4U6WA

Hsmetap (f220m) in complex with 1-amino-2-propylpentyl]phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6wA00
1QZYA 2DFIA 4U71A 4ZWUA 1MATA 4ZNGA 2ZSGA 4S2RP 4U6EA 4QR8A 1B59A 2GG8A 3PKAA 1WN1A 2B3HA 4IKUA 2GG9A 4S2TP 2BHCA 2BWXA 5CDLA 3S6BA 2BWSA 1R5HA 2HOWA 2V6CA 1WL6A 2EA4A 5FCFA 4U69A 1WLRA 2BWUA 1CHMA 1R58A 2OAZA 3TB5A 2OKNA 2ADUA 4RZZA 4FUKA 3L24A 3IU7A 1C24A 5FCHA 3PKEA 2BWYA 3BIPA 1WBQA 1WKMA 4A6VA 1BN5A 4U73A 1QXZA 2BWWA 5D6EA 2BHAA 4U6WA 3MR1A 3CB5A 1W7VA 3D27A 4IU6A 3PKDA 4R60A 4OOKA 2P9AA 1N51A 5JI6A 4A6WA 2GU6A 4IKRA 1WY2A 3RORA 2GG0A 1XGSA 5JFRA 2Q93A 3MX6A 2G6PA 4B28A 1QXWA 5CE6A 5CDEA 4FKCA 4S01A 1BOAA 4FLLA 2EVCA 2EA2A 2V3ZA 4IKSA 5CNXA 2BHBA 1W2MA 3L7GA 2BB7A 1M35A 4ZWPA 4U6ZA 1O0XA 2NQ7A 5E5BA 1JAWA 2GU7A 2Q94A 1YVMA 2GA2A 4IF7A 5CDVA 1WL9A 4JUQA 5CIKA 4U1BA 4KM3A 2BWVA 2GU5A 3BIQA 3TAVA 1C23A 4IKTA 4IPAA 1C22A 2Q95A 2P98A 3PKCA 2EVOA 4EGEA 2Q96A 4Z7MA 3FM3A 1R5GA 2Q8KA 1QXYA 1YW7A 2GU4A 2V3YA 2BN7A 2Q92A 1XGMA 3PKBA 2NQ6A 4FO7A 2B3KA 5CLSA 1YW8A 2IW2A 2GG5A 4U70A 5D6FA 4ZWOA 4FO8A 1PV9A 1YW9A 4U76A 4RGZ1 2GTXA 3RVAA 3IU8A 4U6JA 1Y1NA 2GGBA 2GGCA 2GG2A 3FMRA 3BITA 3CB6A 2P99A 3CTZA 1KP0A 2V3XA 1YJ3A 2EVMA 2MATA 1XNZA 4IDYA 2BH3A 1XGNA 3IG4A 4FLJA 1C27A 3IU9A 1A16A 4FLIA 1B6AA 3FMQA 1XGOA 1KQ9A 4U75A 1C21A 4MATA 2BWTA 4IECA 5JHUA 2GG3A 1KQ0A 3MATA 4HXXA 4U6CA 4FLKA 2GG7A 2GZ5A 4PV4A 2BHDA 2B3LA 4PNCA 3Q6DA 4S00A 4RZYA
chains in the Genus database with same CATH superfamily
1QZYA 2DFIA 4U71A 4ZWUA 1MATA 4ZNGA 2ZSGA 4S2RP 4U6EA 4QR8A 1B59A 2GG8A 3PKAA 1WN1A 2B3HA 4IKUA 2GG9A 4S2TP 2BHCA 2BWXA 5CDLA 3S6BA 2BWSA 1R5HA 2HOWA 2V6CA 1WL6A 2EA4A 5FCFA 4U69A 1WLRA 2BWUA 1CHMA 1R58A 2OAZA 3TB5A 2OKNA 2ADUA 4RZZA 4FUKA 3L24A 3IU7A 1C24A 5FCHA 3PKEA 2BWYA 3BIPA 1WBQA 1WKMA 4A6VA 1BN5A 4U73A 1QXZA 2BWWA 5D6EA 2BHAA 4U6WA 3MR1A 3CB5A 1W7VA 3D27A 4IU6A 3PKDA 4R60A 4OOKA 2P9AA 1N51A 5JI6A 4A6WA 2GU6A 4IKRA 1WY2A 3RORA 2GG0A 1XGSA 5JFRA 2Q93A 3MX6A 2G6PA 4B28A 1QXWA 5CE6A 5CDEA 4FKCA 4S01A 1BOAA 4FLLA 2EVCA 2EA2A 