4A6WA

X-ray structures of oxazole hydroxamate ecmetap-mn complexes
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
pubmed doi rcsb
molecule tags Transferase
total genus 83
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4a6wA00
4Z7MA 2EVMA 4FLLA 2V3YA 3RVAA 4U71A 4FKCA 2BWVA 1KQ0A 5CDLA 1KP0A 4A6WA 2OAZA 1YW8A 2GGCA 2GG9A 2BHCA 2BH3A 3Q6DA 1WN1A 4IDYA 1XGNA 2IW2A 4HXXA 1W2MA 4PNCA 5E5BA 5CNXA 5FCFA 2EA2A 3L24A 3MATA 5JI6A 1MATA 5CLSA 4U6JA 1B59A 4QR8A 2GA2A 2B3HA 2GG3A 4RGZ1 4MATA 5CDEA 1W7VA 2MATA 2V3ZA 3IU7A 4ZWUA 4S2RP 1WLRA 3TAVA 2P9AA 4IKUA 5CIKA 2BB7A 4ZWOA 2GGBA 1QXYA 3D27A 1WBQA 3L7GA 2OKNA 1R5HA 4U76A 4U1BA 1Y1NA 3RORA 1YVMA 2BHBA 3PKAA 1B6AA 2BWTA 4S2TP 2BWXA 1QZYA 3CTZA 1WL6A 5D6FA 2BWYA 2EVOA 1KQ9A 2GU4A 1M35A 1XGMA 4U6WA 4U69A 4RZZA 1C21A 1WY2A 3PKCA 1CHMA 4U6EA 4OOKA 4S01A 1YJ3A 4IKRA 2Q93A 4U6ZA 1YW9A 1WKMA 1JAWA 5CE6A 4KM3A 4FO7A 1BN5A 2BHDA 2P98A 4JUQA 1XNZA 3IG4A 4IPAA 1C23A 2BN7A 2BWSA 4EGEA 2GG0A 1XGSA 3FMQA 4IU6A 2ADUA 2Q92A 4U70A 2B3KA 1XGOA 2GTXA 2Q96A 1BOAA 3PKEA 2GG2A 3PKBA 2DFIA 3PKDA 3MR1A 3S6BA 2P99A 4IECA 2GU6A 5JFRA 4FLIA 3CB6A 2BWUA 2EVCA 2GU7A 2HOWA 1PV9A 2Q95A 4U73A 3BIPA 1C24A 2V3XA 4IKTA 3TB5A 4U75A 2Q94A 1O0XA 2NQ6A 4R60A 2GU5A 3IU8A 1N51A 1R5GA 3IU9A 2BWWA 2V6CA 4ZWPA 2GG5A 4FUKA 1C22A 3FM3A 4FLJA 4FLKA 1WL9A 3CB5A 1R58A 2G6PA 4A6VA 2BHAA 2B3LA 2GG7A 3BIQA 4FO8A 4RZYA 4PV4A 4ZNGA 3FMRA 2Q8KA 1A16A 3BITA 4B28A 2GG8A 1QXZA 2GZ5A 2EA4A 5JHUA 2ZSGA 1YW7A 5FCHA 4IF7A 2NQ7A 3MX6A 1QXWA 4S00A 4U6CA 5D6EA 1C27A 4IKSA 5CDVA
chains in the Genus database with same CATH superfamily
4Z7MA 2EVMA 4FLLA 2V3YA 3RVAA 4U71A 4FKCA 2BWVA 1KQ0A 5CDLA 1KP0A 4A6WA 2OAZA 1YW8A 2GGCA 2GG9A 2BHCA 2BH3A 3Q6DA 1WN1A 4IDYA 1XGNA 2IW2A 4HXXA 1W2MA 4PNCA 5E5BA 5CNXA 5FCFA 2EA2A 3L24A 3MATA 5JI6A 1MATA 5CLSA 4U6JA 1B59A 4QR8A 2GA2A 2B3HA 2GG3A 4RGZ1 4MATA 5CDEA 1W7VA 2MATA 2V3ZA 3IU7A 4ZWUA 4S2RP 1WLRA 3TAVA 2P9AA 4IKUA 5CIKA 2BB7A 4ZWOA 2GGBA 1QXYA 3D27A 1WBQA 3L7GA 2OKNA 1R5HA 4U76A 4U1BA 1Y1NA 3RORA 1YVMA 2BHBA 3PKAA 1B6AA 2BWTA 