2BB7A

Mn form of e. coli methionine aminopeptidase in complex with a quinolinyl sulfonamide inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
258
structure length
258
Chain Sequence
IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Metal mediated inhibition of methionine aminopeptidase by quinolinyl sulfonamides
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 258
sequence length 258
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bb7A00
4U70A 2V3YA 4B28A 4RZYA 2EVCA 2ADUA 4A6VA 5JHUA 1WN1A 1BOAA 4U6EA 2BWWA 2GZ5A 2P9AA 5CDVA 2BWVA 5D6FA 4KM3A 3FMRA 3CB5A 4S2RP 5CIKA 5D6EA 1R58A 3BIPA 2GTXA 1PV9A 1MATA 1B59A 4FKCA 1KP0A 4U6WA 1WL6A 3CTZA 2OKNA 4Z7MA 3IU8A 4U71A 4IKSA 4ZWOA 5CNXA 5FCHA 1O0XA 4S00A 2GGBA 1XGOA 1QXWA 1XGMA 4RZZA 1W7VA 2G6PA 2GU4A 4QR8A 4S01A 1BN5A 2BHAA 2EVOA 1KQ0A 1JAWA 5CDEA 4IKTA 4EGEA 2GG5A 2B3LA 2Q96A 2HOWA 4IECA 1WL9A 3BITA 3FM3A 5CE6A 4RGZ1 4HXXA 2BWSA 4U75A 2BWTA 3L24A 4ZNGA 1WY2A 3Q6DA 1WKMA 3MATA 1M35A 4U6ZA 3PKEA 1R5GA 4FO8A 2GGCA 2BHDA 4U73A 2BWXA 2NQ6A 4PNCA 2Q94A 3FMQA 2GG3A 3D27A 5JI6A 2GU7A 2GG2A 5JFRA 5E5BA 2GG7A 4IF7A 3TAVA 1WLRA 1C21A 2Q95A 4MATA 4S2TP 2BWUA 3PKCA 1XNZA 1KQ9A 2V3XA 4FLIA 4R60A 2B3HA 1A16A 3MR1A 2EVMA 5FCFA 3L7GA 4IKRA 2GU6A 1YW8A 4FO7A 4IDYA 4IU6A 4FLKA 2P99A 2NQ7A 2GG0A 3PKBA 4U1BA 2ZSGA 2Q8KA 4PV4A 1QZYA 2Q93A 4U69A 2EA2A 2P98A 4ZWUA 1QXYA 2B3KA 2BH3A 2V6CA 4FLJA 2GA2A 3PKAA 2DFIA 1N51A 1YJ3A 1R5HA 1Y1NA 2MATA 4FLLA 4IKUA 2BHBA 4U6JA 2BWYA 1CHMA 1C22A 2GU5A 2V3ZA 1YW7A 1QXZA 3IU9A 3PKDA 3TB5A 2BB7A 1C23A 2GG9A 3S6BA 3IG4A 1WBQA 2IW2A 1C27A 1XGSA 4IPAA 4U6CA 1C24A 3MX6A 4FUKA 1W2MA 2Q92A 2OAZA 3BIQA 4ZWPA 1YVMA 4U76A 4JUQA 2BHCA 1XGNA 5CDLA 1B6AA 1YW9A 3RORA 5CLSA 2BN7A 3CB6A 3IU7A 3RVAA 4A6WA 2EA4A 4OOKA 2GG8A
chains in the Genus database with same CATH superfamily
