2BB7A

Mn form of e. coli methionine aminopeptidase in complex with a quinolinyl sulfonamide inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
258
structure length
258
Chain Sequence
b'IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Metal mediated inhibition of methionine aminopeptidase by quinolinyl sulfonamides
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 84
structure length 258
sequence length 258
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bb7A00
5FCHA 3BITA 1C22A 2ZSGA 2BHAA 4FUKA 1WLRA 4IF7A 4IKTA 5JI6A 4IKSA 4A6VA 4OOKA 5JFRA 4IECA 4FKCA 5D6FA 4ZWOA 3RVAA 2ADUA 5CNXA 4A6WA 1M35A 4FLKA 4U6CA 4U71A 4ZNGA 1YW8A 2Q93A 1QZYA 2DFIA 3L7GA 3PKBA 1WN1A 1R58A 1WY2A 1QXYA 2BWTA 1QXZA 1R5HA 4U6EA 2IW2A 2EVCA 4U6ZA 3PKDA 4Z7MA 1YW7A 1N51A 1WKMA 2BHDA 1R5GA 2GU7A 5FCFA 4U6WA 2V3YA 3PKCA 2P98A 2V3XA 1W7VA 1B59A 2GU5A 4U6JA 4RGZ1 2OAZA 4U69A 4S01A 2BB7A 4S2RP 2GZ5A 3PKEA 2P9AA 2EA4A 4B28A 5CE6A 3TAVA 2BHCA 1WL9A 5CLSA 2Q96A 4S2TP 4EGEA 4U1BA 2BWWA 2B3LA 2EA2A 3RORA 2Q8KA 3BIPA 2BH3A 2BWYA 2V3ZA 2HOWA 1C23A 1JAWA 5CDEA 3D27A 4U75A 2BWXA 1B6AA 2GG7A 1C24A 3IG4A 1KQ9A 1MATA 2GU4A 2G6PA 2EVMA 1QXWA 2GTXA 3Q6DA 2GG3A 2GG9A 3FMRA 3FM3A 3FMQA 4IKRA 1C27A 2MATA 4IPAA 3CTZA 4IU6A 3IU8A 4PV4A 2V6CA 4JUQA 4R60A 5CIKA 2BHBA 4FLLA 3IU7A 1BOAA 1A16A 4RZYA 2BWSA 2OKNA 4FLJA 4U73A 2Q94A 5CDVA 4U70A 5E5BA 4U76A 1XGSA 2BN7A 4ZWUA 3TB5A 1KP0A 1WL6A 3CB6A 2GG5A 1W2MA 4IKUA 4S00A 5D6EA 4FO7A 2GGCA 1XNZA 2Q95A 2GG2A 2GA2A 1CHMA 2NQ7A 3MATA 4IDYA 4KM3A 4MATA 3BIQA 3L24A 1C21A 2B3KA 2EVOA 2GG8A 2GG0A 3MR1A 4QR8A 4FO8A 3PKAA 1XGNA 1KQ0A 4HXXA 5JHUA 3CB5A 1YW9A 3S6BA 1PV9A 2GU6A 1YJ3A 2BWUA 4RZZA 4ZWPA 1BN5A 1XGOA 1WBQA 1YVMA 2B3HA 1XGMA 2GGBA 2Q92A 2BWVA 3IU9A 1Y1NA 1O0XA 4PNCA 5CDLA 2P99A 2NQ6A 4FLIA 3MX6A
chains in the Genus database with same CATH superfamily