4S2TP 2BWXA 1QZYA 3CTZA 1WL6A 5D6FA 2BWYA 2EVOA 1KQ9A 2GU4A 1M35A 1XGMA 4U6WA 4U69A 4RZZA 1C21A 1WY2A 3PKCA 1CHMA 4U6EA 4OOKA 4S01A 1YJ3A 4IKRA 2Q93A 4U6ZA 1YW9A 1WKMA 1JAWA 5CE6A 4KM3A 4FO7A 1BN5A 2BHDA 2P98A 4JUQA 1XNZA 3IG4A 4IPAA 1C23A 2BN7A 2BWSA 4EGEA 2GG0A 1XGSA 3FMQA 4IU6A 2ADUA 2Q92A 4U70A 2B3KA 1XGOA 2GTXA 2Q96A 1BOAA 3PKEA 2GG2A 3PKBA 2DFIA 3PKDA 3MR1A 3S6BA 2P99A 4IECA 2GU6A 5JFRA 4FLIA 3CB6A 2BWUA 2EVCA 2GU7A 2HOWA 1PV9A 2Q95A 4U73A 3BIPA 1C24A 2V3XA 4IKTA 3TB5A 4U75A 2Q94A 1O0XA 2NQ6A 4R60A 2GU5A 3IU8A 1N51A 1R5GA 3IU9A 2BWWA 2V6CA 4ZWPA 2GG5A 4FUKA 1C22A 3FM3A 4FLJA 4FLKA 1WL9A 3CB5A 1R58A 2G6PA 4A6VA 2BHAA 2B3LA 2GG7A 3BIQA 4FO8A 4RZYA 4PV4A 4ZNGA 3FMRA 2Q8KA 1A16A 3BITA 4B28A 2GG8A 1QXZA 2GZ5A 2EA4A 5JHUA 2ZSGA 1YW7A 5FCHA 4IF7A 2NQ7A 3MX6A 1QXWA 4S00A 4U6CA 5D6EA 1C27A 4IKSA 5CDVA
chains in the Genus database with same CATH topology
4Z7MA 2EVMA 4FLLA 2V3YA 3RVAA 4U71A 4FKCA 2BWVA 1KQ0A 5CDLA 1KP0A 4A6WA 2OAZA 1YW8A 2GGCA 2GG9A 2BHCA 2BH3A 3Q6DA 1WN1A 4IDYA 1XGNA 2IW2A 4HXXA 1W2MA 4PNCA 5E5BA 5CNXA 5FCFA 2EA2A 3L24A 3MATA 5JI6A 1MATA 5CLSA 4U6JA 1B59A 4QR8A 2GA2A 2B3HA 2GG3A 4RGZ1 4MATA 5CDEA 1W7VA 2MATA 2V3ZA 3IU7A 4ZWUA 4S2RP 1WLRA 3TAVA 2P9AA 4IKUA 5CIKA 2BB7A 4ZWOA 2GGBA 1QXYA 3D27A 1WBQA 3L7GA 2OKNA 1R5HA 4U76A 4U1BA 1Y1NA 3RORA 1YVMA 2BHBA 3PKAA 1B6AA 2BWTA 4S2TP 2BWXA 1QZYA 3CTZA 1WL6A 5D6FA 2BWYA 2EVOA 1KQ9A 2GU4A 1M35A 1XGMA 4U6WA 4U69A 4RZZA 1C21A 1WY2A 3PKCA 1CHMA 4U6EA 4OOKA 4S01A 1YJ3A 4IKRA 2Q93A 4U6ZA 1YW9A 1WKMA 1JAWA 5CE6A 4KM3A 4FO7A 1BN5A 2BHDA 2P98A 4JUQA 1XNZA 3IG4A 4IPAA 1C23A 2BN7A 2BWSA 4EGEA 2GG0A 1XGSA 3FMQA 4IU6A 2ADUA 2Q92A 4U70A 2B3KA 1XGOA 2GTXA 2Q96A 1BOAA 3PKEA 2GG2A 3PKBA 2DFIA 3PKDA 3MR1A 3S6BA 2P99A 4IECA 2GU6A 5JFRA 4FLIA 3CB6A 2BWUA 2EVCA 2GU7A 2HOWA 1PV9A 2Q95A 4U73A 3BIPA 1C24A 2V3XA 4IKTA 3TB5A 4U75A 2Q94A 1O0XA 2NQ6A 4R60A 2GU5A 3IU8A 1N51A 1R5GA 3IU9A 2BWWA 2V6CA 4ZWPA 2GG5A 4FUKA 1C22A 3FM3A 4FLJA 4FLKA 1WL9A 3CB5A 1R58A 2G6PA 4A6VA 2BHAA 2B3LA 2GG7A 3BIQA 4FO8A 4RZYA 4PV4A 4ZNGA 3FMRA 2Q8KA 