2EVOA

Crystal structure of methionine amino peptidase in complex with n-cyclopentyl-n-(thiazol-2-yl)oxalamide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
260
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evoA00
1JAWA 2GU5A 3PKEA 4IU6A 2EVCA 5CLSA 3CB5A 3RVAA 1KQ9A 2G6PA 2NQ7A 3MATA 1KP0A 4IF7A 2P9AA 4IECA 1QZYA 1WL6A 2Q92A 3CTZA 3BITA 4JUQA 5CDLA 2B3LA 1QXYA 1KQ0A 1R5HA 2GU7A 4HXXA 4U70A 1R58A 2B3HA 2BB7A 2HOWA 4U71A 2BN7A 2OKNA 4S01A 2MATA 1R5GA 5D6EA 4ZWOA 1YW8A 3IU7A 3L24A 4U73A 1C22A 5CDEA 2BWVA 1WY2A 2BWYA 2GG3A 1XGSA 2V3YA 4FUKA 1YJ3A 2BHBA 3IU8A 4IDYA 4IKRA 3FM3A 1O0XA 2BHDA 2V3XA 2BWSA 4IKUA 4PNCA 2EA4A 3IU9A 1W2MA 2GG2A 2P99A 1WLRA 2P98A 4PV4A 2GZ5A 3BIQA 1QXZA 2Q93A 4FLLA 4S2TP 2IW2A 4IKSA 2NQ6A 1W7VA 2B3KA 3MX6A 4FO8A 4S2RP 2BH3A 2GG8A 5FCFA 3PKAA 1MATA 2V3ZA 4U69A 2EVMA 1XGNA 3PKBA 1YW7A 1M35A 4U6CA 2EA2A 2GTXA 4U6WA 1C21A 2BHAA 2OAZA 2Q95A 4RGZ1 5JHUA 2DFIA 1CHMA 3FMQA 4A6VA 1WN1A 3FMRA 5E5BA 5JI6A 4ZWUA 1QXWA 1A16A 1WL9A 1YW9A 4MATA 2BWXA 1C24A 5D6FA 4R60A 2EVOA 1WBQA 4ZWPA 1N51A 4OOKA 1WKMA 1C27A 1BN5A 3D27A 4U6EA 4B28A 4Z7MA 5CDVA 3MR1A 2V6CA 5JFRA 2GG5A 4ZNGA 3S6BA 1YVMA 2GU6A 4U6JA 3TB5A 4EGEA 1Y1NA 1XNZA 5FCHA 4FO7A 2BHCA 1B59A 1C23A 2GG7A 3IG4A 4QR8A 1PV9A 4FKCA 3L7GA 3TAVA 2BWWA 3BIPA 2GG0A 4FLIA 1XGMA 2Q94A 4S00A 4U75A 4RZZA 1XGOA 2BWUA 4FLJA 4IKTA 3PKCA 2ZSGA 3Q6DA 2ADUA 2Q96A 3CB6A 2Q8KA 4RZYA 4U6ZA 5CIKA 2GGBA 4U1BA 2BWTA 5CNXA 4A6WA 2GG9A 5CE6A 4U76A 1BOAA 1B6AA 4IPAA 4KM3A 2GA2A 3PKDA 3RORA 4FLKA 2GGCA 2GU4A
chains in the Genus database with same CATH superfamily
1JAWA 2GU5A 3PKEA 4IU6A 2EVCA 5CLSA 3CB5A 3RVAA 1KQ9A 2G6PA 2NQ7A 3MATA 1KP0A 4IF7A 2P9AA 4IECA 1QZYA 1WL6A 2Q92A 3CTZA 3BITA 4JUQA 5CDLA 2B3LA 1QXYA 1KQ0A 1R5HA 2GU7A 4HXXA 4U70A 1R58A 2B3HA 2BB7A 2HOWA 4U71A 2BN7A 2OKNA 4S01A 2MATA 1R5GA 5D6EA 4ZWOA 1YW8A 3IU7A 3L24A 4U73A 1C22A 5CDEA 2BWVA 1WY2A 2BWYA 2GG3A 1XGSA 2V3YA 4FUKA 1YJ3A 2BHBA 3IU8A 4IDYA 4IKRA 3FM3A 1O0XA 2BHDA 2V3XA 2BWSA 4IKUA 4PNCA 2EA4A 3IU9A 1W2MA 2GG2A 2P99A 1WLRA 2P98A 4PV4A 