5FCHA 3BITA 1C22A 2ZSGA 2BHAA 4FUKA 1WLRA 4IF7A 4IKTA 5JI6A 4IKSA 4A6VA 4OOKA 5JFRA 4IECA 4FKCA 5D6FA 4ZWOA 3RVAA 2ADUA 5CNXA 4A6WA 1M35A 4FLKA 4U6CA 4U71A 4ZNGA 1YW8A 2Q93A 1QZYA 2DFIA 3L7GA 3PKBA 1WN1A 1R58A 1WY2A 1QXYA 2BWTA 1QXZA 1R5HA 4U6EA 2IW2A 2EVCA 4U6ZA 3PKDA 4Z7MA 1YW7A 1N51A 1WKMA 2BHDA 1R5GA 2GU7A 5FCFA 4U6WA 2V3YA 3PKCA 2P98A 2V3XA 1W7VA 1B59A 2GU5A 4U6JA 4RGZ1 2OAZA 4U69A 4S01A 2BB7A 4S2RP 2GZ5A 3PKEA 2P9AA 2EA4A 4B28A 5CE6A 3TAVA 2BHCA 1WL9A 5CLSA 2Q96A 4S2TP 4EGEA 4U1BA 2BWWA 2B3LA 2EA2A 3RORA 2Q8KA 3BIPA 2BH3A 2BWYA 2V3ZA 2HOWA 1C23A 1JAWA 5CDEA 3D27A 4U75A 2BWXA 1B6AA 2GG7A 1C24A 3IG4A 1KQ9A 1MATA 2GU4A 2G6PA 2EVMA 1QXWA 2GTXA 3Q6DA 2GG3A 2GG9A 3FMRA 3FM3A 3FMQA 4IKRA 1C27A 2MATA 4IPAA 3CTZA 4IU6A 3IU8A 4PV4A 2V6CA 4JUQA 4R60A 5CIKA 2BHBA 4FLLA 3IU7A 1BOAA 1A16A 4RZYA 2BWSA 2OKNA 4FLJA 4U73A 2Q94A 5CDVA 4U70A 5E5BA 4U76A 1XGSA 2BN7A 4ZWUA 3TB5A 1KP0A 1WL6A 3CB6A 2GG5A 1W2MA 4IKUA 4S00A 5D6EA 4FO7A 2GGCA 1XNZA 2Q95A 2GG2A 2GA2A 1CHMA 2NQ7A 3MATA 4IDYA 4KM3A 4MATA 3BIQA 3L24A 1C21A 2B3KA 2EVOA 2GG8A 2GG0A 3MR1A 4QR8A 4FO8A 3PKAA 1XGNA 1KQ0A 4HXXA 5JHUA 3CB5A 1YW9A 3S6BA 1PV9A 2GU6A 1YJ3A 2BWUA 4RZZA 4ZWPA 1BN5A 1XGOA 1WBQA 1YVMA 2B3HA 1XGMA 2GGBA 2Q92A 2BWVA 3IU9A 1Y1NA 1O0XA 4PNCA 5CDLA 2P99A 2NQ6A 4FLIA 3MX6A
chains in the Genus database with same CATH topology
5FCHA 3BITA 1C22A 2ZSGA 2BHAA 4FUKA 1WLRA 4IF7A 4IKTA 5JI6A 4IKSA 4A6VA 4OOKA 5JFRA 4IECA 4FKCA 5D6FA 4ZWOA 3RVAA 2ADUA 5CNXA 4A6WA 1M35A 4FLKA 4U6CA 4U71A 4ZNGA 1YW8A 2Q93A 1QZYA 2DFIA 3L7GA 3PKBA 1WN1A 1R58A 1WY2A 1QXYA 2BWTA 1QXZA 1R5HA 4U6EA 2IW2A 2EVCA 4U6ZA 3PKDA 4Z7MA 1YW7A 1N51A 1WKMA 2BHDA 1R5GA 2GU7A 5FCFA 4U6WA 2V3YA 3PKCA 2P98A 2V3XA 1W7VA 1B59A 2GU5A 4U6JA 4RGZ1 2OAZA 4U69A 4S01A 2BB7A 4S2RP 2GZ5A 3PKEA 2P9AA 2EA4A 4B28A 5CE6A 3TAVA 2BHCA 1WL9A 5CLSA 2Q96A 4S2TP 4EGEA 4U1BA 2BWWA 2B3LA 2EA2A 3RORA 2Q8KA 3BIPA 2BH3A 2BWYA 2V3ZA 2HOWA 1C23A 1JAWA 5CDEA 3D27A 4U75A 2BWXA 1B6AA 2GG7A 1C24A 3IG4A 1KQ9A 1MATA 2GU4A 2G6PA 2EVMA 1QXWA 2GTXA 3Q6DA 2GG3A 2GG9A 3FMRA 3FM3A 3FMQA 4IKRA 1C27A 2MATA 4IPAA 3CTZA 4IU6A 3IU8A 4PV4A 2V6CA 4JUQA 4R60A 5CIKA 2BHBA 4FLLA 3IU7A 1BOAA 1A16A 4RZYA 2BWSA 2OKNA 4FLJA 4U73A 2Q94A 5CDVA 4U70A 5E5BA 4U76A 1XGSA 2BN7A 4ZWUA 3TB5A 1KP0A 1WL6A 3CB6A 2GG5A 1W2MA 4IKUA 4S00A 5D6EA 4FO7A 2GGCA 1XNZA 2Q95A 2GG2A 2GA2A 1CHMA 2NQ7A 3MATA 