4U70A 2V3YA 4B28A 4RZYA 2EVCA 2ADUA 4A6VA 5JHUA 1WN1A 1BOAA 4U6EA 2BWWA 2GZ5A 2P9AA 5CDVA 2BWVA 5D6FA 4KM3A 3FMRA 3CB5A 4S2RP 5CIKA 5D6EA 1R58A 3BIPA 2GTXA 1PV9A 1MATA 1B59A 4FKCA 1KP0A 4U6WA 1WL6A 3CTZA 2OKNA 4Z7MA 3IU8A 4U71A 4IKSA 4ZWOA 5CNXA 5FCHA 1O0XA 4S00A 2GGBA 1XGOA 1QXWA 1XGMA 4RZZA 1W7VA 2G6PA 2GU4A 4QR8A 4S01A 1BN5A 2BHAA 2EVOA 1KQ0A 1JAWA 5CDEA 4IKTA 4EGEA 2GG5A 2B3LA 2Q96A 2HOWA 4IECA 1WL9A 3BITA 3FM3A 5CE6A 4RGZ1 4HXXA 2BWSA 4U75A 2BWTA 3L24A 4ZNGA 1WY2A 3Q6DA 1WKMA 3MATA 1M35A 4U6ZA 3PKEA 1R5GA 4FO8A 2GGCA 2BHDA 4U73A 2BWXA 2NQ6A 4PNCA 2Q94A 3FMQA 2GG3A 3D27A 5JI6A 2GU7A 2GG2A 5JFRA 5E5BA 2GG7A 4IF7A 3TAVA 1WLRA 1C21A 2Q95A 4MATA 4S2TP 2BWUA 3PKCA 1XNZA 1KQ9A 2V3XA 4FLIA 4R60A 2B3HA 1A16A 3MR1A 2EVMA 5FCFA 3L7GA 4IKRA 2GU6A 1YW8A 4FO7A 4IDYA 4IU6A 4FLKA 2P99A 2NQ7A 2GG0A 3PKBA 4U1BA 2ZSGA 2Q8KA 4PV4A 1QZYA 2Q93A 4U69A 2EA2A 2P98A 4ZWUA 1QXYA 2B3KA 2BH3A 2V6CA 4FLJA 2GA2A 3PKAA 2DFIA 1N51A 1YJ3A 1R5HA 1Y1NA 2MATA 4FLLA 4IKUA 2BHBA 4U6JA 2BWYA 1CHMA 1C22A 2GU5A 2V3ZA 1YW7A 1QXZA 3IU9A 3PKDA 3TB5A 2BB7A 1C23A 2GG9A 3S6BA 3IG4A 1WBQA 2IW2A 1C27A 1XGSA 4IPAA 4U6CA 1C24A 3MX6A 4FUKA 1W2MA 2Q92A 2OAZA 3BIQA 4ZWPA 1YVMA 4U76A 4JUQA 2BHCA 1XGNA 5CDLA 1B6AA 1YW9A 3RORA 5CLSA 2BN7A 3CB6A 3IU7A 3RVAA 4A6WA 2EA4A 4OOKA 2GG8A
chains in the Genus database with same CATH topology
4U70A 2V3YA 4B28A 4RZYA 2EVCA 2ADUA 4A6VA 5JHUA 1WN1A 1BOAA 4U6EA 2BWWA 2GZ5A 2P9AA 5CDVA 2BWVA 5D6FA 4KM3A 3FMRA 3CB5A 4S2RP 5CIKA 5D6EA 1R58A 3BIPA 2GTXA 1PV9A 1MATA 1B59A 4FKCA 1KP0A 4U6WA 1WL6A 3CTZA 2OKNA 4Z7MA 3IU8A 4U71A 4IKSA 4ZWOA 5CNXA 5FCHA 1O0XA 4S00A 2GGBA 1XGOA 1QXWA 1XGMA 4RZZA 1W7VA 2G6PA 2GU4A 4QR8A 4S01A 1BN5A 2BHAA 2EVOA 1KQ0A 1JAWA 5CDEA 4IKTA 4EGEA 2GG5A 2B3LA 2Q96A 2HOWA 4IECA 1WL9A 3BITA 3FM3A 5CE6A 4RGZ1 4HXXA 2BWSA 4U75A 2BWTA 3L24A 4ZNGA 1WY2A 3Q6DA 1WKMA 3MATA 1M35A 4U6ZA 3PKEA 1R5GA 4FO8A 2GGCA 2BHDA 4U73A 2BWXA 2NQ6A 4PNCA 2Q94A 3FMQA 2GG3A 3D27A 5JI6A 2GU7A 2GG2A 5JFRA 5E5BA 2GG7A 4IF7A 3TAVA 1WLRA 1C21A 2Q95A 4MATA 4S2TP 2BWUA 3PKCA 1XNZA 1KQ9A 2V3XA 4FLIA 4R60A 2B3HA 1A16A 3MR1A 2EVMA 5FCFA 3L7GA 4IKRA 2GU6A 1YW8A 4FO7A 4IDYA 4IU6A 4FLKA 2P99A 2NQ7A 2GG0A 3PKBA 4U1BA 2ZSGA 2Q8KA 4PV4A 1QZYA 2Q93A 4U69A 2EA2A 2P98A 4ZWUA 1QXYA 2B3KA 2BH3A 2V6CA 4FLJA 2GA2A 3PKAA 2DFIA 1N51A 1YJ3A 1R5HA 1Y1NA 2MATA 4FLLA 4IKUA 2BHBA 4U6JA 2BWYA 1CHMA 1C22A 2GU5A 