2BB7A

Mn form of e. coli methionine aminopeptidase in complex with a quinolinyl sulfonamide inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
258
structure length
258
Chain Sequence
IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Metal mediated inhibition of methionine aminopeptidase by quinolinyl sulfonamides
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 84
structure length 258
sequence length 258
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bb7A00
4U6EA 5CDLA 1R5HA 3FMQA 4U75A 2GG7A 1WLRA 2Q96A 3IU8A 2ZSGA 1QXYA 3MATA 4A6WA 4IU6A 4EGEA 5CDVA 4ZNGA 5CIKA 2ADUA 3IG4A 2EA2A 4HXXA 5JI6A 2GU7A 1KP0A 1WL6A 1BN5A 3RORA 4IECA 1R5GA 4IF7A 1YVMA 1XGSA 1WKMA 3BITA 3MX6A 2HOWA 1B59A 4U73A 2GGCA 3BIQA 2OAZA 2GG0A 4PV4A 4U70A 2GTXA 1A16A 2B3LA 2GG3A 3IU9A 3Q6DA 3RVAA 4JUQA 3L24A 4IKSA 2P98A 1C24A 4FLKA 5CNXA 2P9AA 4FLIA 4QR8A 3CB5A 1XNZA 2BWYA 1WY2A 4MATA 1C27A 1KQ9A 1BOAA 1YW9A 4FO8A 3PKEA 2GU5A 4Z7MA 5JHUA 1B6AA 2Q94A 2Q93A 3PKBA 1XGMA 4FUKA 2EVCA 4FKCA 5CLSA 2BWVA 5E5BA 4R60A 2BWTA 4ZWPA 1M35A 2EVOA 4FLJA 4U6WA 2BN7A 2NQ6A 1CHMA 2P99A 3BIPA 5CDEA 3S6BA 4U76A 1C21A 1YW8A 3FMRA 2Q8KA 2BWWA 2Q95A 2V3XA 1R58A 4ZWUA 1YW7A 1Y1NA 2BHBA 2GG9A 3L7GA 1QXWA 4FO7A 5FCHA 5FCFA 1YJ3A 2BHCA 2B3HA 3TAVA 2NQ7A 5D6EA 2EA4A 1MATA 1C23A 4FLLA 3TB5A 1QXZA 2BHDA 4IKRA 4RZYA 4U6CA 4PNCA 4OOKA 3IU7A 1WL9A 4RGZ1 2V3YA 4ZWOA 2GU4A 2BHAA 1WN1A 1PV9A 4S2RP 2BWSA 2G6PA 2GG8A 4RZZA 3MR1A 2V3ZA 2BB7A 2DFIA 2GU6A 2Q92A 4KM3A 4S2TP 2GGBA 4U6JA 3FM3A 2BWUA 3PKDA 2BH3A 1XGOA 1XGNA 4IKUA 4IDYA 4B28A 3PKAA 5D6FA 2GA2A 1C22A 2MATA 5JFRA 2GG5A 1JAWA 2BWXA 4S00A 3PKCA 4U69A 4S01A 4A6VA 1WBQA 4IKTA 1QZYA 2V6CA 4U6ZA 3D27A 1O0XA 3CB6A 2GZ5A 2IW2A 1W2MA 4IPAA 5CE6A 2EVMA 4U1BA 1KQ0A 1N51A 2B3KA 1W7VA 3CTZA 2OKNA 2GG2A 4U71A
chains in the Genus database with same CATH superfamily