4IDYA 4KM3A 4MATA 3BIQA 3L24A 1C21A 2B3KA 2EVOA 2GG8A 2GG0A 3MR1A 4QR8A 4FO8A 3PKAA 1XGNA 1KQ0A 4HXXA 5JHUA 3CB5A 1YW9A 3S6BA 1PV9A 2GU6A 1YJ3A 2BWUA 4RZZA 4ZWPA 1BN5A 1XGOA 1WBQA 1YVMA 2B3HA 1XGMA 2GGBA 2Q92A 2BWVA 3IU9A 1Y1NA 1O0XA 4PNCA 5CDLA 2P99A 2NQ6A 4FLIA 3MX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FCH A;  3BIT A;  1C22 A;  2ZSG A;  2BHA A;  4FUK A;  1WLR A;  4IF7 A;  4IKT A;  5JI6 A;  4IKS A;  4A6V A;  4OOK A;  5JFR A;  4IEC A;  4FKC A;  5D6F A;  4ZWO A;  3RVA A;  2ADU A;  5CNX A;  4A6W A;  1M35 A;  4FLK A;  4U6C A;  4U71 A;  4ZNG A;  1YW8 A;  2Q93 A;  1QZY A;  2DFI A;  3L7G A;  3PKB A;  1WN1 A;  1R58 A;  1WY2 A;  1QXY A;  2BWT A;  1QXZ A;  1R5H A;  4U6E A;  2IW2 A;  2EVC A;  4U6Z A;  3PKD A;  4Z7M A;  1YW7 A;  1N51 A;  1WKM A;  2BHD A;  1R5G A;  2GU7 A;  5FCF A;  4U6W A;  2V3Y A;  3PKC A;  2P98 A;  2V3X A;  1W7V A;  1B59 A;  2GU5 A;  4U6J A;  4RGZ 1;  2OAZ A;  4U69 A;  4S01 A;  2BB7 A;  4S2R P;  2GZ5 A;  3PKE A;  2P9A A;  2EA4 A;  4B28 A;  5CE6 A;  3TAV A;  2BHC A;  1WL9 A;  5CLS A;  2Q96 A;  4S2T P;  4EGE A;  4U1B A;  2BWW A;  2B3L A;  2EA2 A;  3ROR A;  2Q8K A;  3BIP A;  2BH3 A;  2BWY A;  2V3Z A;  2HOW A;  1C23 A;  1JAW A;  5CDE A;  3D27 A;  4U75 A;  2BWX A;  1B6A A;  2GG7 A;  1C24 A;  3IG4 A;  1KQ9 A;  1MAT A;  2GU4 A;  2G6P A;  2EVM A;  1QXW A;  2GTX A;  3Q6D A;  2GG3 A;  2GG9 A;  3FMR A;  3FM3 A;  3FMQ A;  4IKR A;  1C27 A;  2MAT A;  4IPA A;  3CTZ A;  4IU6 A;  3IU8 A;  4PV4 A;  2V6C A;  4JUQ A;  4R60 A;  5CIK A;  2BHB A;  4FLL A;  3IU7 A;  1BOA A;  1A16 A;  4RZY A;  2BWS A;  2OKN A;  4FLJ A;  4U73 A;  2Q94 A;  5CDV A;  4U70 A;  5E5B A;  4U76 A;  1XGS A;  2BN7 A;  4ZWU A;  3TB5 A;  1KP0 A;  1WL6 A;  3CB6 A;  2GG5 A;  1W2M A;  4IKU A;  4S00 A;  5D6E A;  4FO7 A;  2GGC A;  1XNZ A;  2Q95 A;  2GG2 A;  2GA2 A;  1CHM A;  2NQ7 A;  3MAT A;  4IDY A;  4KM3 A;  4MAT A;  3BIQ A;  3L24 A;  1C21 A;  2B3K A;  2EVO A;  2GG8 A;  2GG0 A;  3MR1 A;  4QR8 A;  4FO8 A;  3PKA A;  1XGN A;  1KQ0 A;  4HXX A;  5JHU A;  3CB5 A;  1YW9 A;  3S6B A;  1PV9 A;  2GU6 A;  1YJ3 A;  2BWU A;  4RZZ A;  4ZWP A;  1BN5 A;  1XGO A;  1WBQ A;  1YVM A;  2B3H A;  1XGM A;  2GGB A;  2Q92 A;  2BWV A;  3IU9 A;  1Y1N A;  1O0X A;  4PNC A;  5CDL A;  2P99 A;  2NQ6 A;  4FLI A;  3MX6 A; 
