2BB7A

Mn form of e. coli methionine aminopeptidase in complex with a quinolinyl sulfonamide inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
258
structure length
258
Chain Sequence
IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal mediated inhibition of methionine aminopeptidase by quinolinyl sulfonamides
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 258
sequence length 258
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bb7A00
1WLRA 2EA2A 3IU7A 4S2TP 1WL9A 2GU6A 4PNCA 2OKNA 1M35A 3CB5A 5FCHA 1KP0A 2BHBA 3L24A 4ZWOA 3Q6DA 4IDYA 5CDEA 1C24A 4Z7MA 1XGNA 5D6EA 2GG7A 1YVMA 3MR1A 1KQ9A 4KM3A 3IG4A 4U6JA 1QXWA 4FLLA 2DFIA 4R60A 4RGZ1 5CDLA 2BB7A 3IU9A 4IU6A 3PKDA 2Q96A 2GG0A 5CIKA 2BHAA 1WN1A 1BOAA 4U69A 4FLKA 1R58A 2P98A 5JFRA 4FUKA 4ZWPA 2NQ7A 4U6ZA 3TAVA 2Q92A 2GG9A 4U1BA 4U6CA 3PKCA 1XGSA 2GA2A 3BITA 4ZNGA 2GGCA 4FKCA 4FO8A 4PV4A 4S00A 2BWYA 2IW2A 4FLIA 3TB5A 4EGEA 3MATA 4U70A 2GG8A 1W7VA 1JAWA 2GG3A 2GG2A 2BH3A 4JUQA 4U71A 4B28A 4U73A 1R5HA 2BHCA 2BWXA 4U6WA 2BN7A 5JHUA 2BWSA 4RZYA 2GTXA 1Y1NA 3FMRA 2P99A 3PKBA 2NQ6A 4IKRA 2BWVA 2GU7A 2V3ZA 4IKSA 1N51A 3L7GA 1WL6A 1YW9A 2Q94A 1XNZA 2GG5A 1YW8A 2BWTA 1BN5A 4MATA 1A16A 4IKTA 1YW7A 2GZ5A 2ZSGA 5FCFA 2HOWA 2BWWA 1WKMA 2P9AA 4HXXA 3RORA 4FO7A 2Q93A 1C23A 1KQ0A 2V3YA 1C27A 1QXYA 1QZYA 2BHDA 4FLJA 4S2RP 1B59A 4U6EA 2BWUA 4A6VA 2OAZA 1MATA 1C22A 3FM3A 1QXZA 3BIPA 4IPAA 2ADUA 2G6PA 1C21A 2Q95A 1XGMA 3PKEA 4RZZA 1XGOA 4U75A 4U76A 2B3HA 4IECA 1WBQA 5E5BA 1B6AA 5CNXA 4OOKA 3RVAA 1O0XA 2EVOA 5D6FA 2GU5A 2EVMA 1R5GA 5JI6A 2B3KA 3S6BA 2V6CA 5CLSA 2Q8KA 4IKUA 3CTZA 3BIQA 3PKAA 4A6WA 3IU8A 2GGBA 2V3XA 3MX6A 4S01A 1PV9A 4IF7A 1W2MA 1CHMA 2EA4A 4QR8A 4ZWUA 3FMQA 5CDVA 3CB6A 5CE6A 3D27A 1WY2A 2GU4A 2EVCA 2B3LA 2MATA 1YJ3A
chains in the Genus database with same CATH superfamily
