2EVOA

Crystal structure of methionine amino peptidase in complex with n-cyclopentyl-n-(thiazol-2-yl)oxalamide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
260
Chain Sequence
b'SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
molecule tags Hydrolase
source organism Escherichia coli
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
total genus 88
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evoA00
4U6WA 5CDEA 1M35A 2EVOA 2GG8A 3FMRA 3BIQA 5JFRA 2GGCA 1YW7A 5CIKA 1WKMA 2GU6A 4IKSA 2GTXA 4EGEA 4U6ZA 3IG4A 1C22A 2Q95A 3PKAA 3MR1A 4FUKA 2IW2A 5D6EA 5CDVA 1WLRA 5JHUA 1KP0A 2BHDA 4IKUA 4ZWUA 3IU9A 4FO8A 3BITA 3S6BA 3PKEA 1XNZA 2BHCA 4S2TP 2B3KA 1W2MA 2OAZA 4IKTA 4IDYA 3TB5A 2Q92A 4FO7A 1B6AA 1QZYA 2Q93A 4IU6A 4A6WA 2BWYA 2V3ZA 2G6PA 4S01A 1WL6A 2BWWA 3Q6DA 5CNXA 4U6JA 3RVAA 1WY2A 1QXYA 2HOWA 2BWSA 2P9AA 4IKRA 4U69A 4U70A 3D27A 1C27A 3PKBA 2GG0A 4FLLA 2MATA 3BIPA 2EVCA 4MATA 1R58A 1MATA 1B59A 2GG5A 5FCHA 4FLIA 1XGOA 2BN7A 3PKCA 3FMQA 1R5GA 4Z7MA 1WBQA 2GG9A 3CTZA 4IF7A 1WL9A 2GG7A 2Q94A 2V3YA 2ADUA 1YW8A 1C21A 2EVMA 4PV4A 4IPAA 4U71A 3L24A 4U76A 1YJ3A 4KM3A 5CDLA 1C24A 4FKCA 3CB6A 2GG2A 2GU4A 2B3LA 4PNCA 4FLJA 1CHMA 1O0XA 2BWUA 4QR8A 2P98A 4ZWOA 2V6CA 2GG3A 2BB7A 4U6CA 2BHBA 4A6VA 3RORA 4U73A 2Q96A 2GU5A 4R60A 3MATA 4RGZ1 4RZYA 5FCFA 1KQ9A 4HXXA 1QXZA 2BHAA 4U1BA 2NQ6A 2GGBA 4FLKA 2BWTA 1PV9A 2GU7A 1BN5A 3PKDA 2BWXA 2B3HA 1XGNA 3IU7A 1Y1NA 2P99A 2EA2A 1KQ0A 2BH3A 2V3XA 1JAWA 2OKNA 1A16A 4IECA 4B28A 4U75A 4ZNGA 2BWVA 2Q8KA 1QXWA 1BOAA 4U6EA 3FM3A 1N51A 5E5BA 2ZSGA 3MX6A 1YVMA 3TAVA 2EA4A 4OOKA 4ZWPA 1YW9A 2GZ5A 5CE6A 1XGMA 1W7VA 3CB5A 3L7GA 1C23A 4S00A 1WN1A 2DFIA 4S2RP 5CLSA 4RZZA 5D6FA 1XGSA 2GA2A 2NQ7A 1R5HA 3IU8A 5JI6A 4JUQA
chains in the Genus database with same CATH superfamily