#chains in the Genus database with same CATH topology
 5FCH A;  3BIT A;  1C22 A;  2ZSG A;  2BHA A;  4FUK A;  1WLR A;  4IF7 A;  4IKT A;  5JI6 A;  4IKS A;  4A6V A;  4OOK A;  5JFR A;  4IEC A;  4FKC A;  5D6F A;  4ZWO A;  3RVA A;  2ADU A;  5CNX A;  4A6W A;  1M35 A;  4FLK A;  4U6C A;  4U71 A;  4ZNG A;  1YW8 A;  2Q93 A;  1QZY A;  2DFI A;  3L7G A;  3PKB A;  1WN1 A;  1R58 A;  1WY2 A;  1QXY A;  2BWT A;  1QXZ A;  1R5H A;  4U6E A;  2IW2 A;  2EVC A;  4U6Z A;  3PKD A;  4Z7M A;  1YW7 A;  1N51 A;  1WKM A;  2BHD A;  1R5G A;  2GU7 A;  5FCF A;  4U6W A;  2V3Y A;  3PKC A;  2P98 A;  2V3X A;  1W7V A;  1B59 A;  2GU5 A;  4U6J A;  4RGZ 1;  2OAZ A;  4U69 A;  4S01 A;  2BB7 A;  4S2R P;  2GZ5 A;  3PKE A;  2P9A A;  2EA4 A;  4B28 A;  5CE6 A;  3TAV A;  2BHC A;  1WL9 A;  5CLS A;  2Q96 A;  4S2T P;  4EGE A;  4U1B A;  2BWW A;  2B3L A;  2EA2 A;  3ROR A;  2Q8K A;  3BIP A;  2BH3 A;  2BWY A;  2V3Z A;  2HOW A;  1C23 A;  1JAW A;  5CDE A;  3D27 A;  4U75 A;  2BWX A;  1B6A A;  2GG7 A;  1C24 A;  3IG4 A;  1KQ9 A;  1MAT A;  2GU4 A;  2G6P A;  2EVM A;  1QXW A;  2GTX A;  3Q6D A;  2GG3 A;  2GG9 A;  3FMR A;  3FM3 A;  3FMQ A;  4IKR A;  1C27 A;  2MAT A;  4IPA A;  3CTZ A;  4IU6 A;  3IU8 A;  4PV4 A;  2V6C A;  4JUQ A;  4R60 A;  5CIK A;  2BHB A;  4FLL A;  3IU7 A;  1BOA A;  1A16 A;  4RZY A;  2BWS A;  2OKN A;  4FLJ A;  4U73 A;  2Q94 A;  5CDV A;  4U70 A;  5E5B A;  4U76 A;  1XGS A;  2BN7 A;  4ZWU A;  3TB5 A;  1KP0 A;  1WL6 A;  3CB6 A;  2GG5 A;  1W2M A;  4IKU A;  4S00 A;  5D6E A;  4FO7 A;  2GGC A;  1XNZ A;  2Q95 A;  2GG2 A;  2GA2 A;  1CHM A;  2NQ7 A;  3MAT A;  4IDY A;  4KM3 A;  4MAT A;  3BIQ A;  3L24 A;  1C21 A;  2B3K A;  2EVO A;  2GG8 A;  2GG0 A;  3MR1 A;  4QR8 A;  4FO8 A;  3PKA A;  1XGN A;  1KQ0 A;  4HXX A;  5JHU A;  3CB5 A;  1YW9 A;  3S6B A;  1PV9 A;  2GU6 A;  1YJ3 A;  2BWU A;  4RZZ A;  4ZWP A;  1BN5 A;  1XGO A;  1WBQ A;  1YVM A;  2B3H A;  1XGM A;  2GGB A;  2Q92 A;  2BWV A;  3IU9 A;  1Y1N A;  1O0X A;  4PNC A;  5CDL A;  2P99 A;  2NQ6 A;  4FLI A;  3MX6 A; 