4U6EA 5CDLA 1R5HA 3FMQA 4U75A 2GG7A 1WLRA 2Q96A 3IU8A 2ZSGA 1QXYA 3MATA 4A6WA 4IU6A 4EGEA 5CDVA 4ZNGA 5CIKA 2ADUA 3IG4A 2EA2A 4HXXA 5JI6A 2GU7A 1KP0A 1WL6A 1BN5A 3RORA 4IECA 1R5GA 4IF7A 1YVMA 1XGSA 1WKMA 3BITA 3MX6A 2HOWA 1B59A 4U73A 2GGCA 3BIQA 2OAZA 2GG0A 4PV4A 4U70A 2GTXA 1A16A 2B3LA 2GG3A 3IU9A 3Q6DA 3RVAA 4JUQA 3L24A 4IKSA 2P98A 1C24A 4FLKA 5CNXA 2P9AA 4FLIA 4QR8A 3CB5A 1XNZA 2BWYA 1WY2A 4MATA 1C27A 1KQ9A 1BOAA 1YW9A 4FO8A 3PKEA 2GU5A 4Z7MA 5JHUA 1B6AA 2Q94A 2Q93A 3PKBA 1XGMA 4FUKA 2EVCA 4FKCA 5CLSA 2BWVA 5E5BA 4R60A 2BWTA 4ZWPA 1M35A 2EVOA 4FLJA 4U6WA 2BN7A 2NQ6A 1CHMA 2P99A 3BIPA 5CDEA 3S6BA 4U76A 1C21A 1YW8A 3FMRA 2Q8KA 2BWWA 2Q95A 2V3XA 1R58A 4ZWUA 1YW7A 1Y1NA 2BHBA 2GG9A 3L7GA 1QXWA 4FO7A 5FCHA 5FCFA 1YJ3A 2BHCA 2B3HA 3TAVA 2NQ7A 5D6EA 2EA4A 1MATA 1C23A 4FLLA 3TB5A 1QXZA 2BHDA 4IKRA 4RZYA 4U6CA 4PNCA 4OOKA 3IU7A 1WL9A 4RGZ1 2V3YA 4ZWOA 2GU4A 2BHAA 1WN1A 1PV9A 4S2RP 2BWSA 2G6PA 2GG8A 4RZZA 3MR1A 2V3ZA 2BB7A 2DFIA 2GU6A 2Q92A 4KM3A 4S2TP 2GGBA 4U6JA 3FM3A 2BWUA 3PKDA 2BH3A 1XGOA 1XGNA 4IKUA 4IDYA 4B28A 3PKAA 5D6FA 2GA2A 1C22A 2MATA 5JFRA 2GG5A 1JAWA 2BWXA 4S00A 3PKCA 4U69A 4S01A 4A6VA 1WBQA 4IKTA 1QZYA 2V6CA 4U6ZA 3D27A 1O0XA 3CB6A 2GZ5A 2IW2A 1W2MA 4IPAA 5CE6A 2EVMA 4U1BA 1KQ0A 1N51A 2B3KA 1W7VA 3CTZA 2OKNA 2GG2A 4U71A
chains in the Genus database with same CATH topology
4U6EA 5CDLA 1R5HA 3FMQA 4U75A 2GG7A 1WLRA 2Q96A 3IU8A 2ZSGA 1QXYA 3MATA 4A6WA 4IU6A 4EGEA 5CDVA 4ZNGA 5CIKA 2ADUA 3IG4A 2EA2A 4HXXA 5JI6A 2GU7A 1KP0A 1WL6A 1BN5A 3RORA 4IECA 1R5GA 4IF7A 1YVMA 1XGSA 1WKMA 3BITA 3MX6A 2HOWA 1B59A 4U73A 2GGCA 3BIQA 2OAZA 2GG0A 4PV4A 4U70A 2GTXA 1A16A 2B3LA 2GG3A 3IU9A 3Q6DA 3RVAA 4JUQA 3L24A 4IKSA 2P98A 1C24A 4FLKA 5CNXA 2P9AA 4FLIA 4QR8A 3CB5A 1XNZA 2BWYA 1WY2A 4MATA 1C27A 1KQ9A 1BOAA 1YW9A 4FO8A 3PKEA 2GU5A 4Z7MA 5JHUA 1B6AA 2Q94A 2Q93A 3PKBA 1XGMA 4FUKA 2EVCA 4FKCA 5CLSA 2BWVA 5E5BA 4R60A 2BWTA 4ZWPA 1M35A 2EVOA 4FLJA 4U6WA 2BN7A 2NQ6A 1CHMA 2P99A 3BIPA 5CDEA 3S6BA 4U76A 1C21A 1YW8A 3FMRA 2Q8KA 2BWWA 2Q95A 2V3XA 1R58A 4ZWUA 1YW7A 1Y1NA 2BHBA 2GG9A 3L7GA 1QXWA 4FO7A 5FCHA 5FCFA 1YJ3A 2BHCA 2B3HA 3TAVA 2NQ7A 5D6EA 2EA4A 1MATA 1C23A 4FLLA 3TB5A 1QXZA 2BHDA 4IKRA 4RZYA 4U6CA 4PNCA 4OOKA 3IU7A 1WL9A 4RGZ1 2V3YA 4ZWOA 2GU4A 2BHAA 1WN1A 1PV9A 4S2RP 2BWSA 2G6PA 2GG8A 4RZZA 3MR1A 2V3ZA 2BB7A 2DFIA 2GU6A 2Q92A 4KM3A 4S2TP 2GGBA 4U6JA 3FM3A 