1WLRA 2EA2A 3IU7A 4S2TP 1WL9A 2GU6A 4PNCA 2OKNA 1M35A 3CB5A 5FCHA 1KP0A 2BHBA 3L24A 4ZWOA 3Q6DA 4IDYA 5CDEA 1C24A 4Z7MA 1XGNA 5D6EA 2GG7A 1YVMA 3MR1A 1KQ9A 4KM3A 3IG4A 4U6JA 1QXWA 4FLLA 2DFIA 4R60A 4RGZ1 5CDLA 2BB7A 3IU9A 4IU6A 3PKDA 2Q96A 2GG0A 5CIKA 2BHAA 1WN1A 1BOAA 4U69A 4FLKA 1R58A 2P98A 5JFRA 4FUKA 4ZWPA 2NQ7A 4U6ZA 3TAVA 2Q92A 2GG9A 4U1BA 4U6CA 3PKCA 1XGSA 2GA2A 3BITA 4ZNGA 2GGCA 4FKCA 4FO8A 4PV4A 4S00A 2BWYA 2IW2A 4FLIA 3TB5A 4EGEA 3MATA 4U70A 2GG8A 1W7VA 1JAWA 2GG3A 2GG2A 2BH3A 4JUQA 4U71A 4B28A 4U73A 1R5HA 2BHCA 2BWXA 4U6WA 2BN7A 5JHUA 2BWSA 4RZYA 2GTXA 1Y1NA 3FMRA 2P99A 3PKBA 2NQ6A 4IKRA 2BWVA 2GU7A 2V3ZA 4IKSA 1N51A 3L7GA 1WL6A 1YW9A 2Q94A 1XNZA 2GG5A 1YW8A 2BWTA 1BN5A 4MATA 1A16A 4IKTA 1YW7A 2GZ5A 2ZSGA 5FCFA 2HOWA 2BWWA 1WKMA 2P9AA 4HXXA 3RORA 4FO7A 2Q93A 1C23A 1KQ0A 2V3YA 1C27A 1QXYA 1QZYA 2BHDA 4FLJA 4S2RP 1B59A 4U6EA 2BWUA 4A6VA 2OAZA 1MATA 1C22A 3FM3A 1QXZA 3BIPA 4IPAA 2ADUA 2G6PA 1C21A 2Q95A 1XGMA 3PKEA 4RZZA 1XGOA 4U75A 4U76A 2B3HA 4IECA 1WBQA 5E5BA 1B6AA 5CNXA 4OOKA 3RVAA 1O0XA 2EVOA 5D6FA 2GU5A 2EVMA 1R5GA 5JI6A 2B3KA 3S6BA 2V6CA 5CLSA 2Q8KA 4IKUA 3CTZA 3BIQA 3PKAA 4A6WA 3IU8A 2GGBA 2V3XA 3MX6A 4S01A 1PV9A 4IF7A 1W2MA 1CHMA 2EA4A 4QR8A 4ZWUA 3FMQA 5CDVA 3CB6A 5CE6A 3D27A 1WY2A 2GU4A 2EVCA 2B3LA 2MATA 1YJ3A
chains in the Genus database with same CATH topology
1WLRA 2EA2A 3IU7A 4S2TP 1WL9A 2GU6A 4PNCA 2OKNA 1M35A 3CB5A 5FCHA 1KP0A 2BHBA 3L24A 4ZWOA 3Q6DA 4IDYA 5CDEA 1C24A 4Z7MA 1XGNA 5D6EA 2GG7A 1YVMA 3MR1A 1KQ9A 4KM3A 3IG4A 4U6JA 1QXWA 4FLLA 2DFIA 4R60A 4RGZ1 5CDLA 2BB7A 3IU9A 4IU6A 3PKDA 2Q96A 2GG0A 5CIKA 2BHAA 1WN1A 1BOAA 4U69A 4FLKA 1R58A 2P98A 5JFRA 4FUKA 4ZWPA 2NQ7A 4U6ZA 3TAVA 2Q92A 2GG9A 4U1BA 4U6CA 3PKCA 1XGSA 2GA2A 3BITA 4ZNGA 2GGCA 4FKCA 4FO8A 4PV4A 4S00A 2BWYA 2IW2A 4FLIA 3TB5A 4EGEA 3MATA 4U70A 2GG8A 1W7VA 1JAWA 2GG3A 2GG2A 2BH3A 4JUQA 4U71A 4B28A 4U73A 1R5HA 2BHCA 2BWXA 4U6WA 2BN7A 5JHUA 2BWSA 4RZYA 2GTXA 1Y1NA 3FMRA 2P99A 3PKBA 2NQ6A 4IKRA 2BWVA 2GU7A 2V3ZA 4IKSA 1N51A 3L7GA 1WL6A 1YW9A 2Q94A 1XNZA 2GG5A 1YW8A 2BWTA 1BN5A 4MATA 1A16A 4IKTA 1YW7A 2GZ5A 2ZSGA 5FCFA 2HOWA 2BWWA 1WKMA 2P9AA 4HXXA 3RORA 4FO7A 2Q93A 1C23A 1KQ0A 2V3YA 1C27A 1QXYA 1QZYA 2BHDA 4FLJA 4S2RP 1B59A 4U6EA 2BWUA 4A6VA 2OAZA 1MATA 1C22A 3FM3A 1QXZA 3BIPA 4IPAA 2ADUA 2G6PA 1C21A 2Q95A 1XGMA 3PKEA 4RZZA 1XGOA 4U75A 4U76A 2B3HA 4IECA 1WBQA 5E5BA 1B6AA 