4A6WA

X-ray structures of oxazole hydroxamate ecmetap-mn complexes
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
pubmed doi rcsb
molecule tags Transferase
total genus 83
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4a6wA00
1C24A 1QZYA 2GGCA 2GG9A 2Q96A 4U6CA 1C23A 2BN7A 3MX6A 1XGSA 5CE6A 1W2MA 4S01A 2NQ6A 2BWSA 2GG7A 3PKDA 2V6CA 5D6FA 2V3ZA 4IDYA 4U70A 3BIQA 2GG2A 4QR8A 4ZWPA 1O0XA 4A6VA 1KP0A 3L24A 1YW8A 3PKEA 2BHBA 2GGBA 4RZYA 2P98A 1QXYA 1WL9A 5CDEA 4EGEA 4U69A 5FCHA 1Y1NA 3L7GA 4IECA 1XGOA 4IU6A 3IU9A 1KQ9A 1CHMA 1WN1A 4A6WA 5JFRA 4MATA 1R5GA 2BH3A 2GTXA 1B6AA 4U6ZA 3PKCA 1YW9A 2GG5A 1A16A 1C21A 2IW2A 3FM3A 4FUKA 2HOWA 2DFIA 3FMRA 4U6WA 1M35A 5CIKA 2EA2A 2Q93A 2Q92A 3CB5A 3PKAA 2BWUA 2EVMA 2GU5A 3RORA 5JI6A 1XGMA 2EVOA 4OOKA 4KM3A 1B59A 2V3XA 2OKNA 1PV9A 2B3LA 3IG4A 4U1BA 2V3YA 3FMQA 1XNZA 2BWYA 5FCFA 3IU7A 1WY2A 2GA2A 4U71A 4S2TP 3BITA 4IKSA 1MATA 1YW7A 1C22A 1BOAA 3MR1A 1W7VA 4FO8A 2EA4A 4IKUA 5CLSA 2Q95A 1R58A 1WLRA 2B3HA 1JAWA 2GU6A 4FO7A 4U6JA 3BIPA 3CB6A 2NQ7A 2Q94A 2MATA 2BHDA 4FLKA 4IPAA 4FLLA 5CDVA 4U6EA 2GZ5A 2GU4A 2ADUA 4IKRA 2GG0A 4U75A 4ZWOA 2BWWA 3TB5A 3MATA 1XGNA 4HXXA 4IF7A 1BN5A 2GU7A 4IKTA 1N51A 4U73A 1WKMA 4U76A 1WBQA 1YJ3A 4S2RP 1QXWA 5CDLA 3CTZA 1R5HA 4ZWUA 5JHUA 3TAVA 2B3KA 2BHCA 2OAZA 3IU8A 4R60A 2BHAA 4S00A 2GG3A 2EVCA 4JUQA 2P99A 3S6BA 1KQ0A 2BB7A 4PV4A 2ZSGA 4FLIA 2BWVA 3Q6DA 4PNCA 1C27A 2GG8A 4ZNGA 4RZZA 2BWXA 1QXZA 2P9AA 2Q8KA 4B28A 2G6PA 4Z7MA 3D27A 3PKBA 1WL6A 5CNXA 3RVAA 4RGZ1 4FLJA 5D6EA 5E5BA 2BWTA 4FKCA 1YVMA
chains in the Genus database with same CATH superfamily
1C24A 1QZYA 2GGCA 2GG9A 2Q96A 4U6CA 1C23A 2BN7A 3MX6A 1XGSA 5CE6A 1W2MA 4S01A 2NQ6A 2BWSA 2GG7A 3PKDA 2V6CA 5D6FA 2V3ZA 4IDYA 4U70A 3BIQA 2GG2A 4QR8A 4ZWPA 1O0XA 4A6VA 1KP0A 3L24A 1YW8A 3PKEA 2BHBA 2GGBA 4RZYA 2P98A 1QXYA 1WL9A 5CDEA 4EGEA 4U69A 5FCHA 1Y1NA 3L7GA 4IECA 1XGOA 4IU6A 3IU9A 1KQ9A 1CHMA 1WN1A 4A6WA 5JFRA 4MATA 1R5GA 2BH3A 2GTXA 1B6AA 4U6ZA 3PKCA 1YW9A 2GG5A 1A16A 1C21A 2IW2A 3FM3A 4FUKA 2HOWA 2DFIA 3FMRA 4U6WA 1M35A 5CIKA 