4A6WA

X-ray structures of oxazole hydroxamate ecmetap-mn complexes
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
pubmed doi rcsb
molecule tags Transferase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 83
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4a6wA00
3D27A 5FCHA 2DFIA 2GU7A 1XGSA 4U6CA 1WN1A 3RORA 1JAWA 2GG2A 4EGEA 2V6CA 2BWSA 1B59A 2OKNA 4U75A 1WLRA 4A6VA 2BHBA 2V3YA 2V3ZA 3MX6A 4U73A 2GG3A 1M35A 4FLIA 5CE6A 4QR8A 4IF7A 1W2MA 3RVAA 2BH3A 3L24A 1KQ0A 3Q6DA 1B6AA 4PV4A 5D6EA 2GG9A 4ZWPA 2Q96A 1XNZA 3IG4A 1XGNA 2P99A 3MR1A 5JI6A 1N51A 2NQ6A 4S2TP 2Q8KA 3TB5A 1YW8A 4S00A 3BIQA 1YW7A 3PKCA 2P9AA 2GG5A 3PKBA 2BHAA 4PNCA 4S01A 1KP0A 1C27A 2EVOA 2GZ5A 1Y1NA 3PKEA 2EA2A 5CLSA 2GG8A 3CTZA 4FUKA 4U76A 1BOAA 2Q92A 5JHUA 4U70A 3PKDA 2HOWA 1BN5A 1YVMA 4U6EA 1WL9A 1YW9A 3BIPA 2GG7A 1KQ9A 2GU6A 3L7GA 2Q93A 2P98A 4MATA 2ZSGA 4ZWOA 4IKTA 5CDLA 4IKRA 1WL6A 4U69A 2BN7A 4FLJA 1XGMA 4IKSA 1QZYA 2BWUA 5D6FA 1R5GA 4IU6A 4S2RP 4IDYA 2Q94A 2EVCA 1PV9A 1CHMA 1QXYA 4ZWUA 4B28A 4FO7A 1C22A 4OOKA 4R60A 2GTXA 1YJ3A 2NQ7A 1C24A 1WKMA 2BWWA 3IU7A 5CDEA 3FM3A 1WBQA 4FKCA 4IECA 4RZYA 4IPAA 5FCFA 2B3HA 3IU9A 4ZNGA 5E5BA 4FO8A 1QXZA 2OAZA 5CIKA 3S6BA 4U6JA 4FLLA 5JFRA 1A16A 2BHCA 3CB5A 5CDVA 4JUQA 4KM3A 3BITA 5CNXA 2G6PA 4A6WA 2GGBA 4FLKA 4IKUA 4U1BA 1R58A 3CB6A 1O0XA 2ADUA 2BWTA 3PKAA 1R5HA 4RGZ1 2B3KA 2BWYA 1MATA 2GG0A 4U6ZA 2IW2A 1XGOA 1QXWA 2V3XA 2B3LA 4U6WA 4Z7MA 2GU4A 2BWXA 2Q95A 3FMQA 1W7VA 1C21A 4U71A 3IU8A 3TAVA 2EA4A 4HXXA 2BHDA 2GU5A 4RZZA 2BB7A 3FMRA 2GGCA 3MATA 1C23A 2BWVA 1WY2A 2MATA 2EVMA 2GA2A
chains in the Genus database with same CATH superfamily
3D27A 5FCHA 2DFIA 2GU7A 1XGSA 4U6CA 1WN1A 3RORA 1JAWA 2GG2A 4EGEA 2V6CA 2BWSA 1B59A 2OKNA 4U75A 1WLRA 4A6VA 2BHBA 2V3YA 2V3ZA 3MX6A 4U73A 2GG3A 1M35A 4FLIA 5CE6A 4QR8A 4IF7A 1W2MA 3RVAA 2BH3A 3L24A 1KQ0A 3Q6DA 1B6AA 4PV4A 5D6EA 2GG9A 4ZWPA 2Q96A 1XNZA 3IG4A 1XGNA 2P99A 3MR1A 5JI6A 1N51A 2NQ6A 4S2TP 2Q8KA 3TB5A 1YW8A 4S00A 3BIQA 1YW7A 3PKCA 2P9AA 2GG5A 3PKBA 2BHAA 4PNCA 4S01A 1KP0A 1C27A 2EVOA 2GZ5A 1Y1NA 