GTXA 2EVOA 1WKMA 3PKCA 3IU8A 2P9AA 1WN1A 4HXXA 2GU7A 2G6PA 3RORA 5JI6A 5CLSA 1XGMA 4RZZA 1Y1NA 1BOAA 1WL6A 2P99A 2Q96A 1JAWA 1R58A 4EGEA 1WBQA 2BHCA 3PKBA 1W7VA 4IPAA 3FMQA 4FLLA 3S6BA 1B59A 1XNZA 2GG3A 2V3ZA 2BWVA 3BIQA 2BHAA 3CTZA 2GG7A 4U6ZA 2GU6A 3RVAA 5CE6A 1YJ3A 2ZSGA 3MR1A 5CDLA 1KQ9A 3CB5A 2BWTA 5JFRA 2BN7A 4U6JA 1R5GA 4KM3A 4PNCA 4S2RP 2GG8A 4U69A 2IW2A 1QZYA 2Q94A 2HOWA 2BHBA 4B28A 4MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXZ A;  1N51 A;  4ZWO A;  1C22 A;  2B3H A;  1WLR A;  4IKR A;  4IKU A;  5CDE A;  3IG4 A;  3IU7 A;  2NQ6 A;  4S01 A;  4IEC A;  1XGO A;  1XGS A;  1YW8 A;  2V3Y A;  2GGB A;  4RZY A;  1R5H A;  2DFI A;  2P98 A;  2EA2 A;  2GA2 A;  1BN5 A;  2B3K A;  2V3X A;  2GG5 A;  4ZWU A;  2GZ5 A;  3PKD A;  3Q6D A;  3FMR A;  2GU5 A;  4IF7 A;  1WL9 A;  3CB6 A;  4U6C A;  4ZNG A;  2OAZ A;  2BB7 A;  1QXY A;  4FLK A;  2EA4 A;  3L24 A;  1O0X A;  4U6W A;  1YVM A;  4A6V A;  1PV9 A;  2BWW A;  2NQ7 A;  2BHD A;  4ZWP A;  2BWY A;  4U76 A;  3IU9 A;  4FO7 A;  4JUQ A;  5JHU A;  5D6F A;  2Q93 A;  3MX6 A;  4FO8 A;  3TAV A;  1MAT A;  4IU6 A;  4IKS A;  4FLJ A;  3TB5 A;  2GG2 A;  1KQ0 A;  5D6E A;  2EVM A;  4FLI A;  4U73 A;  5FCF A;  2EVC A;  1C21 A;  4U70 A;  2Q95 A;  3FM3 A;  2V6C A;  4PV4 A;  1B6A A;  2BWX A;  4IKT A;  3BIP A;  4U1B A;  1W2M A;  3D27 A;  2B3L A;  3PKE A;  1YW9 A;  2MAT A;  1M35 A;  4U6E A;  1WY2 A;  5CIK A;  5FCH A;  1A16 A;  2BWU A;  2BH3 A;  2GG0 A;  3MAT A;  4S00 A;  3BIT A;  4IDY A;  3L7G A;  4FUK A;  1C23 A;  1CHM A;  3PKA A;  4RGZ 1;  2BWS A;  5CNX A;  4A6W A;  2OKN A;  5CDV A;  2Q92 A;  1C24 A;  1QXW A;  4OOK A;  2ADU A;  2GU4 A;  4U75 A;  2GG9 A;  4S2T P;  4QR8 A;  4U71 A;  1KP0 A;  1XGN A;  2Q8K A;  4R60 A;  5E5B A;  4Z7M A;  1C27 A;  4FKC A;  1YW7 A;  2GGC A;  2GTX A;  2EVO A;  1WKM A;  3PKC A;  3IU8 A;  2P9A A;  1WN1 A;  4HXX A;  2GU7 A;  2G6P A;  3ROR A;  5JI6 A;  5CLS A;  1XGM A;  4RZZ A;  1Y1N A;  1BOA A;  1WL6 A;  2P99 A;  2Q96 A;  1JAW A;  1R58 A;  4EGE A;  1WBQ A;  2BHC A;  3PKB A;  1W7V A;  4IPA A;  3FMQ A;  4FLL A;  3S6B A;  1B59 A;  1XNZ A;  2GG3 A;  2V3Z A;  2BWV A;  3BIQ A;  2BHA A;  3CTZ A;  2GG7 A;  4U6Z A;  2GU6 A;  3RVA A;  5CE6 A;  1YJ3 A;  2ZSG A;  3MR1 A;  5CDL A;  1KQ9 A;  3CB5 A;  2BWT A;  5JFR A;  2BN7 A;  4U6J A;  1R5G A;  4KM3 A;  4PNC A;  4S2R P;  2GG8 A;  4U69 A;  2IW2 A;  1QZY A;  2Q94 A;  2HOW A;  2BHB A;  4B28 A;  4MAT A; 