2GZ5A 3BIQA 1QXZA 2Q93A 4FLLA 4S2TP 2IW2A 4IKSA 2NQ6A 1W7VA 2B3KA 3MX6A 4FO8A 4S2RP 2BH3A 2GG8A 5FCFA 3PKAA 1MATA 2V3ZA 4U69A 2EVMA 1XGNA 3PKBA 1YW7A 1M35A 4U6CA 2EA2A 2GTXA 4U6WA 1C21A 2BHAA 2OAZA 2Q95A 4RGZ1 5JHUA 2DFIA 1CHMA 3FMQA 4A6VA 1WN1A 3FMRA 5E5BA 5JI6A 4ZWUA 1QXWA 1A16A 1WL9A 1YW9A 4MATA 2BWXA 1C24A 5D6FA 4R60A 2EVOA 1WBQA 4ZWPA 1N51A 4OOKA 1WKMA 1C27A 1BN5A 3D27A 4U6EA 4B28A 4Z7MA 5CDVA 3MR1A 2V6CA 5JFRA 2GG5A 4ZNGA 3S6BA 1YVMA 2GU6A 4U6JA 3TB5A 4EGEA 1Y1NA 1XNZA 5FCHA 4FO7A 2BHCA 1B59A 1C23A 2GG7A 3IG4A 4QR8A 1PV9A 4FKCA 3L7GA 3TAVA 2BWWA 3BIPA 2GG0A 4FLIA 1XGMA 2Q94A 4S00A 4U75A 4RZZA 1XGOA 2BWUA 4FLJA 4IKTA 3PKCA 2ZSGA 3Q6DA 2ADUA 2Q96A 3CB6A 2Q8KA 4RZYA 4U6ZA 5CIKA 2GGBA 4U1BA 2BWTA 5CNXA 4A6WA 2GG9A 5CE6A 4U76A 1BOAA 1B6AA 4IPAA 4KM3A 2GA2A 3PKDA 3RORA 4FLKA 2GGCA 2GU4A
chains in the Genus database with same CATH topology
1JAWA 2GU5A 3PKEA 4IU6A 2EVCA 5CLSA 3CB5A 3RVAA 1KQ9A 2G6PA 2NQ7A 3MATA 1KP0A 4IF7A 2P9AA 4IECA 1QZYA 1WL6A 2Q92A 3CTZA 3BITA 4JUQA 5CDLA 2B3LA 1QXYA 1KQ0A 1R5HA 2GU7A 4HXXA 4U70A 1R58A 2B3HA 2BB7A 2HOWA 4U71A 2BN7A 2OKNA 4S01A 2MATA 1R5GA 5D6EA 4ZWOA 1YW8A 3IU7A 3L24A 4U73A 1C22A 5CDEA 2BWVA 1WY2A 2BWYA 2GG3A 1XGSA 2V3YA 4FUKA 1YJ3A 2BHBA 3IU8A 4IDYA 4IKRA 3FM3A 1O0XA 2BHDA 2V3XA 2BWSA 4IKUA 4PNCA 2EA4A 3IU9A 1W2MA 2GG2A 2P99A 1WLRA 2P98A 4PV4A 2GZ5A 3BIQA 1QXZA 2Q93A 4FLLA 4S2TP 2IW2A 4IKSA 2NQ6A 1W7VA 2B3KA 3MX6A 4FO8A 4S2RP 2BH3A 2GG8A 5FCFA 3PKAA 1MATA 2V3ZA 4U69A 2EVMA 1XGNA 3PKBA 1YW7A 1M35A 4U6CA 2EA2A 2GTXA 4U6WA 1C21A 2BHAA 2OAZA 2Q95A 4RGZ1 5JHUA 2DFIA 1CHMA 3FMQA 4A6VA 1WN1A 3FMRA 5E5BA 5JI6A 4ZWUA 1QXWA 1A16A 1WL9A 1YW9A 4MATA 2BWXA 1C24A 5D6FA 4R60A 2EVOA 1WBQA 4ZWPA 1N51A 4OOKA 1WKMA 1C27A 1BN5A 3D27A 4U6EA 4B28A 4Z7MA 5CDVA 3MR1A 2V6CA 5JFRA 2GG5A 4ZNGA 3S6BA 1YVMA 2GU6A 4U6JA 3TB5A 4EGEA 1Y1NA 1XNZA 5FCHA 4FO7A 2BHCA 1B59A 1C23A 2GG7A 3IG4A 4QR8A 1PV9A 4FKCA 3L7GA 3TAVA 2BWWA 3BIPA 2GG0A 4FLIA 1XGMA 2Q94A 4S00A 4U75A 4RZZA 1XGOA 2BWUA 4FLJA 4IKTA 3PKCA 2ZSGA 3Q6DA 2ADUA 2Q96A 3CB6A 2Q8KA 4RZYA 