3PKEA 2EA2A 5CLSA 2GG8A 3CTZA 4FUKA 4U76A 1BOAA 2Q92A 5JHUA 4U70A 3PKDA 2HOWA 1BN5A 1YVMA 4U6EA 1WL9A 1YW9A 3BIPA 2GG7A 1KQ9A 2GU6A 3L7GA 2Q93A 2P98A 4MATA 2ZSGA 4ZWOA 4IKTA 5CDLA 4IKRA 1WL6A 4U69A 2BN7A 4FLJA 1XGMA 4IKSA 1QZYA 2BWUA 5D6FA 1R5GA 4IU6A 4S2RP 4IDYA 2Q94A 2EVCA 1PV9A 1CHMA 1QXYA 4ZWUA 4B28A 4FO7A 1C22A 4OOKA 4R60A 2GTXA 1YJ3A 2NQ7A 1C24A 1WKMA 2BWWA 3IU7A 5CDEA 3FM3A 1WBQA 4FKCA 4IECA 4RZYA 4IPAA 5FCFA 2B3HA 3IU9A 4ZNGA 5E5BA 4FO8A 1QXZA 2OAZA 5CIKA 3S6BA 4U6JA 4FLLA 5JFRA 1A16A 2BHCA 3CB5A 5CDVA 4JUQA 4KM3A 3BITA 5CNXA 2G6PA 4A6WA 2GGBA 4FLKA 4IKUA 4U1BA 1R58A 3CB6A 1O0XA 2ADUA 2BWTA 3PKAA 1R5HA 4RGZ1 2B3KA 2BWYA 1MATA 2GG0A 4U6ZA 2IW2A 1XGOA 1QXWA 2V3XA 2B3LA 4U6WA 4Z7MA 2GU4A 2BWXA 2Q95A 3FMQA 1W7VA 1C21A 4U71A 3IU8A 3TAVA 2EA4A 4HXXA 2BHDA 2GU5A 4RZZA 2BB7A 3FMRA 2GGCA 3MATA 1C23A 2BWVA 1WY2A 2MATA 2EVMA 2GA2A
chains in the Genus database with same CATH topology
3D27A 5FCHA 2DFIA 2GU7A 1XGSA 4U6CA 1WN1A 3RORA 1JAWA 2GG2A 4EGEA 2V6CA 2BWSA 1B59A 2OKNA 4U75A 1WLRA 4A6VA 2BHBA 2V3YA 2V3ZA 3MX6A 4U73A 2GG3A 1M35A 4FLIA 5CE6A 4QR8A 4IF7A 1W2MA 3RVAA 2BH3A 3L24A 1KQ0A 3Q6DA 1B6AA 4PV4A 5D6EA 2GG9A 4ZWPA 2Q96A 1XNZA 3IG4A 1XGNA 2P99A 3MR1A 5JI6A 1N51A 2NQ6A 4S2TP 2Q8KA 3TB5A 1YW8A 4S00A 3BIQA 1YW7A 3PKCA 2P9AA 2GG5A 3PKBA 2BHAA 4PNCA 4S01A 1KP0A 1C27A 2EVOA 2GZ5A 1Y1NA 3PKEA 2EA2A 5CLSA 2GG8A 3CTZA 4FUKA 4U76A 1BOAA 2Q92A 5JHUA 4U70A 3PKDA 2HOWA 1BN5A 1YVMA 4U6EA 1WL9A 1YW9A 3BIPA 2GG7A 1KQ9A 2GU6A 3L7GA 2Q93A 2P98A 4MATA 2ZSGA 4ZWOA 4IKTA 5CDLA 4IKRA 1WL6A 4U69A 2BN7A 4FLJA 1XGMA 4IKSA 1QZYA 2BWUA 5D6FA 1R5GA 4IU6A 4S2RP 4IDYA 2Q94A 2EVCA 1PV9A 1CHMA 1QXYA 4ZWUA 4B28A 4FO7A 1C22A 4OOKA 4R60A 2GTXA 1YJ3A 2NQ7A 1C24A 1WKMA 2BWWA 3IU7A 5CDEA 3FM3A 1WBQA 4FKCA 4IECA 4RZYA 4IPAA 5FCFA 2B3HA 3IU9A 4ZNGA 5E5BA 4FO8A 1QXZA 2OAZA 5CIKA 3S6BA 4U6JA 4FLLA 5JFRA 1A16A 2BHCA 3CB5A 5CDVA 4JUQA 4KM3A 3BITA 5CNXA 2G6PA 4A6WA 2GGBA 4FLKA 4IKUA 4U1BA 1R58A 3CB6A 1O0XA 2ADUA 2BWTA 3PKAA 1R5HA 4RGZ1 2B3KA 2BWYA 1MATA 2GG0A 4U6ZA 2IW2A 1XGOA 1QXWA 2V3XA 2B3LA 4U6WA 