2BWUA 3PKDA 2BH3A 1XGOA 1XGNA 4IKUA 4IDYA 4B28A 3PKAA 5D6FA 2GA2A 1C22A 2MATA 5JFRA 2GG5A 1JAWA 2BWXA 4S00A 3PKCA 4U69A 4S01A 4A6VA 1WBQA 4IKTA 1QZYA 2V6CA 4U6ZA 3D27A 1O0XA 3CB6A 2GZ5A 2IW2A 1W2MA 4IPAA 5CE6A 2EVMA 4U1BA 1KQ0A 1N51A 2B3KA 1W7VA 3CTZA 2OKNA 2GG2A 4U71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6E A;  5CDL A;  1R5H A;  3FMQ A;  4U75 A;  2GG7 A;  1WLR A;  2Q96 A;  3IU8 A;  2ZSG A;  1QXY A;  3MAT A;  4A6W A;  4IU6 A;  4EGE A;  5CDV A;  4ZNG A;  5CIK A;  2ADU A;  3IG4 A;  2EA2 A;  4HXX A;  5JI6 A;  2GU7 A;  1KP0 A;  1WL6 A;  1BN5 A;  3ROR A;  4IEC A;  1R5G A;  4IF7 A;  1YVM A;  1XGS A;  1WKM A;  3BIT A;  3MX6 A;  2HOW A;  1B59 A;  4U73 A;  2GGC A;  3BIQ A;  2OAZ A;  2GG0 A;  4PV4 A;  4U70 A;  2GTX A;  1A16 A;  2B3L A;  2GG3 A;  3IU9 A;  3Q6D A;  3RVA A;  4JUQ A;  3L24 A;  4IKS A;  2P98 A;  1C24 A;  4FLK A;  5CNX A;  2P9A A;  4FLI A;  4QR8 A;  3CB5 A;  1XNZ A;  2BWY A;  1WY2 A;  4MAT A;  1C27 A;  1KQ9 A;  1BOA A;  1YW9 A;  4FO8 A;  3PKE A;  2GU5 A;  4Z7M A;  5JHU A;  1B6A A;  2Q94 A;  2Q93 A;  3PKB A;  1XGM A;  4FUK A;  2EVC A;  4FKC A;  5CLS A;  2BWV A;  5E5B A;  4R60 A;  2BWT A;  4ZWP A;  1M35 A;  2EVO A;  4FLJ A;  4U6W A;  2BN7 A;  2NQ6 A;  1CHM A;  2P99 A;  3BIP A;  5CDE A;  3S6B A;  4U76 A;  1C21 A;  1YW8 A;  3FMR A;  2Q8K A;  2BWW A;  2Q95 A;  2V3X A;  1R58 A;  4ZWU A;  1YW7 A;  1Y1N A;  2BHB A;  2GG9 A;  3L7G A;  1QXW A;  4FO7 A;  5FCH A;  5FCF A;  1YJ3 A;  2BHC A;  2B3H A;  3TAV A;  2NQ7 A;  5D6E A;  2EA4 A;  1MAT A;  1C23 A;  4FLL A;  3TB5 A;  1QXZ A;  2BHD A;  4IKR A;  4RZY A;  4U6C A;  4PNC A;  4OOK A;  3IU7 A;  1WL9 A;  4RGZ 1;  2V3Y A;  4ZWO A;  2GU4 A;  2BHA A;  1WN1 A;  1PV9 A;  4S2R P;  2BWS A;  2G6P A;  2GG8 A;  4RZZ A;  3MR1 A;  2V3Z A;  2BB7 A;  2DFI A;  2GU6 A;  2Q92 A;  4KM3 A;  4S2T P;  2GGB A;  4U6J A;  3FM3 A;  2BWU A;  3PKD A;  2BH3 A;  1XGO A;  1XGN A;  4IKU A;  4IDY A;  4B28 A;  3PKA A;  5D6F A;  2GA2 A;  1C22 A;  2MAT A;  5JFR A;  2GG5 A;  1JAW A;  2BWX A;  4S00 A;  3PKC A;  4U69 A;  4S01 A;  4A6V A;  1WBQ A;  4IKT A;  1QZY A;  2V6C A;  4U6Z A;  3D27 A;  1O0X A;  3CB6 A;  2GZ5 A;  2IW2 A;  1W2M A;  4IPA A;  5CE6 A;  2EVM A;  4U1B A;  1KQ0 A;  1N51 A;  2B3K A;  1W7V A;  3CTZ A;  2OKN A;  2GG2 A;  4U71 A; 