4U6WA 5CDEA 1M35A 2EVOA 2GG8A 3FMRA 3BIQA 5JFRA 2GGCA 1YW7A 5CIKA 1WKMA 2GU6A 4IKSA 2GTXA 4EGEA 4U6ZA 3IG4A 1C22A 2Q95A 3PKAA 3MR1A 4FUKA 2IW2A 5D6EA 5CDVA 1WLRA 5JHUA 1KP0A 2BHDA 4IKUA 4ZWUA 3IU9A 4FO8A 3BITA 3S6BA 3PKEA 1XNZA 2BHCA 4S2TP 2B3KA 1W2MA 2OAZA 4IKTA 4IDYA 3TB5A 2Q92A 4FO7A 1B6AA 1QZYA 2Q93A 4IU6A 4A6WA 2BWYA 2V3ZA 2G6PA 4S01A 1WL6A 2BWWA 3Q6DA 5CNXA 4U6JA 3RVAA 1WY2A 1QXYA 2HOWA 2BWSA 2P9AA 4IKRA 4U69A 4U70A 3D27A 1C27A 3PKBA 2GG0A 4FLLA 2MATA 3BIPA 2EVCA 4MATA 1R58A 1MATA 1B59A 2GG5A 5FCHA 4FLIA 1XGOA 2BN7A 3PKCA 3FMQA 1R5GA 4Z7MA 1WBQA 2GG9A 3CTZA 4IF7A 1WL9A 2GG7A 2Q94A 2V3YA 2ADUA 1YW8A 1C21A 2EVMA 4PV4A 4IPAA 4U71A 3L24A 4U76A 1YJ3A 4KM3A 5CDLA 1C24A 4FKCA 3CB6A 2GG2A 2GU4A 2B3LA 4PNCA 4FLJA 1CHMA 1O0XA 2BWUA 4QR8A 2P98A 4ZWOA 2V6CA 2GG3A 2BB7A 4U6CA 2BHBA 4A6VA 3RORA 4U73A 2Q96A 2GU5A 4R60A 3MATA 4RGZ1 4RZYA 5FCFA 1KQ9A 4HXXA 1QXZA 2BHAA 4U1BA 2NQ6A 2GGBA 4FLKA 2BWTA 1PV9A 2GU7A 1BN5A 3PKDA 2BWXA 2B3HA 1XGNA 3IU7A 1Y1NA 2P99A 2EA2A 1KQ0A 2BH3A 2V3XA 1JAWA 2OKNA 1A16A 4IECA 4B28A 4U75A 4ZNGA 2BWVA 2Q8KA 1QXWA 1BOAA 4U6EA 3FM3A 1N51A 5E5BA 2ZSGA 3MX6A 1YVMA 3TAVA 2EA4A 4OOKA 4ZWPA 1YW9A 2GZ5A 5CE6A 1XGMA 1W7VA 3CB5A 3L7GA 1C23A 4S00A 1WN1A 2DFIA 4S2RP 5CLSA 4RZZA 5D6FA 1XGSA 2GA2A 2NQ7A 1R5HA 3IU8A 5JI6A 4JUQA
chains in the Genus database with same CATH topology
4U6WA 5CDEA 1M35A 2EVOA 2GG8A 3FMRA 3BIQA 5JFRA 2GGCA 1YW7A 5CIKA 1WKMA 2GU6A 4IKSA 2GTXA 4EGEA 4U6ZA 3IG4A 1C22A 2Q95A 3PKAA 3MR1A 4FUKA 2IW2A 5D6EA 5CDVA 1WLRA 5JHUA 1KP0A 2BHDA 4IKUA 4ZWUA 3IU9A 4FO8A 3BITA 3S6BA 3PKEA 1XNZA 2BHCA 4S2TP 2B3KA 1W2MA 2OAZA 4IKTA 4IDYA 3TB5A 2Q92A 4FO7A 1B6AA 1QZYA 2Q93A 4IU6A 4A6WA 2BWYA 2V3ZA 2G6PA 4S01A 1WL6A 2BWWA 3Q6DA 5CNXA 4U6JA 3RVAA 1WY2A 1QXYA 2HOWA 2BWSA 2P9AA 4IKRA 4U69A 4U70A 3D27A 1C27A 3PKBA 2GG0A 4FLLA 2MATA 3BIPA 2EVCA 4MATA 1R58A 1MATA 1B59A 2GG5A 5FCHA 4FLIA 1XGOA 2BN7A 3PKCA 3FMQA 1R5GA 4Z7MA 1WBQA 2GG9A 3CTZA 4IF7A 1WL9A 2GG7A 2Q94A 2V3YA 2ADUA 1YW8A 1C21A 2EVMA 4PV4A 4IPAA 4U71A 3L24A 4U76A 1YJ3A 4KM3A 5CDLA 1C24A 4FKCA 3CB6A 2GG2A 2GU4A 2B3LA 4PNCA 4FLJA 1CHMA 1O0XA 2BWUA 4QR8A 2P98A 4ZWOA 2V6CA 2GG3A 2BB7A 4U6CA 2BHBA 4A6VA 3RORA 4U73A 2Q96A 2GU5A 4R60A 3MATA 4RGZ1 4RZYA 5FCFA 1KQ9A 4HXXA 1QXZA 2BHAA 4U1BA 2NQ6A 2GGBA 4FLKA 2BWTA 1PV9A 2GU7A 1BN5A 3PKDA 2BWXA 2B3HA 1XGNA 3IU7A 1Y1NA 2P99A 2EA2A 1KQ0A 2BH3A 2V3XA 1JAWA 2OKNA 1A16A 4IECA 