4A6WA

X-ray structures of oxazole hydroxamate ecmetap-mn complexes
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
pubmed doi rcsb
total genus 83
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4a6wA00
2EA4A 4U6EA 2NQ7A 2B3KA 4PV4A 1WBQA 1WKMA 2GG2A 1BOAA 3TB5A 4U69A 2EA2A 2P99A 1YW7A 2GG5A 2P9AA 4ZWPA 5CDLA 4U1BA 4ZWUA 2GU7A 2GTXA 2Q92A 2V3YA 4FO7A 4OOKA 5JFRA 1WY2A 5CLSA 2GU5A 1C27A 1N51A 3PKCA 4KM3A 1BN5A 4FLIA 1KQ9A 4FO8A 5CE6A 4R60A 3FMQA 5CDVA 2V3ZA 3IU7A 3MX6A 2V3XA 4QR8A 1XGNA 2BHCA 4S00A 4U70A 3RVAA 4HXXA 2GA2A 3Q6DA 1R5GA 1XNZA 2Q93A 4IPAA 3D27A 1XGSA 3MR1A 4JUQA 4U71A 4FUKA 4IU6A 1KQ0A 3BIPA 5E5BA 2G6PA 2BN7A 2OKNA 1Y1NA 4MATA 4U76A 2BWUA 2GGCA 2DFIA 2GU6A 3FMRA 2P98A 4IKTA 1YJ3A 2Q94A 3PKBA 1R58A 3BITA 1A16A 3RORA 1W2MA 1YW8A 2IW2A 5FCHA 2GG7A 1M35A 5CDEA 4FKCA 2ZSGA 1O0XA 1MATA 3PKAA 2BH3A 3L7GA 1C23A 2OAZA 3CTZA 4FLKA 2Q96A 2B3LA 1PV9A 2EVMA 2BB7A 3FM3A 1KP0A 4RGZ1 2MATA 1R5HA 3IG4A 2BHAA 3CB5A 5CIKA 4S2TP 3S6BA 4EGEA 2BWWA 4IECA 5FCFA 1QZYA 4RZZA 4U6JA 3TAVA 1W7VA 1XGOA 2BWVA 2V6CA 3BIQA 2BHDA 2BHBA 4IKUA 4ZWOA 3L24A 2GG9A 4Z7MA 3MATA 1JAWA 1WL6A 2Q95A 2BWSA 4U75A 4FLJA 1WN1A 2BWXA 2GGBA 3PKDA 5D6FA 2B3HA 2BWYA 2EVOA 2NQ6A 4PNCA 5JI6A 1WL9A 1QXZA 4U6CA 5CNXA 4IDYA 4FLLA 1YVMA 4RZYA 1YW9A 5JHUA 1XGMA 4U6WA 2GG8A 5D6EA 2EVCA 4U6ZA 3PKEA 3IU8A 2HOWA 1B59A 2Q8KA 4B28A 2BWTA 1QXWA 2ADUA 1C24A 1CHMA 3CB6A 1C22A 4IKRA 4S01A 4S2RP 4IKSA 4IF7A 1C21A 1WLRA 2GG3A 2GU4A 4ZNGA 1B6AA 1QXYA 4A6VA 4A6WA 2GZ5A 2GG0A 3IU9A 4U73A
chains in the Genus database with same CATH superfamily
2EA4A 4U6EA 2NQ7A 2B3KA 4PV4A 1WBQA 1WKMA 2GG2A 1BOAA 3TB5A 4U69A 2EA2A 2P99A 1YW7A 2GG5A 2P9AA 4ZWPA 5CDLA 4U1BA 4ZWUA 2GU7A 2GTXA 2Q92A 2V3YA 4FO7A 4OOKA 5JFRA 1WY2A 5CLSA 2GU5A 1C27A 1N51A 3PKCA 4KM3A 1BN5A 4FLIA 1KQ9A 4FO8A 5CE6A 4R60A 3FMQA 5CDVA 2V3ZA 3IU7A 3MX6A 2V3XA 4QR8A 1XGNA 2BHCA 4S00A 4U70A 3RVAA 4HXXA 2GA2A 3Q6DA 1R5GA 1XNZA 2Q93A 4IPAA 3D27A 1XGSA 3MR1A 4JUQA 4U71A 4FUKA 4IU6A 1KQ0A 3BIPA 5E5BA 2G6PA 2BN7A 2OKNA 1Y1NA 4MATA 4U76A 2BWUA 2GGCA 