4U6ZA 5CIKA 2GGBA 4U1BA 2BWTA 5CNXA 4A6WA 2GG9A 5CE6A 4U76A 1BOAA 1B6AA 4IPAA 4KM3A 2GA2A 3PKDA 3RORA 4FLKA 2GGCA 2GU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAW A;  2GU5 A;  3PKE A;  4IU6 A;  2EVC A;  5CLS A;  3CB5 A;  3RVA A;  1KQ9 A;  2G6P A;  2NQ7 A;  3MAT A;  1KP0 A;  4IF7 A;  2P9A A;  4IEC A;  1QZY A;  1WL6 A;  2Q92 A;  3CTZ A;  3BIT A;  4JUQ A;  5CDL A;  2B3L A;  1QXY A;  1KQ0 A;  1R5H A;  2GU7 A;  4HXX A;  4U70 A;  1R58 A;  2B3H A;  2BB7 A;  2HOW A;  4U71 A;  2BN7 A;  2OKN A;  4S01 A;  2MAT A;  1R5G A;  5D6E A;  4ZWO A;  1YW8 A;  3IU7 A;  3L24 A;  4U73 A;  1C22 A;  5CDE A;  2BWV A;  1WY2 A;  2BWY A;  2GG3 A;  1XGS A;  2V3Y A;  4FUK A;  1YJ3 A;  2BHB A;  3IU8 A;  4IDY A;  4IKR A;  3FM3 A;  1O0X A;  2BHD A;  2V3X A;  2BWS A;  4IKU A;  4PNC A;  2EA4 A;  3IU9 A;  1W2M A;  2GG2 A;  2P99 A;  1WLR A;  2P98 A;  4PV4 A;  2GZ5 A;  3BIQ A;  1QXZ A;  2Q93 A;  4FLL A;  4S2T P;  2IW2 A;  4IKS A;  2NQ6 A;  1W7V A;  2B3K A;  3MX6 A;  4FO8 A;  4S2R P;  2BH3 A;  2GG8 A;  5FCF A;  3PKA A;  1MAT A;  2V3Z A;  4U69 A;  2EVM A;  1XGN A;  3PKB A;  1YW7 A;  1M35 A;  4U6C A;  2EA2 A;  2GTX A;  4U6W A;  1C21 A;  2BHA A;  2OAZ A;  2Q95 A;  4RGZ 1;  5JHU A;  2DFI A;  1CHM A;  3FMQ A;  4A6V A;  1WN1 A;  3FMR A;  5E5B A;  5JI6 A;  4ZWU A;  1QXW A;  1A16 A;  1WL9 A;  1YW9 A;  4MAT A;  2BWX A;  1C24 A;  5D6F A;  4R60 A;  2EVO A;  1WBQ A;  4ZWP A;  1N51 A;  4OOK A;  1WKM A;  1C27 A;  1BN5 A;  3D27 A;  4U6E A;  4B28 A;  4Z7M A;  5CDV A;  3MR1 A;  2V6C A;  5JFR A;  2GG5 A;  4ZNG A;  3S6B A;  1YVM A;  2GU6 A;  4U6J A;  3TB5 A;  4EGE A;  1Y1N A;  1XNZ A;  5FCH A;  4FO7 A;  2BHC A;  1B59 A;  1C23 A;  2GG7 A;  3IG4 A;  4QR8 A;  1PV9 A;  4FKC A;  3L7G A;  3TAV A;  2BWW A;  3BIP A;  2GG0 A;  4FLI A;  1XGM A;  2Q94 A;  4S00 A;  4U75 A;  4RZZ A;  1XGO A;  2BWU A;  4FLJ A;  4IKT A;  3PKC A;  2ZSG A;  3Q6D A;  2ADU A;  2Q96 A;  3CB6 A;  2Q8K A;  4RZY A;  4U6Z A;  5CIK A;  2GGB A;  4U1B A;  2BWT A;  5CNX A;  4A6W A;  2GG9 A;  5CE6 A;  4U76 A;  1BOA A;  1B6A A;  4IPA A;  4KM3 A;  2GA2 A;  3PKD A;  3ROR A;  4FLK A;  2GGC A;  2GU4 A; 