1A16A 3BITA 4B28A 2GG8A 1QXZA 2GZ5A 2EA4A 5JHUA 2ZSGA 1YW7A 5FCHA 4IF7A 2NQ7A 3MX6A 1QXWA 4S00A 4U6CA 5D6EA 1C27A 4IKSA 5CDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7M A;  2EVM A;  4FLL A;  2V3Y A;  3RVA A;  4U71 A;  4FKC A;  2BWV A;  1KQ0 A;  5CDL A;  1KP0 A;  4A6W A;  2OAZ A;  1YW8 A;  2GGC A;  2GG9 A;  2BHC A;  2BH3 A;  3Q6D A;  1WN1 A;  4IDY A;  1XGN A;  2IW2 A;  4HXX A;  1W2M A;  4PNC A;  5E5B A;  5CNX A;  5FCF A;  2EA2 A;  3L24 A;  3MAT A;  5JI6 A;  1MAT A;  5CLS A;  4U6J A;  1B59 A;  4QR8 A;  2GA2 A;  2B3H A;  2GG3 A;  4RGZ 1;  4MAT A;  5CDE A;  1W7V A;  2MAT A;  2V3Z A;  3IU7 A;  4ZWU A;  4S2R P;  1WLR A;  3TAV A;  2P9A A;  4IKU A;  5CIK A;  2BB7 A;  4ZWO A;  2GGB A;  1QXY A;  3D27 A;  1WBQ A;  3L7G A;  2OKN A;  1R5H A;  4U76 A;  4U1B A;  1Y1N A;  3ROR A;  1YVM A;  2BHB A;  3PKA A;  1B6A A;  2BWT A;  4S2T P;  2BWX A;  1QZY A;  3CTZ A;  1WL6 A;  5D6F A;  2BWY A;  2EVO A;  1KQ9 A;  2GU4 A;  1M35 A;  1XGM A;  4U6W A;  4U69 A;  4RZZ A;  1C21 A;  1WY2 A;  3PKC A;  1CHM A;  4U6E A;  4OOK A;  4S01 A;  1YJ3 A;  4IKR A;  2Q93 A;  4U6Z A;  1YW9 A;  1WKM A;  1JAW A;  5CE6 A;  4KM3 A;  4FO7 A;  1BN5 A;  2BHD A;  2P98 A;  4JUQ A;  1XNZ A;  3IG4 A;  4IPA A;  1C23 A;  2BN7 A;  2BWS A;  4EGE A;  2GG0 A;  1XGS A;  3FMQ A;  4IU6 A;  2ADU A;  2Q92 A;  4U70 A;  2B3K A;  1XGO A;  2GTX A;  2Q96 A;  1BOA A;  3PKE A;  2GG2 A;  3PKB A;  2DFI A;  3PKD A;  3MR1 A;  3S6B A;  2P99 A;  4IEC A;  2GU6 A;  5JFR A;  4FLI A;  3CB6 A;  2BWU A;  2EVC A;  2GU7 A;  2HOW A;  1PV9 A;  2Q95 A;  4U73 A;  3BIP A;  1C24 A;  2V3X A;  4IKT A;  3TB5 A;  4U75 A;  2Q94 A;  1O0X A;  2NQ6 A;  4R60 A;  2GU5 A;  3IU8 A;  1N51 A;  1R5G A;  3IU9 A;  2BWW A;  2V6C A;  4ZWP A;  2GG5 A;  4FUK A;  1C22 A;  3FM3 A;  4FLJ A;  4FLK A;  1WL9 A;  3CB5 A;  1R58 A;  2G6P A;  4A6V A;  2BHA A;  2B3L A;  2GG7 A;  3BIQ A;  4FO8 A;  4RZY A;  4PV4 A;  4ZNG A;  3FMR A;  2Q8K A;  1A16 A;  3BIT A;  4B28 A;  2GG8 A;  1QXZ A;  2GZ5 A;  2EA4 A;  5JHU A;  2ZSG A;  1YW7 A;  5FCH A;  4IF7 A;  2NQ7 A;  3MX6 A;  1QXW A;  4S00 A;  4U6C A;  5D6E A;  1C27 A;  4IKS A;  5CDV A; 