5CNXA 4OOKA 3RVAA 1O0XA 2EVOA 5D6FA 2GU5A 2EVMA 1R5GA 5JI6A 2B3KA 3S6BA 2V6CA 5CLSA 2Q8KA 4IKUA 3CTZA 3BIQA 3PKAA 4A6WA 3IU8A 2GGBA 2V3XA 3MX6A 4S01A 1PV9A 4IF7A 1W2MA 1CHMA 2EA4A 4QR8A 4ZWUA 3FMQA 5CDVA 3CB6A 5CE6A 3D27A 1WY2A 2GU4A 2EVCA 2B3LA 2MATA 1YJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLR A;  2EA2 A;  3IU7 A;  4S2T P;  1WL9 A;  2GU6 A;  4PNC A;  2OKN A;  1M35 A;  3CB5 A;  5FCH A;  1KP0 A;  2BHB A;  3L24 A;  4ZWO A;  3Q6D A;  4IDY A;  5CDE A;  1C24 A;  4Z7M A;  1XGN A;  5D6E A;  2GG7 A;  1YVM A;  3MR1 A;  1KQ9 A;  4KM3 A;  3IG4 A;  4U6J A;  1QXW A;  4FLL A;  2DFI A;  4R60 A;  4RGZ 1;  5CDL A;  2BB7 A;  3IU9 A;  4IU6 A;  3PKD A;  2Q96 A;  2GG0 A;  5CIK A;  2BHA A;  1WN1 A;  1BOA A;  4U69 A;  4FLK A;  1R58 A;  2P98 A;  5JFR A;  4FUK A;  4ZWP A;  2NQ7 A;  4U6Z A;  3TAV A;  2Q92 A;  2GG9 A;  4U1B A;  4U6C A;  3PKC A;  1XGS A;  2GA2 A;  3BIT A;  4ZNG A;  2GGC A;  4FKC A;  4FO8 A;  4PV4 A;  4S00 A;  2BWY A;  2IW2 A;  4FLI A;  3TB5 A;  4EGE A;  3MAT A;  4U70 A;  2GG8 A;  1W7V A;  1JAW A;  2GG3 A;  2GG2 A;  2BH3 A;  4JUQ A;  4U71 A;  4B28 A;  4U73 A;  1R5H A;  2BHC A;  2BWX A;  4U6W A;  2BN7 A;  5JHU A;  2BWS A;  4RZY A;  2GTX A;  1Y1N A;  3FMR A;  2P99 A;  3PKB A;  2NQ6 A;  4IKR A;  2BWV A;  2GU7 A;  2V3Z A;  4IKS A;  1N51 A;  3L7G A;  1WL6 A;  1YW9 A;  2Q94 A;  1XNZ A;  2GG5 A;  1YW8 A;  2BWT A;  1BN5 A;  4MAT A;  1A16 A;  4IKT A;  1YW7 A;  2GZ5 A;  2ZSG A;  5FCF A;  2HOW A;  2BWW A;  1WKM A;  2P9A A;  4HXX A;  3ROR A;  4FO7 A;  2Q93 A;  1C23 A;  1KQ0 A;  2V3Y A;  1C27 A;  1QXY A;  1QZY A;  2BHD A;  4FLJ A;  4S2R P;  1B59 A;  4U6E A;  2BWU A;  4A6V A;  2OAZ A;  1MAT A;  1C22 A;  3FM3 A;  1QXZ A;  3BIP A;  4IPA A;  2ADU A;  2G6P A;  1C21 A;  2Q95 A;  1XGM A;  3PKE A;  4RZZ A;  1XGO A;  4U75 A;  4U76 A;  2B3H A;  4IEC A;  1WBQ A;  5E5B A;  1B6A A;  5CNX A;  4OOK A;  3RVA A;  1O0X A;  2EVO A;  5D6F A;  2GU5 A;  2EVM A;  1R5G A;  5JI6 A;  2B3K A;  3S6B A;  2V6C A;  5CLS A;  2Q8K A;  4IKU A;  3CTZ A;  3BIQ A;  3PKA A;  4A6W A;  3IU8 A;  2GGB A;  2V3X A;  3MX6 A;  4S01 A;  1PV9 A;  4IF7 A;  1W2M A;  1CHM A;  2EA4 A;  4QR8 A;  4ZWU A;  3FMQ A;  5CDV A;  3CB6 A;  5CE6 A;  3D27 A;  1WY2 A;  2GU4 A;  2EVC A;  2B3L A;  2MAT A;  1YJ3 A; 
