2BB7A

Mn form of e. coli methionine aminopeptidase in complex with a quinolinyl sulfonamide inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
258
structure length
258
Chain Sequence
IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal mediated inhibition of methionine aminopeptidase by quinolinyl sulfonamides
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 258
sequence length 258
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bb7A00
4JUQA 1XGOA 1C24A 5FCFA 4ZWPA 2EA2A 4RZZA 5JI6A 3D27A 3MATA 4RZYA 2IW2A 4HXXA 3RORA 3PKDA 1W7VA 2BWXA 4FKCA 3MR1A 2Q92A 5FCHA 1BN5A 5E5BA 2GA2A 1WL9A 5JFRA 2GG7A 2B3HA 4U6CA 4FUKA 1BOAA 1YJ3A 1W2MA 1C21A 2V6CA 2P98A 4S01A 2BHAA 2OKNA 4FO8A 4IU6A 1WL6A 1KQ9A 5CE6A 1WN1A 1JAWA 2GG9A 2GU4A 1XGNA 3PKCA 1XNZA 4IKRA 4S00A 1M35A 1R58A 2MATA 1Y1NA 3BITA 1R5GA 2BWVA 1QXWA 2GG8A 3TB5A 1QXYA 1MATA 3IU9A 1KP0A 4IF7A 3MX6A 5CLSA 5CDVA 4R60A 5CDLA 3L24A 4IPAA 5D6FA 2BWYA 4EGEA 1YW7A 2BN7A 4FLJA 4IKTA 1N51A 2BWSA 2Q95A 4ZWUA 1KQ0A 2NQ6A 2GG0A 3IU8A 2V3XA 4IECA 2DFIA 1XGSA 4PV4A 1YW9A 1B6AA 4S2RP 1C27A 1WLRA 4IKUA 1WKMA 1PV9A 2HOWA 1QZYA 3CTZA 4KM3A 2GGBA 5JHUA 2GU5A 1XGMA 2GG5A 4A6VA 3TAVA 3FMQA 1C22A 3CB6A 5CNXA 4RGZ1 4A6WA 1R5HA 2GU7A 2Q94A 5D6EA 2GZ5A 3BIQA 4U6JA 4U73A 1WBQA 1WY2A 2BH3A 2EVMA 1C23A 3CB5A 4IDYA 2GTXA 2BWWA 4FO7A 4ZNGA 2ADUA 2BWUA 1O0XA 2GU6A 3IG4A 3Q6DA 4U70A 3PKAA 2P99A 2V3YA 4U6WA 2EVOA 3RVAA 1YW8A 2ZSGA 5CIKA 2BB7A 4S2TP 2GGCA 1QXZA 3L7GA 4PNCA 3S6BA 4FLKA 2NQ7A 4U1BA 1YVMA 4U75A 5CDEA 4U6EA 4QR8A 1A16A 1CHMA 3FMRA 3PKEA 4U76A 2Q8KA 2BHDA 4IKSA 2BWTA 4B28A 1B59A 4U71A 4U6ZA 2BHBA 3FM3A 2BHCA 2GG2A 2EA4A 2GG3A 2G6PA 3IU7A 4OOKA 4MATA 4FLIA 2EVCA 4Z7MA 2Q93A 3BIPA 2B3KA 2OAZA 4ZWOA 4FLLA 4U69A 3PKBA 2Q96A 2V3ZA 2P9AA 2B3LA
chains in the Genus database with same CATH superfamily