2EA2A 2Q93A 2Q92A 3CB5A 3PKAA 2BWUA 2EVMA 2GU5A 3RORA 5JI6A 1XGMA 2EVOA 4OOKA 4KM3A 1B59A 2V3XA 2OKNA 1PV9A 2B3LA 3IG4A 4U1BA 2V3YA 3FMQA 1XNZA 2BWYA 5FCFA 3IU7A 1WY2A 2GA2A 4U71A 4S2TP 3BITA 4IKSA 1MATA 1YW7A 1C22A 1BOAA 3MR1A 1W7VA 4FO8A 2EA4A 4IKUA 5CLSA 2Q95A 1R58A 1WLRA 2B3HA 1JAWA 2GU6A 4FO7A 4U6JA 3BIPA 3CB6A 2NQ7A 2Q94A 2MATA 2BHDA 4FLKA 4IPAA 4FLLA 5CDVA 4U6EA 2GZ5A 2GU4A 2ADUA 4IKRA 2GG0A 4U75A 4ZWOA 2BWWA 3TB5A 3MATA 1XGNA 4HXXA 4IF7A 1BN5A 2GU7A 4IKTA 1N51A 4U73A 1WKMA 4U76A 1WBQA 1YJ3A 4S2RP 1QXWA 5CDLA 3CTZA 1R5HA 4ZWUA 5JHUA 3TAVA 2B3KA 2BHCA 2OAZA 3IU8A 4R60A 2BHAA 4S00A 2GG3A 2EVCA 4JUQA 2P99A 3S6BA 1KQ0A 2BB7A 4PV4A 2ZSGA 4FLIA 2BWVA 3Q6DA 4PNCA 1C27A 2GG8A 4ZNGA 4RZZA 2BWXA 1QXZA 2P9AA 2Q8KA 4B28A 2G6PA 4Z7MA 3D27A 3PKBA 1WL6A 5CNXA 3RVAA 4RGZ1 4FLJA 5D6EA 5E5BA 2BWTA 4FKCA 1YVMA
chains in the Genus database with same CATH topology
1C24A 1QZYA 2GGCA 2GG9A 2Q96A 4U6CA 1C23A 2BN7A 3MX6A 1XGSA 5CE6A 1W2MA 4S01A 2NQ6A 2BWSA 2GG7A 3PKDA 2V6CA 5D6FA 2V3ZA 4IDYA 4U70A 3BIQA 2GG2A 4QR8A 4ZWPA 1O0XA 4A6VA 1KP0A 3L24A 1YW8A 3PKEA 2BHBA 2GGBA 4RZYA 2P98A 1QXYA 1WL9A 5CDEA 4EGEA 4U69A 5FCHA 1Y1NA 3L7GA 4IECA 1XGOA 4IU6A 3IU9A 1KQ9A 1CHMA 1WN1A 4A6WA 5JFRA 4MATA 1R5GA 2BH3A 2GTXA 1B6AA 4U6ZA 3PKCA 1YW9A 2GG5A 1A16A 1C21A 2IW2A 3FM3A 4FUKA 2HOWA 2DFIA 3FMRA 4U6WA 1M35A 5CIKA 2EA2A 2Q93A 2Q92A 3CB5A 3PKAA 2BWUA 2EVMA 2GU5A 3RORA 5JI6A 1XGMA 2EVOA 4OOKA 4KM3A 1B59A 2V3XA 2OKNA 1PV9A 2B3LA 3IG4A 4U1BA 2V3YA 3FMQA 1XNZA 2BWYA 5FCFA 3IU7A 1WY2A 2GA2A 4U71A 4S2TP 3BITA 4IKSA 1MATA 1YW7A 1C22A 1BOAA 3MR1A 1W7VA 4FO8A 2EA4A 4IKUA 5CLSA 2Q95A 1R58A 1WLRA 2B3HA 1JAWA 2GU6A 4FO7A 4U6JA 3BIPA 3CB6A 2NQ7A 2Q94A 2MATA 2BHDA 4FLKA 4IPAA 4FLLA 5CDVA 4U6EA 2GZ5A 2GU4A 2ADUA 4IKRA 2GG0A 4U75A 4ZWOA 2BWWA 3TB5A 3MATA 1XGNA 4HXXA 4IF7A 1BN5A 2GU7A 4IKTA 1N51A 4U73A 1WKMA 4U76A 1WBQA 1YJ3A 4S2RP 1QXWA 5CDLA 3CTZA 1R5HA 4ZWUA 5JHUA 3TAVA 2B3KA 2BHCA 2OAZA 3IU8A 4R60A 2BHAA 4S00A 2GG3A 2EVCA 4JUQA 2P99A 3S6BA 1KQ0A 2BB7A 4PV4A 2ZSGA 4FLIA 2BWVA 3Q6DA 4PNCA 1C27A 2GG8A 