#chains in the Genus database with same CATH topology
 1WLR A;  2EA2 A;  3IU7 A;  4S2T P;  1WL9 A;  2GU6 A;  4PNC A;  2OKN A;  1M35 A;  3CB5 A;  5FCH A;  1KP0 A;  2BHB A;  3L24 A;  4ZWO A;  3Q6D A;  4IDY A;  5CDE A;  1C24 A;  4Z7M A;  1XGN A;  5D6E A;  2GG7 A;  1YVM A;  3MR1 A;  1KQ9 A;  4KM3 A;  3IG4 A;  4U6J A;  1QXW A;  4FLL A;  2DFI A;  4R60 A;  4RGZ 1;  5CDL A;  2BB7 A;  3IU9 A;  4IU6 A;  3PKD A;  2Q96 A;  2GG0 A;  5CIK A;  2BHA A;  1WN1 A;  1BOA A;  4U69 A;  4FLK A;  1R58 A;  2P98 A;  5JFR A;  4FUK A;  4ZWP A;  2NQ7 A;  4U6Z A;  3TAV A;  2Q92 A;  2GG9 A;  4U1B A;  4U6C A;  3PKC A;  1XGS A;  2GA2 A;  3BIT A;  4ZNG A;  2GGC A;  4FKC A;  4FO8 A;  4PV4 A;  4S00 A;  2BWY A;  2IW2 A;  4FLI A;  3TB5 A;  4EGE A;  3MAT A;  4U70 A;  2GG8 A;  1W7V A;  1JAW A;  2GG3 A;  2GG2 A;  2BH3 A;  4JUQ A;  4U71 A;  4B28 A;  4U73 A;  1R5H A;  2BHC A;  2BWX A;  4U6W A;  2BN7 A;  5JHU A;  2BWS A;  4RZY A;  2GTX A;  1Y1N A;  3FMR A;  2P99 A;  3PKB A;  2NQ6 A;  4IKR A;  2BWV A;  2GU7 A;  2V3Z A;  4IKS A;  1N51 A;  3L7G A;  1WL6 A;  1YW9 A;  2Q94 A;  1XNZ A;  2GG5 A;  1YW8 A;  2BWT A;  1BN5 A;  4MAT A;  1A16 A;  4IKT A;  1YW7 A;  2GZ5 A;  2ZSG A;  5FCF A;  2HOW A;  2BWW A;  1WKM A;  2P9A A;  4HXX A;  3ROR A;  4FO7 A;  2Q93 A;  1C23 A;  1KQ0 A;  2V3Y A;  1C27 A;  1QXY A;  1QZY A;  2BHD A;  4FLJ A;  4S2R P;  1B59 A;  4U6E A;  2BWU A;  4A6V A;  2OAZ A;  1MAT A;  1C22 A;  3FM3 A;  1QXZ A;  3BIP A;  4IPA A;  2ADU A;  2G6P A;  1C21 A;  2Q95 A;  1XGM A;  3PKE A;  4RZZ A;  1XGO A;  4U75 A;  4U76 A;  2B3H A;  4IEC A;  1WBQ A;  5E5B A;  1B6A A;  5CNX A;  4OOK A;  3RVA A;  1O0X A;  2EVO A;  5D6F A;  2GU5 A;  2EVM A;  1R5G A;  5JI6 A;  2B3K A;  3S6B A;  2V6C A;  5CLS A;  2Q8K A;  4IKU A;  3CTZ A;  3BIQ A;  3PKA A;  4A6W A;  3IU8 A;  2GGB A;  2V3X A;  3MX6 A;  4S01 A;  1PV9 A;  4IF7 A;  1W2M A;  1CHM A;  2EA4 A;  4QR8 A;  4ZWU A;  3FMQ A;  5CDV A;  3CB6 A;  5CE6 A;  3D27 A;  1WY2 A;  2GU4 A;  2EVC A;  2B3L A;  2MAT A;  1YJ3 A; 