2V3ZA 1YW7A 1QXZA 3IU9A 3PKDA 3TB5A 2BB7A 1C23A 2GG9A 3S6BA 3IG4A 1WBQA 2IW2A 1C27A 1XGSA 4IPAA 4U6CA 1C24A 3MX6A 4FUKA 1W2MA 2Q92A 2OAZA 3BIQA 4ZWPA 1YVMA 4U76A 4JUQA 2BHCA 1XGNA 5CDLA 1B6AA 1YW9A 3RORA 5CLSA 2BN7A 3CB6A 3IU7A 3RVAA 4A6WA 2EA4A 4OOKA 2GG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U70 A;  2V3Y A;  4B28 A;  4RZY A;  2EVC A;  2ADU A;  4A6V A;  5JHU A;  1WN1 A;  1BOA A;  4U6E A;  2BWW A;  2GZ5 A;  2P9A A;  5CDV A;  2BWV A;  5D6F A;  4KM3 A;  3FMR A;  3CB5 A;  4S2R P;  5CIK A;  5D6E A;  1R58 A;  3BIP A;  2GTX A;  1PV9 A;  1MAT A;  1B59 A;  4FKC A;  1KP0 A;  4U6W A;  1WL6 A;  3CTZ A;  2OKN A;  4Z7M A;  3IU8 A;  4U71 A;  4IKS A;  4ZWO A;  5CNX A;  5FCH A;  1O0X A;  4S00 A;  2GGB A;  1XGO A;  1QXW A;  1XGM A;  4RZZ A;  1W7V A;  2G6P A;  2GU4 A;  4QR8 A;  4S01 A;  1BN5 A;  2BHA A;  2EVO A;  1KQ0 A;  1JAW A;  5CDE A;  4IKT A;  4EGE A;  2GG5 A;  2B3L A;  2Q96 A;  2HOW A;  4IEC A;  1WL9 A;  3BIT A;  3FM3 A;  5CE6 A;  4RGZ 1;  4HXX A;  2BWS A;  4U75 A;  2BWT A;  3L24 A;  4ZNG A;  1WY2 A;  3Q6D A;  1WKM A;  3MAT A;  1M35 A;  4U6Z A;  3PKE A;  1R5G A;  4FO8 A;  2GGC A;  2BHD A;  4U73 A;  2BWX A;  2NQ6 A;  4PNC A;  2Q94 A;  3FMQ A;  2GG3 A;  3D27 A;  5JI6 A;  2GU7 A;  2GG2 A;  5JFR A;  5E5B A;  2GG7 A;  4IF7 A;  3TAV A;  1WLR A;  1C21 A;  2Q95 A;  4MAT A;  4S2T P;  2BWU A;  3PKC A;  1XNZ A;  1KQ9 A;  2V3X A;  4FLI A;  4R60 A;  2B3H A;  1A16 A;  3MR1 A;  2EVM A;  5FCF A;  3L7G A;  4IKR A;  2GU6 A;  1YW8 A;  4FO7 A;  4IDY A;  4IU6 A;  4FLK A;  2P99 A;  2NQ7 A;  2GG0 A;  3PKB A;  4U1B A;  2ZSG A;  2Q8K A;  4PV4 A;  1QZY A;  2Q93 A;  4U69 A;  2EA2 A;  2P98 A;  4ZWU A;  1QXY A;  2B3K A;  2BH3 A;  2V6C A;  4FLJ A;  2GA2 A;  3PKA A;  2DFI A;  1N51 A;  1YJ3 A;  1R5H A;  1Y1N A;  2MAT A;  4FLL A;  4IKU A;  2BHB A;  4U6J A;  2BWY A;  1CHM A;  1C22 A;  2GU5 A;  2V3Z A;  1YW7 A;  1QXZ A;  3IU9 A;  3PKD A;  3TB5 A;  2BB7 A;  1C23 A;  2GG9 A;  3S6B A;  3IG4 A;  1WBQ A;  2IW2 A;  1C27 A;  1XGS A;  4IPA A;  4U6C A;  1C24 A;  3MX6 A;  4FUK A;  1W2M A;  2Q92 A;  2OAZ A;  3BIQ A;  4ZWP A;  1YVM A;  4U76 A;  4JUQ A;  2BHC A;  1XGN A;  5CDL A;  1B6A A;  1YW9 A;  3ROR A;  5CLS A;  2BN7 A;  3CB6 A;  3IU7 A;  3RVA A;  4A6W A;  2EA4 A;  4OOK A;  2GG8 A; 