4ZNGA 4RZZA 2BWXA 1QXZA 2P9AA 2Q8KA 4B28A 2G6PA 4Z7MA 3D27A 3PKBA 1WL6A 5CNXA 3RVAA 4RGZ1 4FLJA 5D6EA 5E5BA 2BWTA 4FKCA 1YVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C24 A;  1QZY A;  2GGC A;  2GG9 A;  2Q96 A;  4U6C A;  1C23 A;  2BN7 A;  3MX6 A;  1XGS A;  5CE6 A;  1W2M A;  4S01 A;  2NQ6 A;  2BWS A;  2GG7 A;  3PKD A;  2V6C A;  5D6F A;  2V3Z A;  4IDY A;  4U70 A;  3BIQ A;  2GG2 A;  4QR8 A;  4ZWP A;  1O0X A;  4A6V A;  1KP0 A;  3L24 A;  1YW8 A;  3PKE A;  2BHB A;  2GGB A;  4RZY A;  2P98 A;  1QXY A;  1WL9 A;  5CDE A;  4EGE A;  4U69 A;  5FCH A;  1Y1N A;  3L7G A;  4IEC A;  1XGO A;  4IU6 A;  3IU9 A;  1KQ9 A;  1CHM A;  1WN1 A;  4A6W A;  5JFR A;  4MAT A;  1R5G A;  2BH3 A;  2GTX A;  1B6A A;  4U6Z A;  3PKC A;  1YW9 A;  2GG5 A;  1A16 A;  1C21 A;  2IW2 A;  3FM3 A;  4FUK A;  2HOW A;  2DFI A;  3FMR A;  4U6W A;  1M35 A;  5CIK A;  2EA2 A;  2Q93 A;  2Q92 A;  3CB5 A;  3PKA A;  2BWU A;  2EVM A;  2GU5 A;  3ROR A;  5JI6 A;  1XGM A;  2EVO A;  4OOK A;  4KM3 A;  1B59 A;  2V3X A;  2OKN A;  1PV9 A;  2B3L A;  3IG4 A;  4U1B A;  2V3Y A;  3FMQ A;  1XNZ A;  2BWY A;  5FCF A;  3IU7 A;  1WY2 A;  2GA2 A;  4U71 A;  4S2T P;  3BIT A;  4IKS A;  1MAT A;  1YW7 A;  1C22 A;  1BOA A;  3MR1 A;  1W7V A;  4FO8 A;  2EA4 A;  4IKU A;  5CLS A;  2Q95 A;  1R58 A;  1WLR A;  2B3H A;  1JAW A;  2GU6 A;  4FO7 A;  4U6J A;  3BIP A;  3CB6 A;  2NQ7 A;  2Q94 A;  2MAT A;  2BHD A;  4FLK A;  4IPA A;  4FLL A;  5CDV A;  4U6E A;  2GZ5 A;  2GU4 A;  2ADU A;  4IKR A;  2GG0 A;  4U75 A;  4ZWO A;  2BWW A;  3TB5 A;  3MAT A;  1XGN A;  4HXX A;  4IF7 A;  1BN5 A;  2GU7 A;  4IKT A;  1N51 A;  4U73 A;  1WKM A;  4U76 A;  1WBQ A;  1YJ3 A;  4S2R P;  1QXW A;  5CDL A;  3CTZ A;  1R5H A;  4ZWU A;  5JHU A;  3TAV A;  2B3K A;  2BHC A;  2OAZ A;  3IU8 A;  4R60 A;  2BHA A;  4S00 A;  2GG3 A;  2EVC A;  4JUQ A;  2P99 A;  3S6B A;  1KQ0 A;  2BB7 A;  4PV4 A;  2ZSG A;  4FLI A;  2BWV A;  3Q6D A;  4PNC A;  1C27 A;  2GG8 A;  4ZNG A;  4RZZ A;  2BWX A;  1QXZ A;  2P9A A;  2Q8K A;  4B28 A;  2G6P A;  4Z7M A;  3D27 A;  3PKB A;  1WL6 A;  5CNX A;  3RVA A;  4RGZ 1;  4FLJ A;  5D6E A;  5E5B A;  2BWT A;  4FKC A;  1YVM A; 