2V3ZA 4IKSA 5CNXA 2BHBA 1W2MA 3L7GA 2BB7A 1M35A 4ZWPA 4U6ZA 1O0XA 2NQ7A 5E5BA 1JAWA 2GU7A 2Q94A 1YVMA 2GA2A 4IF7A 5CDVA 1WL9A 4JUQA 5CIKA 4U1BA 4KM3A 2BWVA 2GU5A 3BIQA 3TAVA 1C23A 4IKTA 4IPAA 1C22A 2Q95A 2P98A 3PKCA 2EVOA 4EGEA 2Q96A 4Z7MA 3FM3A 1R5GA 2Q8KA 1QXYA 1YW7A 2GU4A 2V3YA 2BN7A 2Q92A 1XGMA 3PKBA 2NQ6A 4FO7A 2B3KA 5CLSA 1YW8A 2IW2A 2GG5A 4U70A 5D6FA 4ZWOA 4FO8A 1PV9A 1YW9A 4U76A 4RGZ1 2GTXA 3RVAA 3IU8A 4U6JA 1Y1NA 2GGBA 2GGCA 2GG2A 3FMRA 3BITA 3CB6A 2P99A 3CTZA 1KP0A 2V3XA 1YJ3A 2EVMA 2MATA 1XNZA 4IDYA 2BH3A 1XGNA 3IG4A 4FLJA 1C27A 3IU9A 1A16A 4FLIA 1B6AA 3FMQA 1XGOA 1KQ9A 4U75A 1C21A 4MATA 2BWTA 4IECA 5JHUA 2GG3A 1KQ0A 3MATA 4HXXA 4U6CA 4FLKA 2GG7A 2GZ5A 4PV4A 2BHDA 2B3LA 4PNCA 3Q6DA 4S00A 4RZYA
chains in the Genus database with same CATH topology
1QZYA 2DFIA 4U71A 4ZWUA 1MATA 4ZNGA 2ZSGA 4S2RP 4U6EA 4QR8A 1B59A 2GG8A 3PKAA 1WN1A 2B3HA 4IKUA 2GG9A 4S2TP 2BHCA 2BWXA 5CDLA 3S6BA 2BWSA 1R5HA 2HOWA 2V6CA 1WL6A 2EA4A 5FCFA 4U69A 1WLRA 2BWUA 1CHMA 1R58A 2OAZA 3TB5A 2OKNA 2ADUA 4RZZA 4FUKA 3L24A 3IU7A 1C24A 5FCHA 3PKEA 2BWYA 3BIPA 1WBQA 1WKMA 4A6VA 1BN5A 4U73A 1QXZA 2BWWA 5D6EA 2BHAA 4U6WA 3MR1A 3CB5A 1W7VA 3D27A 4IU6A 3PKDA 4R60A 4OOKA 2P9AA 1N51A 5JI6A 4A6WA 2GU6A 4IKRA 1WY2A 3RORA 2GG0A 1XGSA 5JFRA 2Q93A 3MX6A 2G6PA 4B28A 1QXWA 5CE6A 5CDEA 4FKCA 4S01A 1BOAA 4FLLA 2EVCA 2EA2A 2V3ZA 4IKSA 5CNXA 2BHBA 1W2MA 3L7GA 2BB7A 1M35A 4ZWPA 4U6ZA 1O0XA 2NQ7A 5E5BA 1JAWA 2GU7A 2Q94A 1YVMA 2GA2A 4IF7A 5CDVA 1WL9A 4JUQA 5CIKA 4U1BA 4KM3A 2BWVA 2GU5A 3BIQA 3TAVA 1C23A 4IKTA 4IPAA 1C22A 2Q95A 2P98A 3PKCA 2EVOA 4EGEA 2Q96A 4Z7MA 3FM3A 1R5GA 2Q8KA 1QXYA 1YW7A 2GU4A 2V3YA 2BN7A 2Q92A 1XGMA 3PKBA 2NQ6A 4FO7A 2B3KA 5CLSA 1YW8A 2IW2A 2GG5A 4U70A 5D6FA 4ZWOA 4FO8A 1PV9A 1YW9A 4U76A 4RGZ1 2GTXA 3RVAA 3IU8A 4U6JA 1Y1NA 2GGBA 2GGCA 2GG2A 3FMRA 3BITA 3CB6A 2P99A 3CTZA 1KP0A 2V3XA 1YJ3A 2EVMA 2MATA 1XNZA 4IDYA 2BH3A 1XGNA 3IG4A 4FLJA 1C27A 3IU9A 1A16A 4FLIA 1B6AA 3FMQA 1XGOA 1KQ9A 4U75A 1C21A 4MATA 2BWTA 4IECA 5JHUA 2GG3A 1KQ0A 3MATA 4HXXA 4U6CA 4FLKA 