4B28A 4U75A 4ZNGA 2BWVA 2Q8KA 1QXWA 1BOAA 4U6EA 3FM3A 1N51A 5E5BA 2ZSGA 3MX6A 1YVMA 3TAVA 2EA4A 4OOKA 4ZWPA 1YW9A 2GZ5A 5CE6A 1XGMA 1W7VA 3CB5A 3L7GA 1C23A 4S00A 1WN1A 2DFIA 4S2RP 5CLSA 4RZZA 5D6FA 1XGSA 2GA2A 2NQ7A 1R5HA 3IU8A 5JI6A 4JUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6W A;  5CDE A;  1M35 A;  2EVO A;  2GG8 A;  3FMR A;  3BIQ A;  5JFR A;  2GGC A;  1YW7 A;  5CIK A;  1WKM A;  2GU6 A;  4IKS A;  2GTX A;  4EGE A;  4U6Z A;  3IG4 A;  1C22 A;  2Q95 A;  3PKA A;  3MR1 A;  4FUK A;  2IW2 A;  5D6E A;  5CDV A;  1WLR A;  5JHU A;  1KP0 A;  2BHD A;  4IKU A;  4ZWU A;  3IU9 A;  4FO8 A;  3BIT A;  3S6B A;  3PKE A;  1XNZ A;  2BHC A;  4S2T P;  2B3K A;  1W2M A;  2OAZ A;  4IKT A;  4IDY A;  3TB5 A;  2Q92 A;  4FO7 A;  1B6A A;  1QZY A;  2Q93 A;  4IU6 A;  4A6W A;  2BWY A;  2V3Z A;  2G6P A;  4S01 A;  1WL6 A;  2BWW A;  3Q6D A;  5CNX A;  4U6J A;  3RVA A;  1WY2 A;  1QXY A;  2HOW A;  2BWS A;  2P9A A;  4IKR A;  4U69 A;  4U70 A;  3D27 A;  1C27 A;  3PKB A;  2GG0 A;  4FLL A;  2MAT A;  3BIP A;  2EVC A;  4MAT A;  1R58 A;  1MAT A;  1B59 A;  2GG5 A;  5FCH A;  4FLI A;  1XGO A;  2BN7 A;  3PKC A;  3FMQ A;  1R5G A;  4Z7M A;  1WBQ A;  2GG9 A;  3CTZ A;  4IF7 A;  1WL9 A;  2GG7 A;  2Q94 A;  2V3Y A;  2ADU A;  1YW8 A;  1C21 A;  2EVM A;  4PV4 A;  4IPA A;  4U71 A;  3L24 A;  4U76 A;  1YJ3 A;  4KM3 A;  5CDL A;  1C24 A;  4FKC A;  3CB6 A;  2GG2 A;  2GU4 A;  2B3L A;  4PNC A;  4FLJ A;  1CHM A;  1O0X A;  2BWU A;  4QR8 A;  2P98 A;  4ZWO A;  2V6C A;  2GG3 A;  2BB7 A;  4U6C A;  2BHB A;  4A6V A;  3ROR A;  4U73 A;  2Q96 A;  2GU5 A;  4R60 A;  3MAT A;  4RGZ 1;  4RZY A;  5FCF A;  1KQ9 A;  4HXX A;  1QXZ A;  2BHA A;  4U1B A;  2NQ6 A;  2GGB A;  4FLK A;  2BWT A;  1PV9 A;  2GU7 A;  1BN5 A;  3PKD A;  2BWX A;  2B3H A;  1XGN A;  3IU7 A;  1Y1N A;  2P99 A;  2EA2 A;  1KQ0 A;  2BH3 A;  2V3X A;  1JAW A;  2OKN A;  1A16 A;  4IEC A;  4B28 A;  4U75 A;  4ZNG A;  2BWV A;  2Q8K A;  1QXW A;  1BOA A;  4U6E A;  3FM3 A;  1N51 A;  5E5B A;  2ZSG A;  3MX6 A;  1YVM A;  3TAV A;  2EA4 A;  4OOK A;  4ZWP A;  1YW9 A;  2GZ5 A;  5CE6 A;  1XGM A;  1W7V A;  3CB5 A;  3L7G A;  1C23 A;  4S00 A;  1WN1 A;  2DFI A;  4S2R P;  5CLS A;  4RZZ A;  5D6F A;  1XGS A;  2GA2 A;  2NQ7 A;  1R5H A;  3IU8 A;  5JI6 A;  4JUQ A; 