#chains in the Genus database with same CATH topology
 1C24 A;  1QZY A;  2GGC A;  2GG9 A;  2Q96 A;  4U6C A;  1C23 A;  2BN7 A;  3MX6 A;  1XGS A;  5CE6 A;  1W2M A;  4S01 A;  2NQ6 A;  2BWS A;  2GG7 A;  3PKD A;  2V6C A;  5D6F A;  2V3Z A;  4IDY A;  4U70 A;  3BIQ A;  2GG2 A;  4QR8 A;  4ZWP A;  1O0X A;  4A6V A;  1KP0 A;  3L24 A;  1YW8 A;  3PKE A;  2BHB A;  2GGB A;  4RZY A;  2P98 A;  1QXY A;  1WL9 A;  5CDE A;  4EGE A;  4U69 A;  5FCH A;  1Y1N A;  3L7G A;  4IEC A;  1XGO A;  4IU6 A;  3IU9 A;  1KQ9 A;  1CHM A;  1WN1 A;  4A6W A;  5JFR A;  4MAT A;  1R5G A;  2BH3 A;  2GTX A;  1B6A A;  4U6Z A;  3PKC A;  1YW9 A;  2GG5 A;  1A16 A;  1C21 A;  2IW2 A;  3FM3 A;  4FUK A;  2HOW A;  2DFI A;  3FMR A;  4U6W A;  1M35 A;  5CIK A;  2EA2 A;  2Q93 A;  2Q92 A;  3CB5 A;  3PKA A;  2BWU A;  2EVM A;  2GU5 A;  3ROR A;  5JI6 A;  1XGM A;  2EVO A;  4OOK A;  4KM3 A;  1B59 A;  2V3X A;  2OKN A;  1PV9 A;  2B3L A;  3IG4 A;  4U1B A;  2V3Y A;  3FMQ A;  1XNZ A;  2BWY A;  5FCF A;  3IU7 A;  1WY2 A;  2GA2 A;  4U71 A;  4S2T P;  3BIT A;  4IKS A;  1MAT A;  1YW7 A;  1C22 A;  1BOA A;  3MR1 A;  1W7V A;  4FO8 A;  2EA4 A;  4IKU A;  5CLS A;  2Q95 A;  1R58 A;  1WLR A;  2B3H A;  1JAW A;  2GU6 A;  4FO7 A;  4U6J A;  3BIP A;  3CB6 A;  2NQ7 A;  2Q94 A;  2MAT A;  2BHD A;  4FLK A;  4IPA A;  4FLL A;  5CDV A;  4U6E A;  2GZ5 A;  2GU4 A;  2ADU A;  4IKR A;  2GG0 A;  4U75 A;  4ZWO A;  2BWW A;  3TB5 A;  3MAT A;  1XGN A;  4HXX A;  4IF7 A;  1BN5 A;  2GU7 A;  4IKT A;  1N51 A;  4U73 A;  1WKM A;  4U76 A;  1WBQ A;  1YJ3 A;  4S2R P;  1QXW A;  5CDL A;  3CTZ A;  1R5H A;  4ZWU A;  5JHU A;  3TAV A;  2B3K A;  2BHC A;  2OAZ A;  3IU8 A;  4R60 A;  2BHA A;  4S00 A;  2GG3 A;  2EVC A;  4JUQ A;  2P99 A;  3S6B A;  1KQ0 A;  2BB7 A;  4PV4 A;  2ZSG A;  4FLI A;  2BWV A;  3Q6D A;  4PNC A;  1C27 A;  2GG8 A;  4ZNG A;  4RZZ A;  2BWX A;  1QXZ A;  2P9A A;  2Q8K A;  4B28 A;  2G6P A;  4Z7M A;  3D27 A;  3PKB A;  1WL6 A;  5CNX A;  3RVA A;  4RGZ 1;  4FLJ A;  5D6E A;  5E5B A;  2BWT A;  4FKC A;  1YVM A; 