2GG7A 2GZ5A 4PV4A 2BHDA 2B3LA 4PNCA 3Q6DA 4S00A 4RZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZY A;  2DFI A;  4U71 A;  4ZWU A;  1MAT A;  4ZNG A;  2ZSG A;  4S2R P;  4U6E A;  4QR8 A;  1B59 A;  2GG8 A;  3PKA A;  1WN1 A;  2B3H A;  4IKU A;  2GG9 A;  4S2T P;  2BHC A;  2BWX A;  5CDL A;  3S6B A;  2BWS A;  1R5H A;  2HOW A;  2V6C A;  1WL6 A;  2EA4 A;  5FCF A;  4U69 A;  1WLR A;  2BWU A;  1CHM A;  1R58 A;  2OAZ A;  3TB5 A;  2OKN A;  2ADU A;  4RZZ A;  4FUK A;  3L24 A;  3IU7 A;  1C24 A;  5FCH A;  3PKE A;  2BWY A;  3BIP A;  1WBQ A;  1WKM A;  4A6V A;  1BN5 A;  4U73 A;  1QXZ A;  2BWW A;  5D6E A;  2BHA A;  4U6W A;  3MR1 A;  3CB5 A;  1W7V A;  3D27 A;  4IU6 A;  3PKD A;  4R60 A;  4OOK A;  2P9A A;  1N51 A;  5JI6 A;  4A6W A;  2GU6 A;  4IKR A;  1WY2 A;  3ROR A;  2GG0 A;  1XGS A;  5JFR A;  2Q93 A;  3MX6 A;  2G6P A;  4B28 A;  1QXW A;  5CE6 A;  5CDE A;  4FKC A;  4S01 A;  1BOA A;  4FLL A;  2EVC A;  2EA2 A;  2V3Z A;  4IKS A;  5CNX A;  2BHB A;  1W2M A;  3L7G A;  2BB7 A;  1M35 A;  4ZWP A;  4U6Z A;  1O0X A;  2NQ7 A;  5E5B A;  1JAW A;  2GU7 A;  2Q94 A;  1YVM A;  2GA2 A;  4IF7 A;  5CDV A;  1WL9 A;  4JUQ A;  5CIK A;  4U1B A;  4KM3 A;  2BWV A;  2GU5 A;  3BIQ A;  3TAV A;  1C23 A;  4IKT A;  4IPA A;  1C22 A;  2Q95 A;  2P98 A;  3PKC A;  2EVO A;  4EGE A;  2Q96 A;  4Z7M A;  3FM3 A;  1R5G A;  2Q8K A;  1QXY A;  1YW7 A;  2GU4 A;  2V3Y A;  2BN7 A;  2Q92 A;  1XGM A;  3PKB A;  2NQ6 A;  4FO7 A;  2B3K A;  5CLS A;  1YW8 A;  2IW2 A;  2GG5 A;  4U70 A;  5D6F A;  4ZWO A;  4FO8 A;  1PV9 A;  1YW9 A;  4U76 A;  4RGZ 1;  2GTX A;  3RVA A;  3IU8 A;  4U6J A;  1Y1N A;  2GGB A;  2GGC A;  2GG2 A;  3FMR A;  3BIT A;  3CB6 A;  2P99 A;  3CTZ A;  1KP0 A;  2V3X A;  1YJ3 A;  2EVM A;  2MAT A;  1XNZ A;  4IDY A;  2BH3 A;  1XGN A;  3IG4 A;  4FLJ A;  1C27 A;  3IU9 A;  1A16 A;  4FLI A;  1B6A A;  3FMQ A;  1XGO A;  1KQ9 A;  4U75 A;  1C21 A;  4MAT A;  2BWT A;  4IEC A;  5JHU A;  2GG3 A;  1KQ0 A;  3MAT A;  4HXX A;  4U6C A;  4FLK A;  2GG7 A;  2GZ5 A;  4PV4 A;  2BHD A;  2B3L A;  4PNC A;  3Q6D A;  4S00 A;  4RZY A; 
