2EVOA

Crystal structure of methionine amino peptidase in complex with n-cyclopentyl-n-(thiazol-2-yl)oxalamide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
260
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 88
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evoA00
3TB5A 1WN1A 2GG8A 2V3ZA 4IECA 4U6EA 1WL6A 4FKCA 3MR1A 4FLKA 1WL9A 2BH3A 4IKTA 5CIKA 2B3KA 2GZ5A 2BWXA 5JHUA 4RZYA 4S00A 4A6WA 2P99A 4FO7A 1C24A 2B3HA 2V3YA 3BIPA 4OOKA 5CNXA 1JAWA 4IKUA 2GA2A 3IU7A 3IG4A 4S2RP 5CLSA 1WKMA 2Q93A 4ZNGA 2GU6A 5JFRA 2GGCA 3RORA 3FMRA 3D27A 5FCFA 1QXZA 2BWYA 4ZWUA 1B6AA 2Q92A 2GG7A 1QXYA 3CB5A 2BHDA 4HXXA 2GG5A 3CTZA 4U75A 2P9AA 4FLLA 4QR8A 2BN7A 1XGSA 1YW8A 4U76A 1XGMA 1C21A 2EA2A 2GG9A 3L7GA 3PKBA 3PKCA 1W7VA 4IKSA 4U1BA 2OKNA 5JI6A 4ZWPA 5CDVA 4U73A 3PKEA 4U6CA 2V3XA 1W2MA 3MATA 5D6EA 3FMQA 3S6BA 2HOWA 1Y1NA 3MX6A 4RZZA 1C27A 5D6FA 4S2TP 2MATA 5E5BA 3CB6A 2GG3A 1BN5A 3FM3A 1XNZA 4U70A 4U6WA 2ADUA 4U71A 3IU8A 4FLIA 2G6PA 3PKAA 2DFIA 3PKDA 1YW9A 5CDLA 1R58A 5FCHA 2V6CA 4RGZ1 3BITA 2GU7A 1CHMA 1R5HA 2NQ6A 3BIQA 2NQ7A 3TAVA 5CE6A 4Z7MA 4S01A 1O0XA 4MATA 1QXWA 4PNCA 2BHCA 3IU9A 4KM3A 4R60A 4U6JA 1A16A 2EVOA 2GGBA 3Q6DA 4FUKA 1M35A 4A6VA 4IU6A 4IKRA 2Q8KA 2B3LA 5CDEA 1KQ0A 2Q96A 2EA4A 2EVMA 2BWWA 2GU4A 1YJ3A 1XGOA 2IW2A 4EGEA 1B59A 1QZYA 4IDYA 4U6ZA 4PV4A 1YVMA 1C23A 3L24A 2GG0A 1PV9A 1XGNA 4U69A 4JUQA 2GTXA 4IF7A 2BHAA 2BWUA 1KP0A 1KQ9A 2BWVA 2Q94A 1WY2A 2GG2A 3RVAA 2EVCA 4IPAA 1WBQA 4FLJA 2BWTA 2OAZA 1R5GA 2BHBA 1C22A 1N51A 4FO8A 1MATA 2BB7A 1WLRA 2P98A 1BOAA 2GU5A 2Q95A 2BWSA 4ZWOA 4B28A 1YW7A 2ZSGA
chains in the Genus database with same CATH superfamily
3TB5A 1WN1A 2GG8A 2V3ZA 4IECA 4U6EA 1WL6A 4FKCA 3MR1A 4FLKA 1WL9A 2BH3A 4IKTA 5CIKA 2B3KA 2GZ5A 2BWXA 5JHUA 4RZYA 4S00A 4A6WA 2P99A 4FO7A 1C24A 2B3HA 2V3YA 3BIPA 4OOKA 5CNXA 1JAWA 4IKUA 2GA2A 3IU7A 3IG4A 4S2RP 5CLSA 1WKMA 2Q93A 4ZNGA 2GU6A 5JFRA 2GGCA 3RORA 3FMRA 3D27A 5FCFA 1QXZA 2BWYA 4ZWUA 1B6AA 2Q92A 2GG7A 1QXYA 3CB5A 2BHDA 4HXXA 2GG5A 3CTZA 4U75A 2P9AA 4FLLA 4QR8A 2BN7A 1XGSA 1YW8A 4U76A 1XGMA 