#chains in the Genus database with same CATH topology
 4U70 A;  2V3Y A;  4B28 A;  4RZY A;  2EVC A;  2ADU A;  4A6V A;  5JHU A;  1WN1 A;  1BOA A;  4U6E A;  2BWW A;  2GZ5 A;  2P9A A;  5CDV A;  2BWV A;  5D6F A;  4KM3 A;  3FMR A;  3CB5 A;  4S2R P;  5CIK A;  5D6E A;  1R58 A;  3BIP A;  2GTX A;  1PV9 A;  1MAT A;  1B59 A;  4FKC A;  1KP0 A;  4U6W A;  1WL6 A;  3CTZ A;  2OKN A;  4Z7M A;  3IU8 A;  4U71 A;  4IKS A;  4ZWO A;  5CNX A;  5FCH A;  1O0X A;  4S00 A;  2GGB A;  1XGO A;  1QXW A;  1XGM A;  4RZZ A;  1W7V A;  2G6P A;  2GU4 A;  4QR8 A;  4S01 A;  1BN5 A;  2BHA A;  2EVO A;  1KQ0 A;  1JAW A;  5CDE A;  4IKT A;  4EGE A;  2GG5 A;  2B3L A;  2Q96 A;  2HOW A;  4IEC A;  1WL9 A;  3BIT A;  3FM3 A;  5CE6 A;  4RGZ 1;  4HXX A;  2BWS A;  4U75 A;  2BWT A;  3L24 A;  4ZNG A;  1WY2 A;  3Q6D A;  1WKM A;  3MAT A;  1M35 A;  4U6Z A;  3PKE A;  1R5G A;  4FO8 A;  2GGC A;  2BHD A;  4U73 A;  2BWX A;  2NQ6 A;  4PNC A;  2Q94 A;  3FMQ A;  2GG3 A;  3D27 A;  5JI6 A;  2GU7 A;  2GG2 A;  5JFR A;  5E5B A;  2GG7 A;  4IF7 A;  3TAV A;  1WLR A;  1C21 A;  2Q95 A;  4MAT A;  4S2T P;  2BWU A;  3PKC A;  1XNZ A;  1KQ9 A;  2V3X A;  4FLI A;  4R60 A;  2B3H A;  1A16 A;  3MR1 A;  2EVM A;  5FCF A;  3L7G A;  4IKR A;  2GU6 A;  1YW8 A;  4FO7 A;  4IDY A;  4IU6 A;  4FLK A;  2P99 A;  2NQ7 A;  2GG0 A;  3PKB A;  4U1B A;  2ZSG A;  2Q8K A;  4PV4 A;  1QZY A;  2Q93 A;  4U69 A;  2EA2 A;  2P98 A;  4ZWU A;  1QXY A;  2B3K A;  2BH3 A;  2V6C A;  4FLJ A;  2GA2 A;  3PKA A;  2DFI A;  1N51 A;  1YJ3 A;  1R5H A;  1Y1N A;  2MAT A;  4FLL A;  4IKU A;  2BHB A;  4U6J A;  2BWY A;  1CHM A;  1C22 A;  2GU5 A;  2V3Z A;  1YW7 A;  1QXZ A;  3IU9 A;  3PKD A;  3TB5 A;  2BB7 A;  1C23 A;  2GG9 A;  3S6B A;  3IG4 A;  1WBQ A;  2IW2 A;  1C27 A;  1XGS A;  4IPA A;  4U6C A;  1C24 A;  3MX6 A;  4FUK A;  1W2M A;  2Q92 A;  2OAZ A;  3BIQ A;  4ZWP A;  1YVM A;  4U76 A;  4JUQ A;  2BHC A;  1XGN A;  5CDL A;  1B6A A;  1YW9 A;  3ROR A;  5CLS A;  2BN7 A;  3CB6 A;  3IU7 A;  3RVA A;  4A6W A;  2EA4 A;  4OOK A;  2GG8 A; 