#chains in the Genus database with same CATH topology
 1QXZ A;  1N51 A;  4ZWO A;  1C22 A;  2B3H A;  1WLR A;  4IKR A;  4IKU A;  5CDE A;  3IG4 A;  3IU7 A;  2NQ6 A;  4S01 A;  4IEC A;  1XGO A;  1XGS A;  1YW8 A;  2V3Y A;  2GGB A;  4RZY A;  1R5H A;  2DFI A;  2P98 A;  2EA2 A;  2GA2 A;  1BN5 A;  2B3K A;  2V3X A;  2GG5 A;  4ZWU A;  2GZ5 A;  3PKD A;  3Q6D A;  3FMR A;  2GU5 A;  4IF7 A;  1WL9 A;  3CB6 A;  4U6C A;  4ZNG A;  2OAZ A;  2BB7 A;  1QXY A;  4FLK A;  2EA4 A;  3L24 A;  1O0X A;  4U6W A;  1YVM A;  4A6V A;  1PV9 A;  2BWW A;  2NQ7 A;  2BHD A;  4ZWP A;  2BWY A;  4U76 A;  3IU9 A;  4FO7 A;  4JUQ A;  5JHU A;  5D6F A;  2Q93 A;  3MX6 A;  4FO8 A;  3TAV A;  1MAT A;  4IU6 A;  4IKS A;  4FLJ A;  3TB5 A;  2GG2 A;  1KQ0 A;  5D6E A;  2EVM A;  4FLI A;  4U73 A;  5FCF A;  2EVC A;  1C21 A;  4U70 A;  2Q95 A;  3FM3 A;  2V6C A;  4PV4 A;  1B6A A;  2BWX A;  4IKT A;  3BIP A;  4U1B A;  1W2M A;  3D27 A;  2B3L A;  3PKE A;  1YW9 A;  2MAT A;  1M35 A;  4U6E A;  1WY2 A;  5CIK A;  5FCH A;  1A16 A;  2BWU A;  2BH3 A;  2GG0 A;  3MAT A;  4S00 A;  3BIT A;  4IDY A;  3L7G A;  4FUK A;  1C23 A;  1CHM A;  3PKA A;  4RGZ 1;  2BWS A;  5CNX A;  4A6W A;  2OKN A;  5CDV A;  2Q92 A;  1C24 A;  1QXW A;  4OOK A;  2ADU A;  2GU4 A;  4U75 A;  2GG9 A;  4S2T P;  4QR8 A;  4U71 A;  1KP0 A;  1XGN A;  2Q8K A;  4R60 A;  5E5B A;  4Z7M A;  1C27 A;  4FKC A;  1YW7 A;  2GGC A;  2GTX A;  2EVO A;  1WKM A;  3PKC A;  3IU8 A;  2P9A A;  1WN1 A;  4HXX A;  2GU7 A;  2G6P A;  3ROR A;  5JI6 A;  5CLS A;  1XGM A;  4RZZ A;  1Y1N A;  1BOA A;  1WL6 A;  2P99 A;  2Q96 A;  1JAW A;  1R58 A;  4EGE A;  1WBQ A;  2BHC A;  3PKB A;  1W7V A;  4IPA A;  3FMQ A;  4FLL A;  3S6B A;  1B59 A;  1XNZ A;  2GG3 A;  2V3Z A;  2BWV A;  3BIQ A;  2BHA A;  3CTZ A;  2GG7 A;  4U6Z A;  2GU6 A;  3RVA A;  5CE6 A;  1YJ3 A;  2ZSG A;  3MR1 A;  5CDL A;  1KQ9 A;  3CB5 A;  2BWT A;  5JFR A;  2BN7 A;  4U6J A;  1R5G A;  4KM3 A;  4PNC A;  4S2R P;  2GG8 A;  4U69 A;  2IW2 A;  1QZY A;  2Q94 A;  2HOW A;  2BHB A;  4B28 A;  4MAT A; 