#chains in the Genus database with same CATH topology
 4Z7M A;  2EVM A;  4FLL A;  2V3Y A;  3RVA A;  4U71 A;  4FKC A;  2BWV A;  1KQ0 A;  5CDL A;  1KP0 A;  4A6W A;  2OAZ A;  1YW8 A;  2GGC A;  2GG9 A;  2BHC A;  2BH3 A;  3Q6D A;  1WN1 A;  4IDY A;  1XGN A;  2IW2 A;  4HXX A;  1W2M A;  4PNC A;  5E5B A;  5CNX A;  5FCF A;  2EA2 A;  3L24 A;  3MAT A;  5JI6 A;  1MAT A;  5CLS A;  4U6J A;  1B59 A;  4QR8 A;  2GA2 A;  2B3H A;  2GG3 A;  4RGZ 1;  4MAT A;  5CDE A;  1W7V A;  2MAT A;  2V3Z A;  3IU7 A;  4ZWU A;  4S2R P;  1WLR A;  3TAV A;  2P9A A;  4IKU A;  5CIK A;  2BB7 A;  4ZWO A;  2GGB A;  1QXY A;  3D27 A;  1WBQ A;  3L7G A;  2OKN A;  1R5H A;  4U76 A;  4U1B A;  1Y1N A;  3ROR A;  1YVM A;  2BHB A;  3PKA A;  1B6A A;  2BWT A;  4S2T P;  2BWX A;  1QZY A;  3CTZ A;  1WL6 A;  5D6F A;  2BWY A;  2EVO A;  1KQ9 A;  2GU4 A;  1M35 A;  1XGM A;  4U6W A;  4U69 A;  4RZZ A;  1C21 A;  1WY2 A;  3PKC A;  1CHM A;  4U6E A;  4OOK A;  4S01 A;  1YJ3 A;  4IKR A;  2Q93 A;  4U6Z A;  1YW9 A;  1WKM A;  1JAW A;  5CE6 A;  4KM3 A;  4FO7 A;  1BN5 A;  2BHD A;  2P98 A;  4JUQ A;  1XNZ A;  3IG4 A;  4IPA A;  1C23 A;  2BN7 A;  2BWS A;  4EGE A;  2GG0 A;  1XGS A;  3FMQ A;  4IU6 A;  2ADU A;  2Q92 A;  4U70 A;  2B3K A;  1XGO A;  2GTX A;  2Q96 A;  1BOA A;  3PKE A;  2GG2 A;  3PKB A;  2DFI A;  3PKD A;  3MR1 A;  3S6B A;  2P99 A;  4IEC A;  2GU6 A;  5JFR A;  4FLI A;  3CB6 A;  2BWU A;  2EVC A;  2GU7 A;  2HOW A;  1PV9 A;  2Q95 A;  4U73 A;  3BIP A;  1C24 A;  2V3X A;  4IKT A;  3TB5 A;  4U75 A;  2Q94 A;  1O0X A;  2NQ6 A;  4R60 A;  2GU5 A;  3IU8 A;  1N51 A;  1R5G A;  3IU9 A;  2BWW A;  2V6C A;  4ZWP A;  2GG5 A;  4FUK A;  1C22 A;  3FM3 A;  4FLJ A;  4FLK A;  1WL9 A;  3CB5 A;  1R58 A;  2G6P A;  4A6V A;  2BHA A;  2B3L A;  2GG7 A;  3BIQ A;  4FO8 A;  4RZY A;  4PV4 A;  4ZNG A;  3FMR A;  2Q8K A;  1A16 A;  3BIT A;  4B28 A;  2GG8 A;  1QXZ A;  2GZ5 A;  2EA4 A;  5JHU A;  2ZSG A;  1YW7 A;  5FCH A;  4IF7 A;  2NQ7 A;  3MX6 A;  1QXW A;  4S00 A;  4U6C A;  5D6E A;  1C27 A;  4IKS A;  5CDV A; 