#chains in the Genus database with same CATH homology
 4U70 A;  2V3Y A;  4B28 A;  4RZY A;  2EVC A;  2ADU A;  4A6V A;  5JHU A;  1WN1 A;  1BOA A;  4U6E A;  2BWW A;  2GZ5 A;  2P9A A;  5CDV A;  2BWV A;  5D6F A;  4KM3 A;  3FMR A;  3CB5 A;  4S2R P;  5CIK A;  5D6E A;  1R58 A;  3BIP A;  2GTX A;  1PV9 A;  1MAT A;  1B59 A;  4FKC A;  1KP0 A;  4U6W A;  1WL6 A;  3CTZ A;  2OKN A;  4Z7M A;  3IU8 A;  4U71 A;  4IKS A;  4ZWO A;  5CNX A;  5FCH A;  1O0X A;  4S00 A;  2GGB A;  1XGO A;  1QXW A;  1XGM A;  4RZZ A;  1W7V A;  2G6P A;  2GU4 A;  4QR8 A;  4S01 A;  1BN5 A;  2BHA A;  2EVO A;  1KQ0 A;  1JAW A;  5CDE A;  4IKT A;  4EGE A;  2GG5 A;  2B3L A;  2Q96 A;  2HOW A;  4IEC A;  1WL9 A;  3BIT A;  3FM3 A;  5CE6 A;  4RGZ 1;  4HXX A;  2BWS A;  4U75 A;  2BWT A;  3L24 A;  4ZNG A;  1WY2 A;  3Q6D A;  1WKM A;  3MAT A;  1M35 A;  4U6Z A;  3PKE A;  1R5G A;  4FO8 A;  2GGC A;  2BHD A;  4U73 A;  2BWX A;  2NQ6 A;  4PNC A;  2Q94 A;  3FMQ A;  2GG3 A;  3D27 A;  5JI6 A;  2GU7 A;  2GG2 A;  5JFR A;  5E5B A;  2GG7 A;  4IF7 A;  3TAV A;  1WLR A;  1C21 A;  2Q95 A;  4MAT A;  4S2T P;  2BWU A;  3PKC A;  1XNZ A;  1KQ9 A;  2V3X A;  4FLI A;  4R60 A;  2B3H A;  1A16 A;  3MR1 A;  2EVM A;  5FCF A;  3L7G A;  4IKR A;  2GU6 A;  1YW8 A;  4FO7 A;  4IDY A;  4IU6 A;  4FLK A;  2P99 A;  2NQ7 A;  2GG0 A;  3PKB A;  4U1B A;  2ZSG A;  2Q8K A;  4PV4 A;  1QZY A;  2Q93 A;  4U69 A;  2EA2 A;  2P98 A;  4ZWU A;  1QXY A;  2B3K A;  2BH3 A;  2V6C A;  4FLJ A;  2GA2 A;  3PKA A;  2DFI A;  1N51 A;  1YJ3 A;  1R5H A;  1Y1N A;  2MAT A;  4FLL A;  4IKU A;  2BHB A;  4U6J A;  2BWY A;  1CHM A;  1C22 A;  2GU5 A;  2V3Z A;  1YW7 A;  1QXZ A;  3IU9 A;  3PKD A;  3TB5 A;  2BB7 A;  1C23 A;  2GG9 A;  3S6B A;  3IG4 A;  1WBQ A;  2IW2 A;  1C27 A;  1XGS A;  4IPA A;  4U6C A;  1C24 A;  3MX6 A;  4FUK A;  1W2M A;  2Q92 A;  2OAZ A;  3BIQ A;  4ZWP A;  1YVM A;  4U76 A;  4JUQ A;  2BHC A;  1XGN A;  5CDL A;  1B6A A;  1YW9 A;  3ROR A;  5CLS A;  2BN7 A;  3CB6 A;  3IU7 A;  3RVA A;  4A6W A;  2EA4 A;  4OOK A;  2GG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...