#chains in the Genus database with same CATH topology
 1QZY A;  2DFI A;  4U71 A;  4ZWU A;  1MAT A;  4ZNG A;  2ZSG A;  4S2R P;  4U6E A;  4QR8 A;  1B59 A;  2GG8 A;  3PKA A;  1WN1 A;  2B3H A;  4IKU A;  2GG9 A;  4S2T P;  2BHC A;  2BWX A;  5CDL A;  3S6B A;  2BWS A;  1R5H A;  2HOW A;  2V6C A;  1WL6 A;  2EA4 A;  5FCF A;  4U69 A;  1WLR A;  2BWU A;  1CHM A;  1R58 A;  2OAZ A;  3TB5 A;  2OKN A;  2ADU A;  4RZZ A;  4FUK A;  3L24 A;  3IU7 A;  1C24 A;  5FCH A;  3PKE A;  2BWY A;  3BIP A;  1WBQ A;  1WKM A;  4A6V A;  1BN5 A;  4U73 A;  1QXZ A;  2BWW A;  5D6E A;  2BHA A;  4U6W A;  3MR1 A;  3CB5 A;  1W7V A;  3D27 A;  4IU6 A;  3PKD A;  4R60 A;  4OOK A;  2P9A A;  1N51 A;  5JI6 A;  4A6W A;  2GU6 A;  4IKR A;  1WY2 A;  3ROR A;  2GG0 A;  1XGS A;  5JFR A;  2Q93 A;  3MX6 A;  2G6P A;  4B28 A;  1QXW A;  5CE6 A;  5CDE A;  4FKC A;  4S01 A;  1BOA A;  4FLL A;  2EVC A;  2EA2 A;  2V3Z A;  4IKS A;  5CNX A;  2BHB A;  1W2M A;  3L7G A;  2BB7 A;  1M35 A;  4ZWP A;  4U6Z A;  1O0X A;  2NQ7 A;  5E5B A;  1JAW A;  2GU7 A;  2Q94 A;  1YVM A;  2GA2 A;  4IF7 A;  5CDV A;  1WL9 A;  4JUQ A;  5CIK A;  4U1B A;  4KM3 A;  2BWV A;  2GU5 A;  3BIQ A;  3TAV A;  1C23 A;  4IKT A;  4IPA A;  1C22 A;  2Q95 A;  2P98 A;  3PKC A;  2EVO A;  4EGE A;  2Q96 A;  4Z7M A;  3FM3 A;  1R5G A;  2Q8K A;  1QXY A;  1YW7 A;  2GU4 A;  2V3Y A;  2BN7 A;  2Q92 A;  1XGM A;  3PKB A;  2NQ6 A;  4FO7 A;  2B3K A;  5CLS A;  1YW8 A;  2IW2 A;  2GG5 A;  4U70 A;  5D6F A;  4ZWO A;  4FO8 A;  1PV9 A;  1YW9 A;  4U76 A;  4RGZ 1;  2GTX A;  3RVA A;  3IU8 A;  4U6J A;  1Y1N A;  2GGB A;  2GGC A;  2GG2 A;  3FMR A;  3BIT A;  3CB6 A;  2P99 A;  3CTZ A;  1KP0 A;  2V3X A;  1YJ3 A;  2EVM A;  2MAT A;  1XNZ A;  4IDY A;  2BH3 A;  1XGN A;  3IG4 A;  4FLJ A;  1C27 A;  3IU9 A;  1A16 A;  4FLI A;  1B6A A;  3FMQ A;  1XGO A;  1KQ9 A;  4U75 A;  1C21 A;  4MAT A;  2BWT A;  4IEC A;  5JHU A;  2GG3 A;  1KQ0 A;  3MAT A;  4HXX A;  4U6C A;  4FLK A;  2GG7 A;  2GZ5 A;  4PV4 A;  2BHD A;  2B3L A;  4PNC A;  3Q6D A;  4S00 A;  4RZY A; 