#chains in the Genus database with same CATH topology
 1JAW A;  2GU5 A;  3PKE A;  4IU6 A;  2EVC A;  5CLS A;  3CB5 A;  3RVA A;  1KQ9 A;  2G6P A;  2NQ7 A;  3MAT A;  1KP0 A;  4IF7 A;  2P9A A;  4IEC A;  1QZY A;  1WL6 A;  2Q92 A;  3CTZ A;  3BIT A;  4JUQ A;  5CDL A;  2B3L A;  1QXY A;  1KQ0 A;  1R5H A;  2GU7 A;  4HXX A;  4U70 A;  1R58 A;  2B3H A;  2BB7 A;  2HOW A;  4U71 A;  2BN7 A;  2OKN A;  4S01 A;  2MAT A;  1R5G A;  5D6E A;  4ZWO A;  1YW8 A;  3IU7 A;  3L24 A;  4U73 A;  1C22 A;  5CDE A;  2BWV A;  1WY2 A;  2BWY A;  2GG3 A;  1XGS A;  2V3Y A;  4FUK A;  1YJ3 A;  2BHB A;  3IU8 A;  4IDY A;  4IKR A;  3FM3 A;  1O0X A;  2BHD A;  2V3X A;  2BWS A;  4IKU A;  4PNC A;  2EA4 A;  3IU9 A;  1W2M A;  2GG2 A;  2P99 A;  1WLR A;  2P98 A;  4PV4 A;  2GZ5 A;  3BIQ A;  1QXZ A;  2Q93 A;  4FLL A;  4S2T P;  2IW2 A;  4IKS A;  2NQ6 A;  1W7V A;  2B3K A;  3MX6 A;  4FO8 A;  4S2R P;  2BH3 A;  2GG8 A;  5FCF A;  3PKA A;  1MAT A;  2V3Z A;  4U69 A;  2EVM A;  1XGN A;  3PKB A;  1YW7 A;  1M35 A;  4U6C A;  2EA2 A;  2GTX A;  4U6W A;  1C21 A;  2BHA A;  2OAZ A;  2Q95 A;  4RGZ 1;  5JHU A;  2DFI A;  1CHM A;  3FMQ A;  4A6V A;  1WN1 A;  3FMR A;  5E5B A;  5JI6 A;  4ZWU A;  1QXW A;  1A16 A;  1WL9 A;  1YW9 A;  4MAT A;  2BWX A;  1C24 A;  5D6F A;  4R60 A;  2EVO A;  1WBQ A;  4ZWP A;  1N51 A;  4OOK A;  1WKM A;  1C27 A;  1BN5 A;  3D27 A;  4U6E A;  4B28 A;  4Z7M A;  5CDV A;  3MR1 A;  2V6C A;  5JFR A;  2GG5 A;  4ZNG A;  3S6B A;  1YVM A;  2GU6 A;  4U6J A;  3TB5 A;  4EGE A;  1Y1N A;  1XNZ A;  5FCH A;  4FO7 A;  2BHC A;  1B59 A;  1C23 A;  2GG7 A;  3IG4 A;  4QR8 A;  1PV9 A;  4FKC A;  3L7G A;  3TAV A;  2BWW A;  3BIP A;  2GG0 A;  4FLI A;  1XGM A;  2Q94 A;  4S00 A;  4U75 A;  4RZZ A;  1XGO A;  2BWU A;  4FLJ A;  4IKT A;  3PKC A;  2ZSG A;  3Q6D A;  2ADU A;  2Q96 A;  3CB6 A;  2Q8K A;  4RZY A;  4U6Z A;  5CIK A;  2GGB A;  4U1B A;  2BWT A;  5CNX A;  4A6W A;  2GG9 A;  5CE6 A;  4U76 A;  1BOA A;  1B6A A;  4IPA A;  4KM3 A;  2GA2 A;  3PKD A;  3ROR A;  4FLK A;  2GGC A;  2GU4 A; 