1C21A 2EA2A 2GG9A 3L7GA 3PKBA 3PKCA 1W7VA 4IKSA 4U1BA 2OKNA 5JI6A 4ZWPA 5CDVA 4U73A 3PKEA 4U6CA 2V3XA 1W2MA 3MATA 5D6EA 3FMQA 3S6BA 2HOWA 1Y1NA 3MX6A 4RZZA 1C27A 5D6FA 4S2TP 2MATA 5E5BA 3CB6A 2GG3A 1BN5A 3FM3A 1XNZA 4U70A 4U6WA 2ADUA 4U71A 3IU8A 4FLIA 2G6PA 3PKAA 2DFIA 3PKDA 1YW9A 5CDLA 1R58A 5FCHA 2V6CA 4RGZ1 3BITA 2GU7A 1CHMA 1R5HA 2NQ6A 3BIQA 2NQ7A 3TAVA 5CE6A 4Z7MA 4S01A 1O0XA 4MATA 1QXWA 4PNCA 2BHCA 3IU9A 4KM3A 4R60A 4U6JA 1A16A 2EVOA 2GGBA 3Q6DA 4FUKA 1M35A 4A6VA 4IU6A 4IKRA 2Q8KA 2B3LA 5CDEA 1KQ0A 2Q96A 2EA4A 2EVMA 2BWWA 2GU4A 1YJ3A 1XGOA 2IW2A 4EGEA 1B59A 1QZYA 4IDYA 4U6ZA 4PV4A 1YVMA 1C23A 3L24A 2GG0A 1PV9A 1XGNA 4U69A 4JUQA 2GTXA 4IF7A 2BHAA 2BWUA 1KP0A 1KQ9A 2BWVA 2Q94A 1WY2A 2GG2A 3RVAA 2EVCA 4IPAA 1WBQA 4FLJA 2BWTA 2OAZA 1R5GA 2BHBA 1C22A 1N51A 4FO8A 1MATA 2BB7A 1WLRA 2P98A 1BOAA 2GU5A 2Q95A 2BWSA 4ZWOA 4B28A 1YW7A 2ZSGA
chains in the Genus database with same CATH topology
3TB5A 1WN1A 2GG8A 2V3ZA 4IECA 4U6EA 1WL6A 4FKCA 3MR1A 4FLKA 1WL9A 2BH3A 4IKTA 5CIKA 2B3KA 2GZ5A 2BWXA 5JHUA 4RZYA 4S00A 4A6WA 2P99A 4FO7A 1C24A 2B3HA 2V3YA 3BIPA 4OOKA 5CNXA 1JAWA 4IKUA 2GA2A 3IU7A 3IG4A 4S2RP 5CLSA 1WKMA 2Q93A 4ZNGA 2GU6A 5JFRA 2GGCA 3RORA 3FMRA 3D27A 5FCFA 1QXZA 2BWYA 4ZWUA 1B6AA 2Q92A 2GG7A 1QXYA 3CB5A 2BHDA 4HXXA 2GG5A 3CTZA 4U75A 2P9AA 4FLLA 4QR8A 2BN7A 1XGSA 1YW8A 4U76A 1XGMA 1C21A 2EA2A 2GG9A 3L7GA 3PKBA 3PKCA 1W7VA 4IKSA 4U1BA 2OKNA 5JI6A 4ZWPA 5CDVA 4U73A 3PKEA 4U6CA 2V3XA 1W2MA 3MATA 5D6EA 3FMQA 3S6BA 2HOWA 1Y1NA 3MX6A 4RZZA 1C27A 5D6FA 4S2TP 2MATA 5E5BA 3CB6A 2GG3A 1BN5A 3FM3A 1XNZA 4U70A 4U6WA 2ADUA 4U71A 3IU8A 4FLIA 2G6PA 3PKAA 2DFIA 3PKDA 1YW9A 5CDLA 1R58A 5FCHA 2V6CA 4RGZ1 3BITA 2GU7A 1CHMA 1R5HA 2NQ6A 3BIQA 2NQ7A 3TAVA 5CE6A 4Z7MA 4S01A 1O0XA 4MATA 1QXWA 4PNCA 2BHCA 3IU9A 4KM3A 4R60A 4U6JA 1A16A 2EVOA 2GGBA 3Q6DA 4FUKA 1M35A 4A6VA 4IU6A 4IKRA 2Q8KA 2B3LA 5CDEA 1KQ0A 2Q96A 2EA4A 2EVMA 2BWWA 2GU4A 1YJ3A 1XGOA 2IW2A 4EGEA 1B59A 1QZYA 4IDYA 4U6ZA 4PV4A 1YVMA 1C23A 3L24A 2GG0A 1PV9A 1XGNA 4U69A 4JUQA 2GTXA 4IF7A 2BHAA 2BWUA 1KP0A 1KQ9A 2BWVA 2Q94A 1WY2A 