4Z7MA 2GU4A 2BWXA 2Q95A 3FMQA 1W7VA 1C21A 4U71A 3IU8A 3TAVA 2EA4A 4HXXA 2BHDA 2GU5A 4RZZA 2BB7A 3FMRA 2GGCA 3MATA 1C23A 2BWVA 1WY2A 2MATA 2EVMA 2GA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D27 A;  5FCH A;  2DFI A;  2GU7 A;  1XGS A;  4U6C A;  1WN1 A;  3ROR A;  1JAW A;  2GG2 A;  4EGE A;  2V6C A;  2BWS A;  1B59 A;  2OKN A;  4U75 A;  1WLR A;  4A6V A;  2BHB A;  2V3Y A;  2V3Z A;  3MX6 A;  4U73 A;  2GG3 A;  1M35 A;  4FLI A;  5CE6 A;  4QR8 A;  4IF7 A;  1W2M A;  3RVA A;  2BH3 A;  3L24 A;  1KQ0 A;  3Q6D A;  1B6A A;  4PV4 A;  5D6E A;  2GG9 A;  4ZWP A;  2Q96 A;  1XNZ A;  3IG4 A;  1XGN A;  2P99 A;  3MR1 A;  5JI6 A;  1N51 A;  2NQ6 A;  4S2T P;  2Q8K A;  3TB5 A;  1YW8 A;  4S00 A;  3BIQ A;  1YW7 A;  3PKC A;  2P9A A;  2GG5 A;  3PKB A;  2BHA A;  4PNC A;  4S01 A;  1KP0 A;  1C27 A;  2EVO A;  2GZ5 A;  1Y1N A;  3PKE A;  2EA2 A;  5CLS A;  2GG8 A;  3CTZ A;  4FUK A;  4U76 A;  1BOA A;  2Q92 A;  5JHU A;  4U70 A;  3PKD A;  2HOW A;  1BN5 A;  1YVM A;  4U6E A;  1WL9 A;  1YW9 A;  3BIP A;  2GG7 A;  1KQ9 A;  2GU6 A;  3L7G A;  2Q93 A;  2P98 A;  4MAT A;  2ZSG A;  4ZWO A;  4IKT A;  5CDL A;  4IKR A;  1WL6 A;  4U69 A;  2BN7 A;  4FLJ A;  1XGM A;  4IKS A;  1QZY A;  2BWU A;  5D6F A;  1R5G A;  4IU6 A;  4S2R P;  4IDY A;  2Q94 A;  2EVC A;  1PV9 A;  1CHM A;  1QXY A;  4ZWU A;  4B28 A;  4FO7 A;  1C22 A;  4OOK A;  4R60 A;  2GTX A;  1YJ3 A;  2NQ7 A;  1C24 A;  1WKM A;  2BWW A;  3IU7 A;  5CDE A;  3FM3 A;  1WBQ A;  4FKC A;  4IEC A;  4RZY A;  4IPA A;  5FCF A;  2B3H A;  3IU9 A;  4ZNG A;  5E5B A;  4FO8 A;  1QXZ A;  2OAZ A;  5CIK A;  3S6B A;  4U6J A;  4FLL A;  5JFR A;  1A16 A;  2BHC A;  3CB5 A;  5CDV A;  4JUQ A;  4KM3 A;  3BIT A;  5CNX A;  2G6P A;  4A6W A;  2GGB A;  4FLK A;  4IKU A;  4U1B A;  1R58 A;  3CB6 A;  1O0X A;  2ADU A;  2BWT A;  3PKA A;  1R5H A;  4RGZ 1;  2B3K A;  2BWY A;  1MAT A;  2GG0 A;  4U6Z A;  2IW2 A;  1XGO A;  1QXW A;  2V3X A;  2B3L A;  4U6W A;  4Z7M A;  2GU4 A;  2BWX A;  2Q95 A;  3FMQ A;  1W7V A;  1C21 A;  4U71 A;  3IU8 A;  3TAV A;  2EA4 A;  4HXX A;  2BHD A;  2GU5 A;  4RZZ A;  2BB7 A;  3FMR A;  2GGC A;  3MAT A;  1C23 A;  2BWV A;  1WY2 A;  2MAT A;  2EVM A;  2GA2 A; 