2DFIA 2GU6A 3FMRA 2P98A 4IKTA 1YJ3A 2Q94A 3PKBA 1R58A 3BITA 1A16A 3RORA 1W2MA 1YW8A 2IW2A 5FCHA 2GG7A 1M35A 5CDEA 4FKCA 2ZSGA 1O0XA 1MATA 3PKAA 2BH3A 3L7GA 1C23A 2OAZA 3CTZA 4FLKA 2Q96A 2B3LA 1PV9A 2EVMA 2BB7A 3FM3A 1KP0A 4RGZ1 2MATA 1R5HA 3IG4A 2BHAA 3CB5A 5CIKA 4S2TP 3S6BA 4EGEA 2BWWA 4IECA 5FCFA 1QZYA 4RZZA 4U6JA 3TAVA 1W7VA 1XGOA 2BWVA 2V6CA 3BIQA 2BHDA 2BHBA 4IKUA 4ZWOA 3L24A 2GG9A 4Z7MA 3MATA 1JAWA 1WL6A 2Q95A 2BWSA 4U75A 4FLJA 1WN1A 2BWXA 2GGBA 3PKDA 5D6FA 2B3HA 2BWYA 2EVOA 2NQ6A 4PNCA 5JI6A 1WL9A 1QXZA 4U6CA 5CNXA 4IDYA 4FLLA 1YVMA 4RZYA 1YW9A 5JHUA 1XGMA 4U6WA 2GG8A 5D6EA 2EVCA 4U6ZA 3PKEA 3IU8A 2HOWA 1B59A 2Q8KA 4B28A 2BWTA 1QXWA 2ADUA 1C24A 1CHMA 3CB6A 1C22A 4IKRA 4S01A 4S2RP 4IKSA 4IF7A 1C21A 1WLRA 2GG3A 2GU4A 4ZNGA 1B6AA 1QXYA 4A6VA 4A6WA 2GZ5A 2GG0A 3IU9A 4U73A
chains in the Genus database with same CATH topology
2EA4A 4U6EA 2NQ7A 2B3KA 4PV4A 1WBQA 1WKMA 2GG2A 1BOAA 3TB5A 4U69A 2EA2A 2P99A 1YW7A 2GG5A 2P9AA 4ZWPA 5CDLA 4U1BA 4ZWUA 2GU7A 2GTXA 2Q92A 2V3YA 4FO7A 4OOKA 5JFRA 1WY2A 5CLSA 2GU5A 1C27A 1N51A 3PKCA 4KM3A 1BN5A 4FLIA 1KQ9A 4FO8A 5CE6A 4R60A 3FMQA 5CDVA 2V3ZA 3IU7A 3MX6A 2V3XA 4QR8A 1XGNA 2BHCA 4S00A 4U70A 3RVAA 4HXXA 2GA2A 3Q6DA 1R5GA 1XNZA 2Q93A 4IPAA 3D27A 1XGSA 3MR1A 4JUQA 4U71A 4FUKA 4IU6A 1KQ0A 3BIPA 5E5BA 2G6PA 2BN7A 2OKNA 1Y1NA 4MATA 4U76A 2BWUA 2GGCA 2DFIA 2GU6A 3FMRA 2P98A 4IKTA 1YJ3A 2Q94A 3PKBA 1R58A 3BITA 1A16A 3RORA 1W2MA 1YW8A 2IW2A 5FCHA 2GG7A 1M35A 5CDEA 4FKCA 2ZSGA 1O0XA 1MATA 3PKAA 2BH3A 3L7GA 1C23A 2OAZA 3CTZA 4FLKA 2Q96A 2B3LA 1PV9A 2EVMA 2BB7A 3FM3A 1KP0A 4RGZ1 2MATA 1R5HA 3IG4A 2BHAA 3CB5A 5CIKA 4S2TP 3S6BA 4EGEA 2BWWA 4IECA 5FCFA 1QZYA 4RZZA 4U6JA 3TAVA 1W7VA 1XGOA 2BWVA 2V6CA 3BIQA 2BHDA 2BHBA 4IKUA 4ZWOA 3L24A 2GG9A 4Z7MA 3MATA 1JAWA 1WL6A 2Q95A 2BWSA 4U75A 4FLJA 1WN1A 2BWXA 2GGBA 3PKDA 5D6FA 2B3HA 2BWYA 2EVOA 2NQ6A 4PNCA 5JI6A 1WL9A 1QXZA 4U6CA 5CNXA 4IDYA 4FLLA 1YVMA 4RZYA 1YW9A 5JHUA 1XGMA 4U6WA 2GG8A 5D6EA 2EVCA 4U6ZA 3PKEA 3IU8A 2HOWA 1B59A 2Q8KA 4B28A 2BWTA 1QXWA 2ADUA 1C24A 1CHMA 3CB6A 1C22A 