4JUQA 1XGOA 1C24A 5FCFA 4ZWPA 2EA2A 4RZZA 5JI6A 3D27A 3MATA 4RZYA 2IW2A 4HXXA 3RORA 3PKDA 1W7VA 2BWXA 4FKCA 3MR1A 2Q92A 5FCHA 1BN5A 5E5BA 2GA2A 1WL9A 5JFRA 2GG7A 2B3HA 4U6CA 4FUKA 1BOAA 1YJ3A 1W2MA 1C21A 2V6CA 2P98A 4S01A 2BHAA 2OKNA 4FO8A 4IU6A 1WL6A 1KQ9A 5CE6A 1WN1A 1JAWA 2GG9A 2GU4A 1XGNA 3PKCA 1XNZA 4IKRA 4S00A 1M35A 1R58A 2MATA 1Y1NA 3BITA 1R5GA 2BWVA 1QXWA 2GG8A 3TB5A 1QXYA 1MATA 3IU9A 1KP0A 4IF7A 3MX6A 5CLSA 5CDVA 4R60A 5CDLA 3L24A 4IPAA 5D6FA 2BWYA 4EGEA 1YW7A 2BN7A 4FLJA 4IKTA 1N51A 2BWSA 2Q95A 4ZWUA 1KQ0A 2NQ6A 2GG0A 3IU8A 2V3XA 4IECA 2DFIA 1XGSA 4PV4A 1YW9A 1B6AA 4S2RP 1C27A 1WLRA 4IKUA 1WKMA 1PV9A 2HOWA 1QZYA 3CTZA 4KM3A 2GGBA 5JHUA 2GU5A 1XGMA 2GG5A 4A6VA 3TAVA 3FMQA 1C22A 3CB6A 5CNXA 4RGZ1 4A6WA 1R5HA 2GU7A 2Q94A 5D6EA 2GZ5A 3BIQA 4U6JA 4U73A 1WBQA 1WY2A 2BH3A 2EVMA 1C23A 3CB5A 4IDYA 2GTXA 2BWWA 4FO7A 4ZNGA 2ADUA 2BWUA 1O0XA 2GU6A 3IG4A 3Q6DA 4U70A 3PKAA 2P99A 2V3YA 4U6WA 2EVOA 3RVAA 1YW8A 2ZSGA 5CIKA 2BB7A 4S2TP 2GGCA 1QXZA 3L7GA 4PNCA 3S6BA 4FLKA 2NQ7A 4U1BA 1YVMA 4U75A 5CDEA 4U6EA 4QR8A 1A16A 1CHMA 3FMRA 3PKEA 4U76A 2Q8KA 2BHDA 4IKSA 2BWTA 4B28A 1B59A 4U71A 4U6ZA 2BHBA 3FM3A 2BHCA 2GG2A 2EA4A 2GG3A 2G6PA 3IU7A 4OOKA 4MATA 4FLIA 2EVCA 4Z7MA 2Q93A 3BIPA 2B3KA 2OAZA 4ZWOA 4FLLA 4U69A 3PKBA 2Q96A 2V3ZA 2P9AA 2B3LA
chains in the Genus database with same CATH topology
4JUQA 1XGOA 1C24A 5FCFA 4ZWPA 2EA2A 4RZZA 5JI6A 3D27A 3MATA 4RZYA 2IW2A 4HXXA 3RORA 3PKDA 1W7VA 2BWXA 4FKCA 3MR1A 2Q92A 5FCHA 1BN5A 5E5BA 2GA2A 1WL9A 5JFRA 2GG7A 2B3HA 4U6CA 4FUKA 1BOAA 1YJ3A 1W2MA 1C21A 2V6CA 2P98A 4S01A 2BHAA 2OKNA 4FO8A 4IU6A 1WL6A 1KQ9A 5CE6A 1WN1A 1JAWA 2GG9A 2GU4A 1XGNA 3PKCA 1XNZA 4IKRA 4S00A 1M35A 1R58A 2MATA 1Y1NA 3BITA 1R5GA 2BWVA 1QXWA 2GG8A 3TB5A 1QXYA 1MATA 3IU9A 1KP0A 4IF7A 3MX6A 5CLSA 5CDVA 4R60A 5CDLA 3L24A 4IPAA 5D6FA 2BWYA 4EGEA 1YW7A 2BN7A 4FLJA 4IKTA 1N51A 2BWSA 2Q95A 4ZWUA 1KQ0A 2NQ6A 2GG0A 3IU8A 2V3XA 4IECA 2DFIA 1XGSA 4PV4A 1YW9A 1B6AA 4S2RP 1C27A 1WLRA 4IKUA 1WKMA 1PV9A 2HOWA 1QZYA 3CTZA 4KM3A 2GGBA 5JHUA 2GU5A 1XGMA 2GG5A 4A6VA 3TAVA 3FMQA 1C22A 3CB6A 5CNXA 4RGZ1 4A6WA 1R5HA 2GU7A 2Q94A 5D6EA 2GZ5A 3BIQA 4U6JA 4U73A 1WBQA 1WY2A 2BH3A 2EVMA 1C23A 3CB5A 4IDYA 2GTXA 2BWWA 4FO7A 4ZNGA 2ADUA 2BWUA 1O0XA 2GU6A 3IG4A 3Q6DA 4U70A 3PKAA 2P99A 2V3YA 4U6WA 2EVOA 3RVAA 1YW8A 2ZSGA 5CIKA 2BB7A 4S2TP 2GGCA 1QXZA 3L7GA 4PNCA 3S6BA 4FLKA 2NQ7A 4U1BA 