#chains in the Genus database with same CATH topology
 4U6E A;  5CDL A;  1R5H A;  3FMQ A;  4U75 A;  2GG7 A;  1WLR A;  2Q96 A;  3IU8 A;  2ZSG A;  1QXY A;  3MAT A;  4A6W A;  4IU6 A;  4EGE A;  5CDV A;  4ZNG A;  5CIK A;  2ADU A;  3IG4 A;  2EA2 A;  4HXX A;  5JI6 A;  2GU7 A;  1KP0 A;  1WL6 A;  1BN5 A;  3ROR A;  4IEC A;  1R5G A;  4IF7 A;  1YVM A;  1XGS A;  1WKM A;  3BIT A;  3MX6 A;  2HOW A;  1B59 A;  4U73 A;  2GGC A;  3BIQ A;  2OAZ A;  2GG0 A;  4PV4 A;  4U70 A;  2GTX A;  1A16 A;  2B3L A;  2GG3 A;  3IU9 A;  3Q6D A;  3RVA A;  4JUQ A;  3L24 A;  4IKS A;  2P98 A;  1C24 A;  4FLK A;  5CNX A;  2P9A A;  4FLI A;  4QR8 A;  3CB5 A;  1XNZ A;  2BWY A;  1WY2 A;  4MAT A;  1C27 A;  1KQ9 A;  1BOA A;  1YW9 A;  4FO8 A;  3PKE A;  2GU5 A;  4Z7M A;  5JHU A;  1B6A A;  2Q94 A;  2Q93 A;  3PKB A;  1XGM A;  4FUK A;  2EVC A;  4FKC A;  5CLS A;  2BWV A;  5E5B A;  4R60 A;  2BWT A;  4ZWP A;  1M35 A;  2EVO A;  4FLJ A;  4U6W A;  2BN7 A;  2NQ6 A;  1CHM A;  2P99 A;  3BIP A;  5CDE A;  3S6B A;  4U76 A;  1C21 A;  1YW8 A;  3FMR A;  2Q8K A;  2BWW A;  2Q95 A;  2V3X A;  1R58 A;  4ZWU A;  1YW7 A;  1Y1N A;  2BHB A;  2GG9 A;  3L7G A;  1QXW A;  4FO7 A;  5FCH A;  5FCF A;  1YJ3 A;  2BHC A;  2B3H A;  3TAV A;  2NQ7 A;  5D6E A;  2EA4 A;  1MAT A;  1C23 A;  4FLL A;  3TB5 A;  1QXZ A;  2BHD A;  4IKR A;  4RZY A;  4U6C A;  4PNC A;  4OOK A;  3IU7 A;  1WL9 A;  4RGZ 1;  2V3Y A;  4ZWO A;  2GU4 A;  2BHA A;  1WN1 A;  1PV9 A;  4S2R P;  2BWS A;  2G6P A;  2GG8 A;  4RZZ A;  3MR1 A;  2V3Z A;  2BB7 A;  2DFI A;  2GU6 A;  2Q92 A;  4KM3 A;  4S2T P;  2GGB A;  4U6J A;  3FM3 A;  2BWU A;  3PKD A;  2BH3 A;  1XGO A;  1XGN A;  4IKU A;  4IDY A;  4B28 A;  3PKA A;  5D6F A;  2GA2 A;  1C22 A;  2MAT A;  5JFR A;  2GG5 A;  1JAW A;  2BWX A;  4S00 A;  3PKC A;  4U69 A;  4S01 A;  4A6V A;  1WBQ A;  4IKT A;  1QZY A;  2V6C A;  4U6Z A;  3D27 A;  1O0X A;  3CB6 A;  2GZ5 A;  2IW2 A;  1W2M A;  4IPA A;  5CE6 A;  2EVM A;  4U1B A;  1KQ0 A;  1N51 A;  2B3K A;  1W7V A;  3CTZ A;  2OKN A;  2GG2 A;  4U71 A; 