#chains in the Genus database with same CATH topology
 3D27 A;  5FCH A;  2DFI A;  2GU7 A;  1XGS A;  4U6C A;  1WN1 A;  3ROR A;  1JAW A;  2GG2 A;  4EGE A;  2V6C A;  2BWS A;  1B59 A;  2OKN A;  4U75 A;  1WLR A;  4A6V A;  2BHB A;  2V3Y A;  2V3Z A;  3MX6 A;  4U73 A;  2GG3 A;  1M35 A;  4FLI A;  5CE6 A;  4QR8 A;  4IF7 A;  1W2M A;  3RVA A;  2BH3 A;  3L24 A;  1KQ0 A;  3Q6D A;  1B6A A;  4PV4 A;  5D6E A;  2GG9 A;  4ZWP A;  2Q96 A;  1XNZ A;  3IG4 A;  1XGN A;  2P99 A;  3MR1 A;  5JI6 A;  1N51 A;  2NQ6 A;  4S2T P;  2Q8K A;  3TB5 A;  1YW8 A;  4S00 A;  3BIQ A;  1YW7 A;  3PKC A;  2P9A A;  2GG5 A;  3PKB A;  2BHA A;  4PNC A;  4S01 A;  1KP0 A;  1C27 A;  2EVO A;  2GZ5 A;  1Y1N A;  3PKE A;  2EA2 A;  5CLS A;  2GG8 A;  3CTZ A;  4FUK A;  4U76 A;  1BOA A;  2Q92 A;  5JHU A;  4U70 A;  3PKD A;  2HOW A;  1BN5 A;  1YVM A;  4U6E A;  1WL9 A;  1YW9 A;  3BIP A;  2GG7 A;  1KQ9 A;  2GU6 A;  3L7G A;  2Q93 A;  2P98 A;  4MAT A;  2ZSG A;  4ZWO A;  4IKT A;  5CDL A;  4IKR A;  1WL6 A;  4U69 A;  2BN7 A;  4FLJ A;  1XGM A;  4IKS A;  1QZY A;  2BWU A;  5D6F A;  1R5G A;  4IU6 A;  4S2R P;  4IDY A;  2Q94 A;  2EVC A;  1PV9 A;  1CHM A;  1QXY A;  4ZWU A;  4B28 A;  4FO7 A;  1C22 A;  4OOK A;  4R60 A;  2GTX A;  1YJ3 A;  2NQ7 A;  1C24 A;  1WKM A;  2BWW A;  3IU7 A;  5CDE A;  3FM3 A;  1WBQ A;  4FKC A;  4IEC A;  4RZY A;  4IPA A;  5FCF A;  2B3H A;  3IU9 A;  4ZNG A;  5E5B A;  4FO8 A;  1QXZ A;  2OAZ A;  5CIK A;  3S6B A;  4U6J A;  4FLL A;  5JFR A;  1A16 A;  2BHC A;  3CB5 A;  5CDV A;  4JUQ A;  4KM3 A;  3BIT A;  5CNX A;  2G6P A;  4A6W A;  2GGB A;  4FLK A;  4IKU A;  4U1B A;  1R58 A;  3CB6 A;  1O0X A;  2ADU A;  2BWT A;  3PKA A;  1R5H A;  4RGZ 1;  2B3K A;  2BWY A;  1MAT A;  2GG0 A;  4U6Z A;  2IW2 A;  1XGO A;  1QXW A;  2V3X A;  2B3L A;  4U6W A;  4Z7M A;  2GU4 A;  2BWX A;  2Q95 A;  3FMQ A;  1W7V A;  1C21 A;  4U71 A;  3IU8 A;  3TAV A;  2EA4 A;  4HXX A;  2BHD A;  2GU5 A;  4RZZ A;  2BB7 A;  3FMR A;  2GGC A;  3MAT A;  1C23 A;  2BWV A;  1WY2 A;  2MAT A;  2EVM A;  2GA2 A; 