#chains in the Genus database with same CATH homology
 5FCH A;  3BIT A;  1C22 A;  2ZSG A;  2BHA A;  4FUK A;  1WLR A;  4IF7 A;  4IKT A;  5JI6 A;  4IKS A;  4A6V A;  4OOK A;  5JFR A;  4IEC A;  4FKC A;  5D6F A;  4ZWO A;  3RVA A;  2ADU A;  5CNX A;  4A6W A;  1M35 A;  4FLK A;  4U6C A;  4U71 A;  4ZNG A;  1YW8 A;  2Q93 A;  1QZY A;  2DFI A;  3L7G A;  3PKB A;  1WN1 A;  1R58 A;  1WY2 A;  1QXY A;  2BWT A;  1QXZ A;  1R5H A;  4U6E A;  2IW2 A;  2EVC A;  4U6Z A;  3PKD A;  4Z7M A;  1YW7 A;  1N51 A;  1WKM A;  2BHD A;  1R5G A;  2GU7 A;  5FCF A;  4U6W A;  2V3Y A;  3PKC A;  2P98 A;  2V3X A;  1W7V A;  1B59 A;  2GU5 A;  4U6J A;  4RGZ 1;  2OAZ A;  4U69 A;  4S01 A;  2BB7 A;  4S2R P;  2GZ5 A;  3PKE A;  2P9A A;  2EA4 A;  4B28 A;  5CE6 A;  3TAV A;  2BHC A;  1WL9 A;  5CLS A;  2Q96 A;  4S2T P;  4EGE A;  4U1B A;  2BWW A;  2B3L A;  2EA2 A;  3ROR A;  2Q8K A;  3BIP A;  2BH3 A;  2BWY A;  2V3Z A;  2HOW A;  1C23 A;  1JAW A;  5CDE A;  3D27 A;  4U75 A;  2BWX A;  1B6A A;  2GG7 A;  1C24 A;  3IG4 A;  1KQ9 A;  1MAT A;  2GU4 A;  2G6P A;  2EVM A;  1QXW A;  2GTX A;  3Q6D A;  2GG3 A;  2GG9 A;  3FMR A;  3FM3 A;  3FMQ A;  4IKR A;  1C27 A;  2MAT A;  4IPA A;  3CTZ A;  4IU6 A;  3IU8 A;  4PV4 A;  2V6C A;  4JUQ A;  4R60 A;  5CIK A;  2BHB A;  4FLL A;  3IU7 A;  1BOA A;  1A16 A;  4RZY A;  2BWS A;  2OKN A;  4FLJ A;  4U73 A;  2Q94 A;  5CDV A;  4U70 A;  5E5B A;  4U76 A;  1XGS A;  2BN7 A;  4ZWU A;  3TB5 A;  1KP0 A;  1WL6 A;  3CB6 A;  2GG5 A;  1W2M A;  4IKU A;  4S00 A;  5D6E A;  4FO7 A;  2GGC A;  1XNZ A;  2Q95 A;  2GG2 A;  2GA2 A;  1CHM A;  2NQ7 A;  3MAT A;  4IDY A;  4KM3 A;  4MAT A;  3BIQ A;  3L24 A;  1C21 A;  2B3K A;  2EVO A;  2GG8 A;  2GG0 A;  3MR1 A;  4QR8 A;  4FO8 A;  3PKA A;  1XGN A;  1KQ0 A;  4HXX A;  5JHU A;  3CB5 A;  1YW9 A;  3S6B A;  1PV9 A;  2GU6 A;  1YJ3 A;  2BWU A;  4RZZ A;  4ZWP A;  1BN5 A;  1XGO A;  1WBQ A;  1YVM A;  2B3H A;  1XGM A;  2GGB A;  2Q92 A;  2BWV A;  3IU9 A;  1Y1N A;  1O0X A;  4PNC A;  5CDL A;  2P99 A;  2NQ6 A;  4FLI A;  3MX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...