1YVMA 4U75A 5CDEA 4U6EA 4QR8A 1A16A 1CHMA 3FMRA 3PKEA 4U76A 2Q8KA 2BHDA 4IKSA 2BWTA 4B28A 1B59A 4U71A 4U6ZA 2BHBA 3FM3A 2BHCA 2GG2A 2EA4A 2GG3A 2G6PA 3IU7A 4OOKA 4MATA 4FLIA 2EVCA 4Z7MA 2Q93A 3BIPA 2B3KA 2OAZA 4ZWOA 4FLLA 4U69A 3PKBA 2Q96A 2V3ZA 2P9AA 2B3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JUQ A;  1XGO A;  1C24 A;  5FCF A;  4ZWP A;  2EA2 A;  4RZZ A;  5JI6 A;  3D27 A;  3MAT A;  4RZY A;  2IW2 A;  4HXX A;  3ROR A;  3PKD A;  1W7V A;  2BWX A;  4FKC A;  3MR1 A;  2Q92 A;  5FCH A;  1BN5 A;  5E5B A;  2GA2 A;  1WL9 A;  5JFR A;  2GG7 A;  2B3H A;  4U6C A;  4FUK A;  1BOA A;  1YJ3 A;  1W2M A;  1C21 A;  2V6C A;  2P98 A;  4S01 A;  2BHA A;  2OKN A;  4FO8 A;  4IU6 A;  1WL6 A;  1KQ9 A;  5CE6 A;  1WN1 A;  1JAW A;  2GG9 A;  2GU4 A;  1XGN A;  3PKC A;  1XNZ A;  4IKR A;  4S00 A;  1M35 A;  1R58 A;  2MAT A;  1Y1N A;  3BIT A;  1R5G A;  2BWV A;  1QXW A;  2GG8 A;  3TB5 A;  1QXY A;  1MAT A;  3IU9 A;  1KP0 A;  4IF7 A;  3MX6 A;  5CLS A;  5CDV A;  4R60 A;  5CDL A;  3L24 A;  4IPA A;  5D6F A;  2BWY A;  4EGE A;  1YW7 A;  2BN7 A;  4FLJ A;  4IKT A;  1N51 A;  2BWS A;  2Q95 A;  4ZWU A;  1KQ0 A;  2NQ6 A;  2GG0 A;  3IU8 A;  2V3X A;  4IEC A;  2DFI A;  1XGS A;  4PV4 A;  1YW9 A;  1B6A A;  4S2R P;  1C27 A;  1WLR A;  4IKU A;  1WKM A;  1PV9 A;  2HOW A;  1QZY A;  3CTZ A;  4KM3 A;  2GGB A;  5JHU A;  2GU5 A;  1XGM A;  2GG5 A;  4A6V A;  3TAV A;  3FMQ A;  1C22 A;  3CB6 A;  5CNX A;  4RGZ 1;  4A6W A;  1R5H A;  2GU7 A;  2Q94 A;  5D6E A;  2GZ5 A;  3BIQ A;  4U6J A;  4U73 A;  1WBQ A;  1WY2 A;  2BH3 A;  2EVM A;  1C23 A;  3CB5 A;  4IDY A;  2GTX A;  2BWW A;  4FO7 A;  4ZNG A;  2ADU A;  2BWU A;  1O0X A;  2GU6 A;  3IG4 A;  3Q6D A;  4U70 A;  3PKA A;  2P99 A;  2V3Y A;  4U6W A;  2EVO A;  3RVA A;  1YW8 A;  2ZSG A;  5CIK A;  2BB7 A;  4S2T P;  2GGC A;  1QXZ A;  3L7G A;  4PNC A;  3S6B A;  4FLK A;  2NQ7 A;  4U1B A;  1YVM A;  4U75 A;  5CDE A;  4U6E A;  4QR8 A;  1A16 A;  1CHM A;  3FMR A;  3PKE A;  4U76 A;  2Q8K A;  2BHD A;  4IKS A;  2BWT A;  4B28 A;  1B59 A;  4U71 A;  4U6Z A;  2BHB A;  3FM3 A;  2BHC A;  2GG2 A;  2EA4 A;  2GG3 A;  2G6P A;  3IU7 A;  4OOK A;  4MAT A;  4FLI A;  2EVC A;  4Z7M A;  2Q93 A;  3BIP A;  2B3K A;  2OAZ A;  4ZWO A;  4FLL A;  4U69 A;  3PKB A;  2Q96 A;  2V3Z A;  2P9A A;  2B3L A; 