#chains in the Genus database with same CATH homology
 1QXZ A;  1N51 A;  4ZWO A;  1C22 A;  2B3H A;  1WLR A;  4IKR A;  4IKU A;  5CDE A;  3IG4 A;  3IU7 A;  2NQ6 A;  4S01 A;  4IEC A;  1XGO A;  1XGS A;  1YW8 A;  2V3Y A;  2GGB A;  4RZY A;  1R5H A;  2DFI A;  2P98 A;  2EA2 A;  2GA2 A;  1BN5 A;  2B3K A;  2V3X A;  2GG5 A;  4ZWU A;  2GZ5 A;  3PKD A;  3Q6D A;  3FMR A;  2GU5 A;  4IF7 A;  1WL9 A;  3CB6 A;  4U6C A;  4ZNG A;  2OAZ A;  2BB7 A;  1QXY A;  4FLK A;  2EA4 A;  3L24 A;  1O0X A;  4U6W A;  1YVM A;  4A6V A;  1PV9 A;  2BWW A;  2NQ7 A;  2BHD A;  4ZWP A;  2BWY A;  4U76 A;  3IU9 A;  4FO7 A;  4JUQ A;  5JHU A;  5D6F A;  2Q93 A;  3MX6 A;  4FO8 A;  3TAV A;  1MAT A;  4IU6 A;  4IKS A;  4FLJ A;  3TB5 A;  2GG2 A;  1KQ0 A;  5D6E A;  2EVM A;  4FLI A;  4U73 A;  5FCF A;  2EVC A;  1C21 A;  4U70 A;  2Q95 A;  3FM3 A;  2V6C A;  4PV4 A;  1B6A A;  2BWX A;  4IKT A;  3BIP A;  4U1B A;  1W2M A;  3D27 A;  2B3L A;  3PKE A;  1YW9 A;  2MAT A;  1M35 A;  4U6E A;  1WY2 A;  5CIK A;  5FCH A;  1A16 A;  2BWU A;  2BH3 A;  2GG0 A;  3MAT A;  4S00 A;  3BIT A;  4IDY A;  3L7G A;  4FUK A;  1C23 A;  1CHM A;  3PKA A;  4RGZ 1;  2BWS A;  5CNX A;  4A6W A;  2OKN A;  5CDV A;  2Q92 A;  1C24 A;  1QXW A;  4OOK A;  2ADU A;  2GU4 A;  4U75 A;  2GG9 A;  4S2T P;  4QR8 A;  4U71 A;  1KP0 A;  1XGN A;  2Q8K A;  4R60 A;  5E5B A;  4Z7M A;  1C27 A;  4FKC A;  1YW7 A;  2GGC A;  2GTX A;  2EVO A;  1WKM A;  3PKC A;  3IU8 A;  2P9A A;  1WN1 A;  4HXX A;  2GU7 A;  2G6P A;  3ROR A;  5JI6 A;  5CLS A;  1XGM A;  4RZZ A;  1Y1N A;  1BOA A;  1WL6 A;  2P99 A;  2Q96 A;  1JAW A;  1R58 A;  4EGE A;  1WBQ A;  2BHC A;  3PKB A;  1W7V A;  4IPA A;  3FMQ A;  4FLL A;  3S6B A;  1B59 A;  1XNZ A;  2GG3 A;  2V3Z A;  2BWV A;  3BIQ A;  2BHA A;  3CTZ A;  2GG7 A;  4U6Z A;  2GU6 A;  3RVA A;  5CE6 A;  1YJ3 A;  2ZSG A;  3MR1 A;  5CDL A;  1KQ9 A;  3CB5 A;  2BWT A;  5JFR A;  2BN7 A;  4U6J A;  1R5G A;  4KM3 A;  4PNC A;  4S2R P;  2GG8 A;  4U69 A;  2IW2 A;  1QZY A;  2Q94 A;  2HOW A;  2BHB A;  4B28 A;  4MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...