4IKRA 4S01A 4S2RP 4IKSA 4IF7A 1C21A 1WLRA 2GG3A 2GU4A 4ZNGA 1B6AA 1QXYA 4A6VA 4A6WA 2GZ5A 2GG0A 3IU9A 4U73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA4 A;  4U6E A;  2NQ7 A;  2B3K A;  4PV4 A;  1WBQ A;  1WKM A;  2GG2 A;  1BOA A;  3TB5 A;  4U69 A;  2EA2 A;  2P99 A;  1YW7 A;  2GG5 A;  2P9A A;  4ZWP A;  5CDL A;  4U1B A;  4ZWU A;  2GU7 A;  2GTX A;  2Q92 A;  2V3Y A;  4FO7 A;  4OOK A;  5JFR A;  1WY2 A;  5CLS A;  2GU5 A;  1C27 A;  1N51 A;  3PKC A;  4KM3 A;  1BN5 A;  4FLI A;  1KQ9 A;  4FO8 A;  5CE6 A;  4R60 A;  3FMQ A;  5CDV A;  2V3Z A;  3IU7 A;  3MX6 A;  2V3X A;  4QR8 A;  1XGN A;  2BHC A;  4S00 A;  4U70 A;  3RVA A;  4HXX A;  2GA2 A;  3Q6D A;  1R5G A;  1XNZ A;  2Q93 A;  4IPA A;  3D27 A;  1XGS A;  3MR1 A;  4JUQ A;  4U71 A;  4FUK A;  4IU6 A;  1KQ0 A;  3BIP A;  5E5B A;  2G6P A;  2BN7 A;  2OKN A;  1Y1N A;  4MAT A;  4U76 A;  2BWU A;  2GGC A;  2DFI A;  2GU6 A;  3FMR A;  2P98 A;  4IKT A;  1YJ3 A;  2Q94 A;  3PKB A;  1R58 A;  3BIT A;  1A16 A;  3ROR A;  1W2M A;  1YW8 A;  2IW2 A;  5FCH A;  2GG7 A;  1M35 A;  5CDE A;  4FKC A;  2ZSG A;  1O0X A;  1MAT A;  3PKA A;  2BH3 A;  3L7G A;  1C23 A;  2OAZ A;  3CTZ A;  4FLK A;  2Q96 A;  2B3L A;  1PV9 A;  2EVM A;  2BB7 A;  3FM3 A;  1KP0 A;  4RGZ 1;  2MAT A;  1R5H A;  3IG4 A;  2BHA A;  3CB5 A;  5CIK A;  4S2T P;  3S6B A;  4EGE A;  2BWW A;  4IEC A;  5FCF A;  1QZY A;  4RZZ A;  4U6J A;  3TAV A;  1W7V A;  1XGO A;  2BWV A;  2V6C A;  3BIQ A;  2BHD A;  2BHB A;  4IKU A;  4ZWO A;  3L24 A;  2GG9 A;  4Z7M A;  3MAT A;  1JAW A;  1WL6 A;  2Q95 A;  2BWS A;  4U75 A;  4FLJ A;  1WN1 A;  2BWX A;  2GGB A;  3PKD A;  5D6F A;  2B3H A;  2BWY A;  2EVO A;  2NQ6 A;  4PNC A;  5JI6 A;  1WL9 A;  1QXZ A;  4U6C A;  5CNX A;  4IDY A;  4FLL A;  1YVM A;  4RZY A;  1YW9 A;  5JHU A;  1XGM A;  4U6W A;  2GG8 A;  5D6E A;  2EVC A;  4U6Z A;  3PKE A;  3IU8 A;  2HOW A;  1B59 A;  2Q8K A;  4B28 A;  2BWT A;  1QXW A;  2ADU A;  1C24 A;  1CHM A;  3CB6 A;  1C22 A;  4IKR A;  4S01 A;  4S2R P;  4IKS A;  4IF7 A;  1C21 A;  1WLR A;  2GG3 A;  2GU4 A;  4ZNG A;  1B6A A;  1QXY A;  4A6V A;  4A6W A;  2GZ5 A;  2GG0 A;  3IU9 A;  4U73 A; 