#chains in the Genus database with same CATH topology
 4U6W A;  5CDE A;  1M35 A;  2EVO A;  2GG8 A;  3FMR A;  3BIQ A;  5JFR A;  2GGC A;  1YW7 A;  5CIK A;  1WKM A;  2GU6 A;  4IKS A;  2GTX A;  4EGE A;  4U6Z A;  3IG4 A;  1C22 A;  2Q95 A;  3PKA A;  3MR1 A;  4FUK A;  2IW2 A;  5D6E A;  5CDV A;  1WLR A;  5JHU A;  1KP0 A;  2BHD A;  4IKU A;  4ZWU A;  3IU9 A;  4FO8 A;  3BIT A;  3S6B A;  3PKE A;  1XNZ A;  2BHC A;  4S2T P;  2B3K A;  1W2M A;  2OAZ A;  4IKT A;  4IDY A;  3TB5 A;  2Q92 A;  4FO7 A;  1B6A A;  1QZY A;  2Q93 A;  4IU6 A;  4A6W A;  2BWY A;  2V3Z A;  2G6P A;  4S01 A;  1WL6 A;  2BWW A;  3Q6D A;  5CNX A;  4U6J A;  3RVA A;  1WY2 A;  1QXY A;  2HOW A;  2BWS A;  2P9A A;  4IKR A;  4U69 A;  4U70 A;  3D27 A;  1C27 A;  3PKB A;  2GG0 A;  4FLL A;  2MAT A;  3BIP A;  2EVC A;  4MAT A;  1R58 A;  1MAT A;  1B59 A;  2GG5 A;  5FCH A;  4FLI A;  1XGO A;  2BN7 A;  3PKC A;  3FMQ A;  1R5G A;  4Z7M A;  1WBQ A;  2GG9 A;  3CTZ A;  4IF7 A;  1WL9 A;  2GG7 A;  2Q94 A;  2V3Y A;  2ADU A;  1YW8 A;  1C21 A;  2EVM A;  4PV4 A;  4IPA A;  4U71 A;  3L24 A;  4U76 A;  1YJ3 A;  4KM3 A;  5CDL A;  1C24 A;  4FKC A;  3CB6 A;  2GG2 A;  2GU4 A;  2B3L A;  4PNC A;  4FLJ A;  1CHM A;  1O0X A;  2BWU A;  4QR8 A;  2P98 A;  4ZWO A;  2V6C A;  2GG3 A;  2BB7 A;  4U6C A;  2BHB A;  4A6V A;  3ROR A;  4U73 A;  2Q96 A;  2GU5 A;  4R60 A;  3MAT A;  4RGZ 1;  4RZY A;  5FCF A;  1KQ9 A;  4HXX A;  1QXZ A;  2BHA A;  4U1B A;  2NQ6 A;  2GGB A;  4FLK A;  2BWT A;  1PV9 A;  2GU7 A;  1BN5 A;  3PKD A;  2BWX A;  2B3H A;  1XGN A;  3IU7 A;  1Y1N A;  2P99 A;  2EA2 A;  1KQ0 A;  2BH3 A;  2V3X A;  1JAW A;  2OKN A;  1A16 A;  4IEC A;  4B28 A;  4U75 A;  4ZNG A;  2BWV A;  2Q8K A;  1QXW A;  1BOA A;  4U6E A;  3FM3 A;  1N51 A;  5E5B A;  2ZSG A;  3MX6 A;  1YVM A;  3TAV A;  2EA4 A;  4OOK A;  4ZWP A;  1YW9 A;  2GZ5 A;  5CE6 A;  1XGM A;  1W7V A;  3CB5 A;  3L7G A;  1C23 A;  4S00 A;  1WN1 A;  2DFI A;  4S2R P;  5CLS A;  4RZZ A;  5D6F A;  1XGS A;  2GA2 A;  2NQ7 A;  1R5H A;  3IU8 A;  5JI6 A;  4JUQ A; 