2GG2A 3RVAA 2EVCA 4IPAA 1WBQA 4FLJA 2BWTA 2OAZA 1R5GA 2BHBA 1C22A 1N51A 4FO8A 1MATA 2BB7A 1WLRA 2P98A 1BOAA 2GU5A 2Q95A 2BWSA 4ZWOA 4B28A 1YW7A 2ZSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TB5 A;  1WN1 A;  2GG8 A;  2V3Z A;  4IEC A;  4U6E A;  1WL6 A;  4FKC A;  3MR1 A;  4FLK A;  1WL9 A;  2BH3 A;  4IKT A;  5CIK A;  2B3K A;  2GZ5 A;  2BWX A;  5JHU A;  4RZY A;  4S00 A;  4A6W A;  2P99 A;  4FO7 A;  1C24 A;  2B3H A;  2V3Y A;  3BIP A;  4OOK A;  5CNX A;  1JAW A;  4IKU A;  2GA2 A;  3IU7 A;  3IG4 A;  4S2R P;  5CLS A;  1WKM A;  2Q93 A;  4ZNG A;  2GU6 A;  5JFR A;  2GGC A;  3ROR A;  3FMR A;  3D27 A;  5FCF A;  1QXZ A;  2BWY A;  4ZWU A;  1B6A A;  2Q92 A;  2GG7 A;  1QXY A;  3CB5 A;  2BHD A;  4HXX A;  2GG5 A;  3CTZ A;  4U75 A;  2P9A A;  4FLL A;  4QR8 A;  2BN7 A;  1XGS A;  1YW8 A;  4U76 A;  1XGM A;  1C21 A;  2EA2 A;  2GG9 A;  3L7G A;  3PKB A;  3PKC A;  1W7V A;  4IKS A;  4U1B A;  2OKN A;  5JI6 A;  4ZWP A;  5CDV A;  4U73 A;  3PKE A;  4U6C A;  2V3X A;  1W2M A;  3MAT A;  5D6E A;  3FMQ A;  3S6B A;  2HOW A;  1Y1N A;  3MX6 A;  4RZZ A;  1C27 A;  5D6F A;  4S2T P;  2MAT A;  5E5B A;  3CB6 A;  2GG3 A;  1BN5 A;  3FM3 A;  1XNZ A;  4U70 A;  4U6W A;  2ADU A;  4U71 A;  3IU8 A;  4FLI A;  2G6P A;  3PKA A;  2DFI A;  3PKD A;  1YW9 A;  5CDL A;  1R58 A;  5FCH A;  2V6C A;  4RGZ 1;  3BIT A;  2GU7 A;  1CHM A;  1R5H A;  2NQ6 A;  3BIQ A;  2NQ7 A;  3TAV A;  5CE6 A;  4Z7M A;  4S01 A;  1O0X A;  4MAT A;  1QXW A;  4PNC A;  2BHC A;  3IU9 A;  4KM3 A;  4R60 A;  4U6J A;  1A16 A;  2EVO A;  2GGB A;  3Q6D A;  4FUK A;  1M35 A;  4A6V A;  4IU6 A;  4IKR A;  2Q8K A;  2B3L A;  5CDE A;  1KQ0 A;  2Q96 A;  2EA4 A;  2EVM A;  2BWW A;  2GU4 A;  1YJ3 A;  1XGO A;  2IW2 A;  4EGE A;  1B59 A;  1QZY A;  4IDY A;  4U6Z A;  4PV4 A;  1YVM A;  1C23 A;  3L24 A;  2GG0 A;  1PV9 A;  1XGN A;  4U69 A;  4JUQ A;  2GTX A;  4IF7 A;  2BHA A;  2BWU A;  1KP0 A;  1KQ9 A;  2BWV A;  2Q94 A;  1WY2 A;  2GG2 A;  3RVA A;  2EVC A;  4IPA A;  1WBQ A;  4FLJ A;  2BWT A;  2OAZ A;  1R5G A;  2BHB A;  1C22 A;  1N51 A;  4FO8 A;  1MAT A;  2BB7 A;  1WLR A;  2P98 A;  1BOA A;  2GU5 A;  2Q95 A;  2BWS A;  4ZWO A;  4B28 A;  1YW7 A;  2ZSG A; 