#chains in the Genus database with same CATH homology
 1JAW A;  2GU5 A;  3PKE A;  4IU6 A;  2EVC A;  5CLS A;  3CB5 A;  3RVA A;  1KQ9 A;  2G6P A;  2NQ7 A;  3MAT A;  1KP0 A;  4IF7 A;  2P9A A;  4IEC A;  1QZY A;  1WL6 A;  2Q92 A;  3CTZ A;  3BIT A;  4JUQ A;  5CDL A;  2B3L A;  1QXY A;  1KQ0 A;  1R5H A;  2GU7 A;  4HXX A;  4U70 A;  1R58 A;  2B3H A;  2BB7 A;  2HOW A;  4U71 A;  2BN7 A;  2OKN A;  4S01 A;  2MAT A;  1R5G A;  5D6E A;  4ZWO A;  1YW8 A;  3IU7 A;  3L24 A;  4U73 A;  1C22 A;  5CDE A;  2BWV A;  1WY2 A;  2BWY A;  2GG3 A;  1XGS A;  2V3Y A;  4FUK A;  1YJ3 A;  2BHB A;  3IU8 A;  4IDY A;  4IKR A;  3FM3 A;  1O0X A;  2BHD A;  2V3X A;  2BWS A;  4IKU A;  4PNC A;  2EA4 A;  3IU9 A;  1W2M A;  2GG2 A;  2P99 A;  1WLR A;  2P98 A;  4PV4 A;  2GZ5 A;  3BIQ A;  1QXZ A;  2Q93 A;  4FLL A;  4S2T P;  2IW2 A;  4IKS A;  2NQ6 A;  1W7V A;  2B3K A;  3MX6 A;  4FO8 A;  4S2R P;  2BH3 A;  2GG8 A;  5FCF A;  3PKA A;  1MAT A;  2V3Z A;  4U69 A;  2EVM A;  1XGN A;  3PKB A;  1YW7 A;  1M35 A;  4U6C A;  2EA2 A;  2GTX A;  4U6W A;  1C21 A;  2BHA A;  2OAZ A;  2Q95 A;  4RGZ 1;  5JHU A;  2DFI A;  1CHM A;  3FMQ A;  4A6V A;  1WN1 A;  3FMR A;  5E5B A;  5JI6 A;  4ZWU A;  1QXW A;  1A16 A;  1WL9 A;  1YW9 A;  4MAT A;  2BWX A;  1C24 A;  5D6F A;  4R60 A;  2EVO A;  1WBQ A;  4ZWP A;  1N51 A;  4OOK A;  1WKM A;  1C27 A;  1BN5 A;  3D27 A;  4U6E A;  4B28 A;  4Z7M A;  5CDV A;  3MR1 A;  2V6C A;  5JFR A;  2GG5 A;  4ZNG A;  3S6B A;  1YVM A;  2GU6 A;  4U6J A;  3TB5 A;  4EGE A;  1Y1N A;  1XNZ A;  5FCH A;  4FO7 A;  2BHC A;  1B59 A;  1C23 A;  2GG7 A;  3IG4 A;  4QR8 A;  1PV9 A;  4FKC A;  3L7G A;  3TAV A;  2BWW A;  3BIP A;  2GG0 A;  4FLI A;  1XGM A;  2Q94 A;  4S00 A;  4U75 A;  4RZZ A;  1XGO A;  2BWU A;  4FLJ A;  4IKT A;  3PKC A;  2ZSG A;  3Q6D A;  2ADU A;  2Q96 A;  3CB6 A;  2Q8K A;  4RZY A;  4U6Z A;  5CIK A;  2GGB A;  4U1B A;  2BWT A;  5CNX A;  4A6W A;  2GG9 A;  5CE6 A;  4U76 A;  1BOA A;  1B6A A;  4IPA A;  4KM3 A;  2GA2 A;  3PKD A;  3ROR A;  4FLK A;  2GGC A;  2GU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...