#chains in the Genus database with same CATH homology
 3D27 A;  5FCH A;  2DFI A;  2GU7 A;  1XGS A;  4U6C A;  1WN1 A;  3ROR A;  1JAW A;  2GG2 A;  4EGE A;  2V6C A;  2BWS A;  1B59 A;  2OKN A;  4U75 A;  1WLR A;  4A6V A;  2BHB A;  2V3Y A;  2V3Z A;  3MX6 A;  4U73 A;  2GG3 A;  1M35 A;  4FLI A;  5CE6 A;  4QR8 A;  4IF7 A;  1W2M A;  3RVA A;  2BH3 A;  3L24 A;  1KQ0 A;  3Q6D A;  1B6A A;  4PV4 A;  5D6E A;  2GG9 A;  4ZWP A;  2Q96 A;  1XNZ A;  3IG4 A;  1XGN A;  2P99 A;  3MR1 A;  5JI6 A;  1N51 A;  2NQ6 A;  4S2T P;  2Q8K A;  3TB5 A;  1YW8 A;  4S00 A;  3BIQ A;  1YW7 A;  3PKC A;  2P9A A;  2GG5 A;  3PKB A;  2BHA A;  4PNC A;  4S01 A;  1KP0 A;  1C27 A;  2EVO A;  2GZ5 A;  1Y1N A;  3PKE A;  2EA2 A;  5CLS A;  2GG8 A;  3CTZ A;  4FUK A;  4U76 A;  1BOA A;  2Q92 A;  5JHU A;  4U70 A;  3PKD A;  2HOW A;  1BN5 A;  1YVM A;  4U6E A;  1WL9 A;  1YW9 A;  3BIP A;  2GG7 A;  1KQ9 A;  2GU6 A;  3L7G A;  2Q93 A;  2P98 A;  4MAT A;  2ZSG A;  4ZWO A;  4IKT A;  5CDL A;  4IKR A;  1WL6 A;  4U69 A;  2BN7 A;  4FLJ A;  1XGM A;  4IKS A;  1QZY A;  2BWU A;  5D6F A;  1R5G A;  4IU6 A;  4S2R P;  4IDY A;  2Q94 A;  2EVC A;  1PV9 A;  1CHM A;  1QXY A;  4ZWU A;  4B28 A;  4FO7 A;  1C22 A;  4OOK A;  4R60 A;  2GTX A;  1YJ3 A;  2NQ7 A;  1C24 A;  1WKM A;  2BWW A;  3IU7 A;  5CDE A;  3FM3 A;  1WBQ A;  4FKC A;  4IEC A;  4RZY A;  4IPA A;  5FCF A;  2B3H A;  3IU9 A;  4ZNG A;  5E5B A;  4FO8 A;  1QXZ A;  2OAZ A;  5CIK A;  3S6B A;  4U6J A;  4FLL A;  5JFR A;  1A16 A;  2BHC A;  3CB5 A;  5CDV A;  4JUQ A;  4KM3 A;  3BIT A;  5CNX A;  2G6P A;  4A6W A;  2GGB A;  4FLK A;  4IKU A;  4U1B A;  1R58 A;  3CB6 A;  1O0X A;  2ADU A;  2BWT A;  3PKA A;  1R5H A;  4RGZ 1;  2B3K A;  2BWY A;  1MAT A;  2GG0 A;  4U6Z A;  2IW2 A;  1XGO A;  1QXW A;  2V3X A;  2B3L A;  4U6W A;  4Z7M A;  2GU4 A;  2BWX A;  2Q95 A;  3FMQ A;  1W7V A;  1C21 A;  4U71 A;  3IU8 A;  3TAV A;  2EA4 A;  4HXX A;  2BHD A;  2GU5 A;  4RZZ A;  2BB7 A;  3FMR A;  2GGC A;  3MAT A;  1C23 A;  2BWV A;  1WY2 A;  2MAT A;  2EVM A;  2GA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...