#chains in the Genus database with same CATH topology
 3TB5 A;  1WN1 A;  2GG8 A;  2V3Z A;  4IEC A;  4U6E A;  1WL6 A;  4FKC A;  3MR1 A;  4FLK A;  1WL9 A;  2BH3 A;  4IKT A;  5CIK A;  2B3K A;  2GZ5 A;  2BWX A;  5JHU A;  4RZY A;  4S00 A;  4A6W A;  2P99 A;  4FO7 A;  1C24 A;  2B3H A;  2V3Y A;  3BIP A;  4OOK A;  5CNX A;  1JAW A;  4IKU A;  2GA2 A;  3IU7 A;  3IG4 A;  4S2R P;  5CLS A;  1WKM A;  2Q93 A;  4ZNG A;  2GU6 A;  5JFR A;  2GGC A;  3ROR A;  3FMR A;  3D27 A;  5FCF A;  1QXZ A;  2BWY A;  4ZWU A;  1B6A A;  2Q92 A;  2GG7 A;  1QXY A;  3CB5 A;  2BHD A;  4HXX A;  2GG5 A;  3CTZ A;  4U75 A;  2P9A A;  4FLL A;  4QR8 A;  2BN7 A;  1XGS A;  1YW8 A;  4U76 A;  1XGM A;  1C21 A;  2EA2 A;  2GG9 A;  3L7G A;  3PKB A;  3PKC A;  1W7V A;  4IKS A;  4U1B A;  2OKN A;  5JI6 A;  4ZWP A;  5CDV A;  4U73 A;  3PKE A;  4U6C A;  2V3X A;  1W2M A;  3MAT A;  5D6E A;  3FMQ A;  3S6B A;  2HOW A;  1Y1N A;  3MX6 A;  4RZZ A;  1C27 A;  5D6F A;  4S2T P;  2MAT A;  5E5B A;  3CB6 A;  2GG3 A;  1BN5 A;  3FM3 A;  1XNZ A;  4U70 A;  4U6W A;  2ADU A;  4U71 A;  3IU8 A;  4FLI A;  2G6P A;  3PKA A;  2DFI A;  3PKD A;  1YW9 A;  5CDL A;  1R58 A;  5FCH A;  2V6C A;  4RGZ 1;  3BIT A;  2GU7 A;  1CHM A;  1R5H A;  2NQ6 A;  3BIQ A;  2NQ7 A;  3TAV A;  5CE6 A;  4Z7M A;  4S01 A;  1O0X A;  4MAT A;  1QXW A;  4PNC A;  2BHC A;  3IU9 A;  4KM3 A;  4R60 A;  4U6J A;  1A16 A;  2EVO A;  2GGB A;  3Q6D A;  4FUK A;  1M35 A;  4A6V A;  4IU6 A;  4IKR A;  2Q8K A;  2B3L A;  5CDE A;  1KQ0 A;  2Q96 A;  2EA4 A;  2EVM A;  2BWW A;  2GU4 A;  1YJ3 A;  1XGO A;  2IW2 A;  4EGE A;  1B59 A;  1QZY A;  4IDY A;  4U6Z A;  4PV4 A;  1YVM A;  1C23 A;  3L24 A;  2GG0 A;  1PV9 A;  1XGN A;  4U69 A;  4JUQ A;  2GTX A;  4IF7 A;  2BHA A;  2BWU A;  1KP0 A;  1KQ9 A;  2BWV A;  2Q94 A;  1WY2 A;  2GG2 A;  3RVA A;  2EVC A;  4IPA A;  1WBQ A;  4FLJ A;  2BWT A;  2OAZ A;  1R5G A;  2BHB A;  1C22 A;  1N51 A;  4FO8 A;  1MAT A;  2BB7 A;  1WLR A;  2P98 A;  1BOA A;  2GU5 A;  2Q95 A;  2BWS A;  4ZWO A;  4B28 A;  1YW7 A;  2ZSG A; 