#chains in the Genus database with same CATH homology
 1WLR A;  2EA2 A;  3IU7 A;  4S2T P;  1WL9 A;  2GU6 A;  4PNC A;  2OKN A;  1M35 A;  3CB5 A;  5FCH A;  1KP0 A;  2BHB A;  3L24 A;  4ZWO A;  3Q6D A;  4IDY A;  5CDE A;  1C24 A;  4Z7M A;  1XGN A;  5D6E A;  2GG7 A;  1YVM A;  3MR1 A;  1KQ9 A;  4KM3 A;  3IG4 A;  4U6J A;  1QXW A;  4FLL A;  2DFI A;  4R60 A;  4RGZ 1;  5CDL A;  2BB7 A;  3IU9 A;  4IU6 A;  3PKD A;  2Q96 A;  2GG0 A;  5CIK A;  2BHA A;  1WN1 A;  1BOA A;  4U69 A;  4FLK A;  1R58 A;  2P98 A;  5JFR A;  4FUK A;  4ZWP A;  2NQ7 A;  4U6Z A;  3TAV A;  2Q92 A;  2GG9 A;  4U1B A;  4U6C A;  3PKC A;  1XGS A;  2GA2 A;  3BIT A;  4ZNG A;  2GGC A;  4FKC A;  4FO8 A;  4PV4 A;  4S00 A;  2BWY A;  2IW2 A;  4FLI A;  3TB5 A;  4EGE A;  3MAT A;  4U70 A;  2GG8 A;  1W7V A;  1JAW A;  2GG3 A;  2GG2 A;  2BH3 A;  4JUQ A;  4U71 A;  4B28 A;  4U73 A;  1R5H A;  2BHC A;  2BWX A;  4U6W A;  2BN7 A;  5JHU A;  2BWS A;  4RZY A;  2GTX A;  1Y1N A;  3FMR A;  2P99 A;  3PKB A;  2NQ6 A;  4IKR A;  2BWV A;  2GU7 A;  2V3Z A;  4IKS A;  1N51 A;  3L7G A;  1WL6 A;  1YW9 A;  2Q94 A;  1XNZ A;  2GG5 A;  1YW8 A;  2BWT A;  1BN5 A;  4MAT A;  1A16 A;  4IKT A;  1YW7 A;  2GZ5 A;  2ZSG A;  5FCF A;  2HOW A;  2BWW A;  1WKM A;  2P9A A;  4HXX A;  3ROR A;  4FO7 A;  2Q93 A;  1C23 A;  1KQ0 A;  2V3Y A;  1C27 A;  1QXY A;  1QZY A;  2BHD A;  4FLJ A;  4S2R P;  1B59 A;  4U6E A;  2BWU A;  4A6V A;  2OAZ A;  1MAT A;  1C22 A;  3FM3 A;  1QXZ A;  3BIP A;  4IPA A;  2ADU A;  2G6P A;  1C21 A;  2Q95 A;  1XGM A;  3PKE A;  4RZZ A;  1XGO A;  4U75 A;  4U76 A;  2B3H A;  4IEC A;  1WBQ A;  5E5B A;  1B6A A;  5CNX A;  4OOK A;  3RVA A;  1O0X A;  2EVO A;  5D6F A;  2GU5 A;  2EVM A;  1R5G A;  5JI6 A;  2B3K A;  3S6B A;  2V6C A;  5CLS A;  2Q8K A;  4IKU A;  3CTZ A;  3BIQ A;  3PKA A;  4A6W A;  3IU8 A;  2GGB A;  2V3X A;  3MX6 A;  4S01 A;  1PV9 A;  4IF7 A;  1W2M A;  1CHM A;  2EA4 A;  4QR8 A;  4ZWU A;  3FMQ A;  5CDV A;  3CB6 A;  5CE6 A;  3D27 A;  1WY2 A;  2GU4 A;  2EVC A;  2B3L A;  2MAT A;  1YJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...