#chains in the Genus database with same CATH homology
 1QZY A;  2DFI A;  4U71 A;  4ZWU A;  1MAT A;  4ZNG A;  2ZSG A;  4S2R P;  4U6E A;  4QR8 A;  1B59 A;  2GG8 A;  3PKA A;  1WN1 A;  2B3H A;  4IKU A;  2GG9 A;  4S2T P;  2BHC A;  2BWX A;  5CDL A;  3S6B A;  2BWS A;  1R5H A;  2HOW A;  2V6C A;  1WL6 A;  2EA4 A;  5FCF A;  4U69 A;  1WLR A;  2BWU A;  1CHM A;  1R58 A;  2OAZ A;  3TB5 A;  2OKN A;  2ADU A;  4RZZ A;  4FUK A;  3L24 A;  3IU7 A;  1C24 A;  5FCH A;  3PKE A;  2BWY A;  3BIP A;  1WBQ A;  1WKM A;  4A6V A;  1BN5 A;  4U73 A;  1QXZ A;  2BWW A;  5D6E A;  2BHA A;  4U6W A;  3MR1 A;  3CB5 A;  1W7V A;  3D27 A;  4IU6 A;  3PKD A;  4R60 A;  4OOK A;  2P9A A;  1N51 A;  5JI6 A;  4A6W A;  2GU6 A;  4IKR A;  1WY2 A;  3ROR A;  2GG0 A;  1XGS A;  5JFR A;  2Q93 A;  3MX6 A;  2G6P A;  4B28 A;  1QXW A;  5CE6 A;  5CDE A;  4FKC A;  4S01 A;  1BOA A;  4FLL A;  2EVC A;  2EA2 A;  2V3Z A;  4IKS A;  5CNX A;  2BHB A;  1W2M A;  3L7G A;  2BB7 A;  1M35 A;  4ZWP A;  4U6Z A;  1O0X A;  2NQ7 A;  5E5B A;  1JAW A;  2GU7 A;  2Q94 A;  1YVM A;  2GA2 A;  4IF7 A;  5CDV A;  1WL9 A;  4JUQ A;  5CIK A;  4U1B A;  4KM3 A;  2BWV A;  2GU5 A;  3BIQ A;  3TAV A;  1C23 A;  4IKT A;  4IPA A;  1C22 A;  2Q95 A;  2P98 A;  3PKC A;  2EVO A;  4EGE A;  2Q96 A;  4Z7M A;  3FM3 A;  1R5G A;  2Q8K A;  1QXY A;  1YW7 A;  2GU4 A;  2V3Y A;  2BN7 A;  2Q92 A;  1XGM A;  3PKB A;  2NQ6 A;  4FO7 A;  2B3K A;  5CLS A;  1YW8 A;  2IW2 A;  2GG5 A;  4U70 A;  5D6F A;  4ZWO A;  4FO8 A;  1PV9 A;  1YW9 A;  4U76 A;  4RGZ 1;  2GTX A;  3RVA A;  3IU8 A;  4U6J A;  1Y1N A;  2GGB A;  2GGC A;  2GG2 A;  3FMR A;  3BIT A;  3CB6 A;  2P99 A;  3CTZ A;  1KP0 A;  2V3X A;  1YJ3 A;  2EVM A;  2MAT A;  1XNZ A;  4IDY A;  2BH3 A;  1XGN A;  3IG4 A;  4FLJ A;  1C27 A;  3IU9 A;  1A16 A;  4FLI A;  1B6A A;  3FMQ A;  1XGO A;  1KQ9 A;  4U75 A;  1C21 A;  4MAT A;  2BWT A;  4IEC A;  5JHU A;  2GG3 A;  1KQ0 A;  3MAT A;  4HXX A;  4U6C A;  4FLK A;  2GG7 A;  2GZ5 A;  4PV4 A;  2BHD A;  2B3L A;  4PNC A;  3Q6D A;  4S00 A;  4RZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...