#chains in the Genus database with same CATH homology
 3TB5 A;  1WN1 A;  2GG8 A;  2V3Z A;  4IEC A;  4U6E A;  1WL6 A;  4FKC A;  3MR1 A;  4FLK A;  1WL9 A;  2BH3 A;  4IKT A;  5CIK A;  2B3K A;  2GZ5 A;  2BWX A;  5JHU A;  4RZY A;  4S00 A;  4A6W A;  2P99 A;  4FO7 A;  1C24 A;  2B3H A;  2V3Y A;  3BIP A;  4OOK A;  5CNX A;  1JAW A;  4IKU A;  2GA2 A;  3IU7 A;  3IG4 A;  4S2R P;  5CLS A;  1WKM A;  2Q93 A;  4ZNG A;  2GU6 A;  5JFR A;  2GGC A;  3ROR A;  3FMR A;  3D27 A;  5FCF A;  1QXZ A;  2BWY A;  4ZWU A;  1B6A A;  2Q92 A;  2GG7 A;  1QXY A;  3CB5 A;  2BHD A;  4HXX A;  2GG5 A;  3CTZ A;  4U75 A;  2P9A A;  4FLL A;  4QR8 A;  2BN7 A;  1XGS A;  1YW8 A;  4U76 A;  1XGM A;  1C21 A;  2EA2 A;  2GG9 A;  3L7G A;  3PKB A;  3PKC A;  1W7V A;  4IKS A;  4U1B A;  2OKN A;  5JI6 A;  4ZWP A;  5CDV A;  4U73 A;  3PKE A;  4U6C A;  2V3X A;  1W2M A;  3MAT A;  5D6E A;  3FMQ A;  3S6B A;  2HOW A;  1Y1N A;  3MX6 A;  4RZZ A;  1C27 A;  5D6F A;  4S2T P;  2MAT A;  5E5B A;  3CB6 A;  2GG3 A;  1BN5 A;  3FM3 A;  1XNZ A;  4U70 A;  4U6W A;  2ADU A;  4U71 A;  3IU8 A;  4FLI A;  2G6P A;  3PKA A;  2DFI A;  3PKD A;  1YW9 A;  5CDL A;  1R58 A;  5FCH A;  2V6C A;  4RGZ 1;  3BIT A;  2GU7 A;  1CHM A;  1R5H A;  2NQ6 A;  3BIQ A;  2NQ7 A;  3TAV A;  5CE6 A;  4Z7M A;  4S01 A;  1O0X A;  4MAT A;  1QXW A;  4PNC A;  2BHC A;  3IU9 A;  4KM3 A;  4R60 A;  4U6J A;  1A16 A;  2EVO A;  2GGB A;  3Q6D A;  4FUK A;  1M35 A;  4A6V A;  4IU6 A;  4IKR A;  2Q8K A;  2B3L A;  5CDE A;  1KQ0 A;  2Q96 A;  2EA4 A;  2EVM A;  2BWW A;  2GU4 A;  1YJ3 A;  1XGO A;  2IW2 A;  4EGE A;  1B59 A;  1QZY A;  4IDY A;  4U6Z A;  4PV4 A;  1YVM A;  1C23 A;  3L24 A;  2GG0 A;  1PV9 A;  1XGN A;  4U69 A;  4JUQ A;  2GTX A;  4IF7 A;  2BHA A;  2BWU A;  1KP0 A;  1KQ9 A;  2BWV A;  2Q94 A;  1WY2 A;  2GG2 A;  3RVA A;  2EVC A;  4IPA A;  1WBQ A;  4FLJ A;  2BWT A;  2OAZ A;  1R5G A;  2BHB A;  1C22 A;  1N51 A;  4FO8 A;  1MAT A;  2BB7 A;  1WLR A;  2P98 A;  1BOA A;  2GU5 A;  2Q95 A;  2BWS A;  4ZWO A;  4B28 A;  1YW7 A;  2ZSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...