#chains in the Genus database with same CATH homology
 1C24 A;  1QZY A;  2GGC A;  2GG9 A;  2Q96 A;  4U6C A;  1C23 A;  2BN7 A;  3MX6 A;  1XGS A;  5CE6 A;  1W2M A;  4S01 A;  2NQ6 A;  2BWS A;  2GG7 A;  3PKD A;  2V6C A;  5D6F A;  2V3Z A;  4IDY A;  4U70 A;  3BIQ A;  2GG2 A;  4QR8 A;  4ZWP A;  1O0X A;  4A6V A;  1KP0 A;  3L24 A;  1YW8 A;  3PKE A;  2BHB A;  2GGB A;  4RZY A;  2P98 A;  1QXY A;  1WL9 A;  5CDE A;  4EGE A;  4U69 A;  5FCH A;  1Y1N A;  3L7G A;  4IEC A;  1XGO A;  4IU6 A;  3IU9 A;  1KQ9 A;  1CHM A;  1WN1 A;  4A6W A;  5JFR A;  4MAT A;  1R5G A;  2BH3 A;  2GTX A;  1B6A A;  4U6Z A;  3PKC A;  1YW9 A;  2GG5 A;  1A16 A;  1C21 A;  2IW2 A;  3FM3 A;  4FUK A;  2HOW A;  2DFI A;  3FMR A;  4U6W A;  1M35 A;  5CIK A;  2EA2 A;  2Q93 A;  2Q92 A;  3CB5 A;  3PKA A;  2BWU A;  2EVM A;  2GU5 A;  3ROR A;  5JI6 A;  1XGM A;  2EVO A;  4OOK A;  4KM3 A;  1B59 A;  2V3X A;  2OKN A;  1PV9 A;  2B3L A;  3IG4 A;  4U1B A;  2V3Y A;  3FMQ A;  1XNZ A;  2BWY A;  5FCF A;  3IU7 A;  1WY2 A;  2GA2 A;  4U71 A;  4S2T P;  3BIT A;  4IKS A;  1MAT A;  1YW7 A;  1C22 A;  1BOA A;  3MR1 A;  1W7V A;  4FO8 A;  2EA4 A;  4IKU A;  5CLS A;  2Q95 A;  1R58 A;  1WLR A;  2B3H A;  1JAW A;  2GU6 A;  4FO7 A;  4U6J A;  3BIP A;  3CB6 A;  2NQ7 A;  2Q94 A;  2MAT A;  2BHD A;  4FLK A;  4IPA A;  4FLL A;  5CDV A;  4U6E A;  2GZ5 A;  2GU4 A;  2ADU A;  4IKR A;  2GG0 A;  4U75 A;  4ZWO A;  2BWW A;  3TB5 A;  3MAT A;  1XGN A;  4HXX A;  4IF7 A;  1BN5 A;  2GU7 A;  4IKT A;  1N51 A;  4U73 A;  1WKM A;  4U76 A;  1WBQ A;  1YJ3 A;  4S2R P;  1QXW A;  5CDL A;  3CTZ A;  1R5H A;  4ZWU A;  5JHU A;  3TAV A;  2B3K A;  2BHC A;  2OAZ A;  3IU8 A;  4R60 A;  2BHA A;  4S00 A;  2GG3 A;  2EVC A;  4JUQ A;  2P99 A;  3S6B A;  1KQ0 A;  2BB7 A;  4PV4 A;  2ZSG A;  4FLI A;  2BWV A;  3Q6D A;  4PNC A;  1C27 A;  2GG8 A;  4ZNG A;  4RZZ A;  2BWX A;  1QXZ A;  2P9A A;  2Q8K A;  4B28 A;  2G6P A;  4Z7M A;  3D27 A;  3PKB A;  1WL6 A;  5CNX A;  3RVA A;  4RGZ 1;  4FLJ A;  5D6E A;  5E5B A;  2BWT A;  4FKC A;  1YVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...