#chains in the Genus database with same CATH homology
 4U6W A;  5CDE A;  1M35 A;  2EVO A;  2GG8 A;  3FMR A;  3BIQ A;  5JFR A;  2GGC A;  1YW7 A;  5CIK A;  1WKM A;  2GU6 A;  4IKS A;  2GTX A;  4EGE A;  4U6Z A;  3IG4 A;  1C22 A;  2Q95 A;  3PKA A;  3MR1 A;  4FUK A;  2IW2 A;  5D6E A;  5CDV A;  1WLR A;  5JHU A;  1KP0 A;  2BHD A;  4IKU A;  4ZWU A;  3IU9 A;  4FO8 A;  3BIT A;  3S6B A;  3PKE A;  1XNZ A;  2BHC A;  4S2T P;  2B3K A;  1W2M A;  2OAZ A;  4IKT A;  4IDY A;  3TB5 A;  2Q92 A;  4FO7 A;  1B6A A;  1QZY A;  2Q93 A;  4IU6 A;  4A6W A;  2BWY A;  2V3Z A;  2G6P A;  4S01 A;  1WL6 A;  2BWW A;  3Q6D A;  5CNX A;  4U6J A;  3RVA A;  1WY2 A;  1QXY A;  2HOW A;  2BWS A;  2P9A A;  4IKR A;  4U69 A;  4U70 A;  3D27 A;  1C27 A;  3PKB A;  2GG0 A;  4FLL A;  2MAT A;  3BIP A;  2EVC A;  4MAT A;  1R58 A;  1MAT A;  1B59 A;  2GG5 A;  5FCH A;  4FLI A;  1XGO A;  2BN7 A;  3PKC A;  3FMQ A;  1R5G A;  4Z7M A;  1WBQ A;  2GG9 A;  3CTZ A;  4IF7 A;  1WL9 A;  2GG7 A;  2Q94 A;  2V3Y A;  2ADU A;  1YW8 A;  1C21 A;  2EVM A;  4PV4 A;  4IPA A;  4U71 A;  3L24 A;  4U76 A;  1YJ3 A;  4KM3 A;  5CDL A;  1C24 A;  4FKC A;  3CB6 A;  2GG2 A;  2GU4 A;  2B3L A;  4PNC A;  4FLJ A;  1CHM A;  1O0X A;  2BWU A;  4QR8 A;  2P98 A;  4ZWO A;  2V6C A;  2GG3 A;  2BB7 A;  4U6C A;  2BHB A;  4A6V A;  3ROR A;  4U73 A;  2Q96 A;  2GU5 A;  4R60 A;  3MAT A;  4RGZ 1;  4RZY A;  5FCF A;  1KQ9 A;  4HXX A;  1QXZ A;  2BHA A;  4U1B A;  2NQ6 A;  2GGB A;  4FLK A;  2BWT A;  1PV9 A;  2GU7 A;  1BN5 A;  3PKD A;  2BWX A;  2B3H A;  1XGN A;  3IU7 A;  1Y1N A;  2P99 A;  2EA2 A;  1KQ0 A;  2BH3 A;  2V3X A;  1JAW A;  2OKN A;  1A16 A;  4IEC A;  4B28 A;  4U75 A;  4ZNG A;  2BWV A;  2Q8K A;  1QXW A;  1BOA A;  4U6E A;  3FM3 A;  1N51 A;  5E5B A;  2ZSG A;  3MX6 A;  1YVM A;  3TAV A;  2EA4 A;  4OOK A;  4ZWP A;  1YW9 A;  2GZ5 A;  5CE6 A;  1XGM A;  1W7V A;  3CB5 A;  3L7G A;  1C23 A;  4S00 A;  1WN1 A;  2DFI A;  4S2R P;  5CLS A;  4RZZ A;  5D6F A;  1XGS A;  2GA2 A;  2NQ7 A;  1R5H A;  3IU8 A;  5JI6 A;  4JUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...