#chains in the Genus database with same CATH topology
 2EA4 A;  4U6E A;  2NQ7 A;  2B3K A;  4PV4 A;  1WBQ A;  1WKM A;  2GG2 A;  1BOA A;  3TB5 A;  4U69 A;  2EA2 A;  2P99 A;  1YW7 A;  2GG5 A;  2P9A A;  4ZWP A;  5CDL A;  4U1B A;  4ZWU A;  2GU7 A;  2GTX A;  2Q92 A;  2V3Y A;  4FO7 A;  4OOK A;  5JFR A;  1WY2 A;  5CLS A;  2GU5 A;  1C27 A;  1N51 A;  3PKC A;  4KM3 A;  1BN5 A;  4FLI A;  1KQ9 A;  4FO8 A;  5CE6 A;  4R60 A;  3FMQ A;  5CDV A;  2V3Z A;  3IU7 A;  3MX6 A;  2V3X A;  4QR8 A;  1XGN A;  2BHC A;  4S00 A;  4U70 A;  3RVA A;  4HXX A;  2GA2 A;  3Q6D A;  1R5G A;  1XNZ A;  2Q93 A;  4IPA A;  3D27 A;  1XGS A;  3MR1 A;  4JUQ A;  4U71 A;  4FUK A;  4IU6 A;  1KQ0 A;  3BIP A;  5E5B A;  2G6P A;  2BN7 A;  2OKN A;  1Y1N A;  4MAT A;  4U76 A;  2BWU A;  2GGC A;  2DFI A;  2GU6 A;  3FMR A;  2P98 A;  4IKT A;  1YJ3 A;  2Q94 A;  3PKB A;  1R58 A;  3BIT A;  1A16 A;  3ROR A;  1W2M A;  1YW8 A;  2IW2 A;  5FCH A;  2GG7 A;  1M35 A;  5CDE A;  4FKC A;  2ZSG A;  1O0X A;  1MAT A;  3PKA A;  2BH3 A;  3L7G A;  1C23 A;  2OAZ A;  3CTZ A;  4FLK A;  2Q96 A;  2B3L A;  1PV9 A;  2EVM A;  2BB7 A;  3FM3 A;  1KP0 A;  4RGZ 1;  2MAT A;  1R5H A;  3IG4 A;  2BHA A;  3CB5 A;  5CIK A;  4S2T P;  3S6B A;  4EGE A;  2BWW A;  4IEC A;  5FCF A;  1QZY A;  4RZZ A;  4U6J A;  3TAV A;  1W7V A;  1XGO A;  2BWV A;  2V6C A;  3BIQ A;  2BHD A;  2BHB A;  4IKU A;  4ZWO A;  3L24 A;  2GG9 A;  4Z7M A;  3MAT A;  1JAW A;  1WL6 A;  2Q95 A;  2BWS A;  4U75 A;  4FLJ A;  1WN1 A;  2BWX A;  2GGB A;  3PKD A;  5D6F A;  2B3H A;  2BWY A;  2EVO A;  2NQ6 A;  4PNC A;  5JI6 A;  1WL9 A;  1QXZ A;  4U6C A;  5CNX A;  4IDY A;  4FLL A;  1YVM A;  4RZY A;  1YW9 A;  5JHU A;  1XGM A;  4U6W A;  2GG8 A;  5D6E A;  2EVC A;  4U6Z A;  3PKE A;  3IU8 A;  2HOW A;  1B59 A;  2Q8K A;  4B28 A;  2BWT A;  1QXW A;  2ADU A;  1C24 A;  1CHM A;  3CB6 A;  1C22 A;  4IKR A;  4S01 A;  4S2R P;  4IKS A;  4IF7 A;  1C21 A;  1WLR A;  2GG3 A;  2GU4 A;  4ZNG A;  1B6A A;  1QXY A;  4A6V A;  4A6W A;  2GZ5 A;  2GG0 A;  3IU9 A;  4U73 A; 