#chains in the Genus database with same CATH topology
 4JUQ A;  1XGO A;  1C24 A;  5FCF A;  4ZWP A;  2EA2 A;  4RZZ A;  5JI6 A;  3D27 A;  3MAT A;  4RZY A;  2IW2 A;  4HXX A;  3ROR A;  3PKD A;  1W7V A;  2BWX A;  4FKC A;  3MR1 A;  2Q92 A;  5FCH A;  1BN5 A;  5E5B A;  2GA2 A;  1WL9 A;  5JFR A;  2GG7 A;  2B3H A;  4U6C A;  4FUK A;  1BOA A;  1YJ3 A;  1W2M A;  1C21 A;  2V6C A;  2P98 A;  4S01 A;  2BHA A;  2OKN A;  4FO8 A;  4IU6 A;  1WL6 A;  1KQ9 A;  5CE6 A;  1WN1 A;  1JAW A;  2GG9 A;  2GU4 A;  1XGN A;  3PKC A;  1XNZ A;  4IKR A;  4S00 A;  1M35 A;  1R58 A;  2MAT A;  1Y1N A;  3BIT A;  1R5G A;  2BWV A;  1QXW A;  2GG8 A;  3TB5 A;  1QXY A;  1MAT A;  3IU9 A;  1KP0 A;  4IF7 A;  3MX6 A;  5CLS A;  5CDV A;  4R60 A;  5CDL A;  3L24 A;  4IPA A;  5D6F A;  2BWY A;  4EGE A;  1YW7 A;  2BN7 A;  4FLJ A;  4IKT A;  1N51 A;  2BWS A;  2Q95 A;  4ZWU A;  1KQ0 A;  2NQ6 A;  2GG0 A;  3IU8 A;  2V3X A;  4IEC A;  2DFI A;  1XGS A;  4PV4 A;  1YW9 A;  1B6A A;  4S2R P;  1C27 A;  1WLR A;  4IKU A;  1WKM A;  1PV9 A;  2HOW A;  1QZY A;  3CTZ A;  4KM3 A;  2GGB A;  5JHU A;  2GU5 A;  1XGM A;  2GG5 A;  4A6V A;  3TAV A;  3FMQ A;  1C22 A;  3CB6 A;  5CNX A;  4RGZ 1;  4A6W A;  1R5H A;  2GU7 A;  2Q94 A;  5D6E A;  2GZ5 A;  3BIQ A;  4U6J A;  4U73 A;  1WBQ A;  1WY2 A;  2BH3 A;  2EVM A;  1C23 A;  3CB5 A;  4IDY A;  2GTX A;  2BWW A;  4FO7 A;  4ZNG A;  2ADU A;  2BWU A;  1O0X A;  2GU6 A;  3IG4 A;  3Q6D A;  4U70 A;  3PKA A;  2P99 A;  2V3Y A;  4U6W A;  2EVO A;  3RVA A;  1YW8 A;  2ZSG A;  5CIK A;  2BB7 A;  4S2T P;  2GGC A;  1QXZ A;  3L7G A;  4PNC A;  3S6B A;  4FLK A;  2NQ7 A;  4U1B A;  1YVM A;  4U75 A;  5CDE A;  4U6E A;  4QR8 A;  1A16 A;  1CHM A;  3FMR A;  3PKE A;  4U76 A;  2Q8K A;  2BHD A;  4IKS A;  2BWT A;  4B28 A;  1B59 A;  4U71 A;  4U6Z A;  2BHB A;  3FM3 A;  2BHC A;  2GG2 A;  2EA4 A;  2GG3 A;  2G6P A;  3IU7 A;  4OOK A;  4MAT A;  4FLI A;  2EVC A;  4Z7M A;  2Q93 A;  3BIP A;  2B3K A;  2OAZ A;  4ZWO A;  4FLL A;  4U69 A;  3PKB A;  2Q96 A;  2V3Z A;  2P9A A;  2B3L A; 