#chains in the Genus database with same CATH homology
 4U6E A;  5CDL A;  1R5H A;  3FMQ A;  4U75 A;  2GG7 A;  1WLR A;  2Q96 A;  3IU8 A;  2ZSG A;  1QXY A;  3MAT A;  4A6W A;  4IU6 A;  4EGE A;  5CDV A;  4ZNG A;  5CIK A;  2ADU A;  3IG4 A;  2EA2 A;  4HXX A;  5JI6 A;  2GU7 A;  1KP0 A;  1WL6 A;  1BN5 A;  3ROR A;  4IEC A;  1R5G A;  4IF7 A;  1YVM A;  1XGS A;  1WKM A;  3BIT A;  3MX6 A;  2HOW A;  1B59 A;  4U73 A;  2GGC A;  3BIQ A;  2OAZ A;  2GG0 A;  4PV4 A;  4U70 A;  2GTX A;  1A16 A;  2B3L A;  2GG3 A;  3IU9 A;  3Q6D A;  3RVA A;  4JUQ A;  3L24 A;  4IKS A;  2P98 A;  1C24 A;  4FLK A;  5CNX A;  2P9A A;  4FLI A;  4QR8 A;  3CB5 A;  1XNZ A;  2BWY A;  1WY2 A;  4MAT A;  1C27 A;  1KQ9 A;  1BOA A;  1YW9 A;  4FO8 A;  3PKE A;  2GU5 A;  4Z7M A;  5JHU A;  1B6A A;  2Q94 A;  2Q93 A;  3PKB A;  1XGM A;  4FUK A;  2EVC A;  4FKC A;  5CLS A;  2BWV A;  5E5B A;  4R60 A;  2BWT A;  4ZWP A;  1M35 A;  2EVO A;  4FLJ A;  4U6W A;  2BN7 A;  2NQ6 A;  1CHM A;  2P99 A;  3BIP A;  5CDE A;  3S6B A;  4U76 A;  1C21 A;  1YW8 A;  3FMR A;  2Q8K A;  2BWW A;  2Q95 A;  2V3X A;  1R58 A;  4ZWU A;  1YW7 A;  1Y1N A;  2BHB A;  2GG9 A;  3L7G A;  1QXW A;  4FO7 A;  5FCH A;  5FCF A;  1YJ3 A;  2BHC A;  2B3H A;  3TAV A;  2NQ7 A;  5D6E A;  2EA4 A;  1MAT A;  1C23 A;  4FLL A;  3TB5 A;  1QXZ A;  2BHD A;  4IKR A;  4RZY A;  4U6C A;  4PNC A;  4OOK A;  3IU7 A;  1WL9 A;  4RGZ 1;  2V3Y A;  4ZWO A;  2GU4 A;  2BHA A;  1WN1 A;  1PV9 A;  4S2R P;  2BWS A;  2G6P A;  2GG8 A;  4RZZ A;  3MR1 A;  2V3Z A;  2BB7 A;  2DFI A;  2GU6 A;  2Q92 A;  4KM3 A;  4S2T P;  2GGB A;  4U6J A;  3FM3 A;  2BWU A;  3PKD A;  2BH3 A;  1XGO A;  1XGN A;  4IKU A;  4IDY A;  4B28 A;  3PKA A;  5D6F A;  2GA2 A;  1C22 A;  2MAT A;  5JFR A;  2GG5 A;  1JAW A;  2BWX A;  4S00 A;  3PKC A;  4U69 A;  4S01 A;  4A6V A;  1WBQ A;  4IKT A;  1QZY A;  2V6C A;  4U6Z A;  3D27 A;  1O0X A;  3CB6 A;  2GZ5 A;  2IW2 A;  1W2M A;  4IPA A;  5CE6 A;  2EVM A;  4U1B A;  1KQ0 A;  1N51 A;  2B3K A;  1W7V A;  3CTZ A;  2OKN A;  2GG2 A;  4U71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...