#chains in the Genus database with same CATH homology
 2EA4 A;  4U6E A;  2NQ7 A;  2B3K A;  4PV4 A;  1WBQ A;  1WKM A;  2GG2 A;  1BOA A;  3TB5 A;  4U69 A;  2EA2 A;  2P99 A;  1YW7 A;  2GG5 A;  2P9A A;  4ZWP A;  5CDL A;  4U1B A;  4ZWU A;  2GU7 A;  2GTX A;  2Q92 A;  2V3Y A;  4FO7 A;  4OOK A;  5JFR A;  1WY2 A;  5CLS A;  2GU5 A;  1C27 A;  1N51 A;  3PKC A;  4KM3 A;  1BN5 A;  4FLI A;  1KQ9 A;  4FO8 A;  5CE6 A;  4R60 A;  3FMQ A;  5CDV A;  2V3Z A;  3IU7 A;  3MX6 A;  2V3X A;  4QR8 A;  1XGN A;  2BHC A;  4S00 A;  4U70 A;  3RVA A;  4HXX A;  2GA2 A;  3Q6D A;  1R5G A;  1XNZ A;  2Q93 A;  4IPA A;  3D27 A;  1XGS A;  3MR1 A;  4JUQ A;  4U71 A;  4FUK A;  4IU6 A;  1KQ0 A;  3BIP A;  5E5B A;  2G6P A;  2BN7 A;  2OKN A;  1Y1N A;  4MAT A;  4U76 A;  2BWU A;  2GGC A;  2DFI A;  2GU6 A;  3FMR A;  2P98 A;  4IKT A;  1YJ3 A;  2Q94 A;  3PKB A;  1R58 A;  3BIT A;  1A16 A;  3ROR A;  1W2M A;  1YW8 A;  2IW2 A;  5FCH A;  2GG7 A;  1M35 A;  5CDE A;  4FKC A;  2ZSG A;  1O0X A;  1MAT A;  3PKA A;  2BH3 A;  3L7G A;  1C23 A;  2OAZ A;  3CTZ A;  4FLK A;  2Q96 A;  2B3L A;  1PV9 A;  2EVM A;  2BB7 A;  3FM3 A;  1KP0 A;  4RGZ 1;  2MAT A;  1R5H A;  3IG4 A;  2BHA A;  3CB5 A;  5CIK A;  4S2T P;  3S6B A;  4EGE A;  2BWW A;  4IEC A;  5FCF A;  1QZY A;  4RZZ A;  4U6J A;  3TAV A;  1W7V A;  1XGO A;  2BWV A;  2V6C A;  3BIQ A;  2BHD A;  2BHB A;  4IKU A;  4ZWO A;  3L24 A;  2GG9 A;  4Z7M A;  3MAT A;  1JAW A;  1WL6 A;  2Q95 A;  2BWS A;  4U75 A;  4FLJ A;  1WN1 A;  2BWX A;  2GGB A;  3PKD A;  5D6F A;  2B3H A;  2BWY A;  2EVO A;  2NQ6 A;  4PNC A;  5JI6 A;  1WL9 A;  1QXZ A;  4U6C A;  5CNX A;  4IDY A;  4FLL A;  1YVM A;  4RZY A;  1YW9 A;  5JHU A;  1XGM A;  4U6W A;  2GG8 A;  5D6E A;  2EVC A;  4U6Z A;  3PKE A;  3IU8 A;  2HOW A;  1B59 A;  2Q8K A;  4B28 A;  2BWT A;  1QXW A;  2ADU A;  1C24 A;  1CHM A;  3CB6 A;  1C22 A;  4IKR A;  4S01 A;  4S2R P;  4IKS A;  4IF7 A;  1C21 A;  1WLR A;  2GG3 A;  2GU4 A;  4ZNG A;  1B6A A;  1QXY A;  4A6V A;  4A6W A;  2GZ5 A;  2GG0 A;  3IU9 A;  4U73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...