#chains in the Genus database with same CATH homology
 4JUQ A;  1XGO A;  1C24 A;  5FCF A;  4ZWP A;  2EA2 A;  4RZZ A;  5JI6 A;  3D27 A;  3MAT A;  4RZY A;  2IW2 A;  4HXX A;  3ROR A;  3PKD A;  1W7V A;  2BWX A;  4FKC A;  3MR1 A;  2Q92 A;  5FCH A;  1BN5 A;  5E5B A;  2GA2 A;  1WL9 A;  5JFR A;  2GG7 A;  2B3H A;  4U6C A;  4FUK A;  1BOA A;  1YJ3 A;  1W2M A;  1C21 A;  2V6C A;  2P98 A;  4S01 A;  2BHA A;  2OKN A;  4FO8 A;  4IU6 A;  1WL6 A;  1KQ9 A;  5CE6 A;  1WN1 A;  1JAW A;  2GG9 A;  2GU4 A;  1XGN A;  3PKC A;  1XNZ A;  4IKR A;  4S00 A;  1M35 A;  1R58 A;  2MAT A;  1Y1N A;  3BIT A;  1R5G A;  2BWV A;  1QXW A;  2GG8 A;  3TB5 A;  1QXY A;  1MAT A;  3IU9 A;  1KP0 A;  4IF7 A;  3MX6 A;  5CLS A;  5CDV A;  4R60 A;  5CDL A;  3L24 A;  4IPA A;  5D6F A;  2BWY A;  4EGE A;  1YW7 A;  2BN7 A;  4FLJ A;  4IKT A;  1N51 A;  2BWS A;  2Q95 A;  4ZWU A;  1KQ0 A;  2NQ6 A;  2GG0 A;  3IU8 A;  2V3X A;  4IEC A;  2DFI A;  1XGS A;  4PV4 A;  1YW9 A;  1B6A A;  4S2R P;  1C27 A;  1WLR A;  4IKU A;  1WKM A;  1PV9 A;  2HOW A;  1QZY A;  3CTZ A;  4KM3 A;  2GGB A;  5JHU A;  2GU5 A;  1XGM A;  2GG5 A;  4A6V A;  3TAV A;  3FMQ A;  1C22 A;  3CB6 A;  5CNX A;  4RGZ 1;  4A6W A;  1R5H A;  2GU7 A;  2Q94 A;  5D6E A;  2GZ5 A;  3BIQ A;  4U6J A;  4U73 A;  1WBQ A;  1WY2 A;  2BH3 A;  2EVM A;  1C23 A;  3CB5 A;  4IDY A;  2GTX A;  2BWW A;  4FO7 A;  4ZNG A;  2ADU A;  2BWU A;  1O0X A;  2GU6 A;  3IG4 A;  3Q6D A;  4U70 A;  3PKA A;  2P99 A;  2V3Y A;  4U6W A;  2EVO A;  3RVA A;  1YW8 A;  2ZSG A;  5CIK A;  2BB7 A;  4S2T P;  2GGC A;  1QXZ A;  3L7G A;  4PNC A;  3S6B A;  4FLK A;  2NQ7 A;  4U1B A;  1YVM A;  4U75 A;  5CDE A;  4U6E A;  4QR8 A;  1A16 A;  1CHM A;  3FMR A;  3PKE A;  4U76 A;  2Q8K A;  2BHD A;  4IKS A;  2BWT A;  4B28 A;  1B59 A;  4U71 A;  4U6Z A;  2BHB A;  3FM3 A;  2BHC A;  2GG2 A;  2EA4 A;  2GG3 A;  2G6P A;  3IU7 A;  4OOK A;  4MAT A;  4FLI A;  2EVC A;  4Z7M A;  2Q93 A;  3BIP A;  2B3K A;  2OAZ A;  4ZWO A;  4FLL A;  4U69 A;  3PKB A;  2Q96 A;  2V3Z A;  2P9A A;  2B3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...