#chains in the Genus database with same CATH homology
 4Z7M A;  2EVM A;  4FLL A;  2V3Y A;  3RVA A;  4U71 A;  4FKC A;  2BWV A;  1KQ0 A;  5CDL A;  1KP0 A;  4A6W A;  2OAZ A;  1YW8 A;  2GGC A;  2GG9 A;  2BHC A;  2BH3 A;  3Q6D A;  1WN1 A;  4IDY A;  1XGN A;  2IW2 A;  4HXX A;  1W2M A;  4PNC A;  5E5B A;  5CNX A;  5FCF A;  2EA2 A;  3L24 A;  3MAT A;  5JI6 A;  1MAT A;  5CLS A;  4U6J A;  1B59 A;  4QR8 A;  2GA2 A;  2B3H A;  2GG3 A;  4RGZ 1;  4MAT A;  5CDE A;  1W7V A;  2MAT A;  2V3Z A;  3IU7 A;  4ZWU A;  4S2R P;  1WLR A;  3TAV A;  2P9A A;  4IKU A;  5CIK A;  2BB7 A;  4ZWO A;  2GGB A;  1QXY A;  3D27 A;  1WBQ A;  3L7G A;  2OKN A;  1R5H A;  4U76 A;  4U1B A;  1Y1N A;  3ROR A;  1YVM A;  2BHB A;  3PKA A;  1B6A A;  2BWT A;  4S2T P;  2BWX A;  1QZY A;  3CTZ A;  1WL6 A;  5D6F A;  2BWY A;  2EVO A;  1KQ9 A;  2GU4 A;  1M35 A;  1XGM A;  4U6W A;  4U69 A;  4RZZ A;  1C21 A;  1WY2 A;  3PKC A;  1CHM A;  4U6E A;  4OOK A;  4S01 A;  1YJ3 A;  4IKR A;  2Q93 A;  4U6Z A;  1YW9 A;  1WKM A;  1JAW A;  5CE6 A;  4KM3 A;  4FO7 A;  1BN5 A;  2BHD A;  2P98 A;  4JUQ A;  1XNZ A;  3IG4 A;  4IPA A;  1C23 A;  2BN7 A;  2BWS A;  4EGE A;  2GG0 A;  1XGS A;  3FMQ A;  4IU6 A;  2ADU A;  2Q92 A;  4U70 A;  2B3K A;  1XGO A;  2GTX A;  2Q96 A;  1BOA A;  3PKE A;  2GG2 A;  3PKB A;  2DFI A;  3PKD A;  3MR1 A;  3S6B A;  2P99 A;  4IEC A;  2GU6 A;  5JFR A;  4FLI A;  3CB6 A;  2BWU A;  2EVC A;  2GU7 A;  2HOW A;  1PV9 A;  2Q95 A;  4U73 A;  3BIP A;  1C24 A;  2V3X A;  4IKT A;  3TB5 A;  4U75 A;  2Q94 A;  1O0X A;  2NQ6 A;  4R60 A;  2GU5 A;  3IU8 A;  1N51 A;  1R5G A;  3IU9 A;  2BWW A;  2V6C A;  4ZWP A;  2GG5 A;  4FUK A;  1C22 A;  3FM3 A;  4FLJ A;  4FLK A;  1WL9 A;  3CB5 A;  1R58 A;  2G6P A;  4A6V A;  2BHA A;  2B3L A;  2GG7 A;  3BIQ A;  4FO8 A;  4RZY A;  4PV4 A;  4ZNG A;  3FMR A;  2Q8K A;  1A16 A;  3BIT A;  4B28 A;  2GG8 A;  1QXZ A;  2GZ5 A;  2EA4 A;  5JHU A;  2ZSG A;  1YW7 A;  5FCH A;  4IF7 A;  2NQ7 A;  3MX6 A;  1QXW A;  4S00 A;  4U6C A;  5D6E A;  1C27 A;  4IKS A;  5CDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...