4U6WA

Hsmetap (f220m) in complex with 1-amino-2-propylpentyl]phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6wA00
1CHMA 4U6WA 2BWYA 5CNXA 1C27A 1BN5A 2GG9A 4S2RP 5CDEA 4U6ZA 3TB5A 2P99A 5CDVA 2BHBA 2GU6A 1XGSA 4U70A 4FLJA 3PKBA 2Q8KA 2GGCA 2Q96A 4IECA 3CB6A 2BHCA 1XGNA 2GU4A 2BWUA 2G6PA 1YVMA 2BWSA 3IU8A 1A16A 3RORA 2V3YA 1B59A 1XGOA 2GG7A 2MATA 2Q95A 2B3LA 3L24A 4JUQA 1YW8A 4U69A 4FUKA 1XNZA 1WKMA 2EA2A 5D6EA 4ZWUA 3MX6A 4Z7MA 1YW7A 4B28A 4FLKA 1XGMA 2GG2A 4U73A 4A6WA 4IKTA 4OOKA 1WLRA 2GG3A 2EVCA 1QZYA 4U6JA 1WN1A 2GU5A 1WBQA 2NQ6A 2GZ5A 1Y1NA 2B3KA 4S2TP 3BIQA 5E5BA 4MATA 2GA2A 2NQ7A 4HXXA 4ZWOA 1QXWA 1M35A 3L7GA 2Q93A 1YJ3A 4S01A 2V3ZA 4PNCA 4R60A 2BWWA 5CDLA 2P98A 3Q6DA 2EVMA 1W2MA 4EGEA 2BWXA 2V3XA 5CLSA 5FCFA 2BH3A 1KP0A 4U6EA 1WL9A 3PKAA 4RZYA 2Q92A 1N51A 4U6CA 2B3HA 2BHAA 2DFIA 3CTZA 2BB7A 1WY2A 5JHUA 5CIKA 2GG5A 4IU6A 3FMQA 4U1BA 2HOWA 1BOAA 1KQ9A 2OAZA 2BN7A 1R5GA 4IKRA 2ZSGA 2V6CA 4S00A 2BWTA 2IW2A 4U71A 1C22A 4IDYA 3TAVA 2EA4A 2Q94A 4IKSA 1QXYA 1QXZA 1C24A 4QR8A 3S6BA 1JAWA 4FO8A 4RZZA 4FLIA 3PKCA 2BWVA 4PV4A 2P9AA 5D6FA 1B6AA 2GGBA 1YW9A 5FCHA 3RVAA 2GU7A 3MATA 3BIPA 4KM3A 5CE6A 2ADUA 1R58A 2GG0A 4FKCA 3PKDA 4ZWPA 4A6VA 3PKEA 1KQ0A 5JFRA 2BHDA 2GG8A 1C21A 1C23A 3IG4A 1O0XA 1W7VA 1PV9A 2EVOA 3IU7A 2GTXA 5JI6A 3FM3A 1R5HA 4ZNGA 2OKNA 1MATA 4U75A 4FLLA 4U76A 1WL6A 3CB5A 3MR1A 4FO7A 3BITA 3IU9A 4RGZ1 4IF7A 4IPAA 3D27A 3FMRA 4IKUA
chains in the Genus database with same CATH superfamily
1CHMA 4U6WA 2BWYA 5CNXA 1C27A 1BN5A 2GG9A 4S2RP 5CDEA 4U6ZA 3TB5A 2P99A 5CDVA 2BHBA 2GU6A 1XGSA 4U70A 4FLJA 3PKBA 2Q8KA 2GGCA 2Q96A 4IECA 3CB6A 2BHCA 1XGNA 2GU4A 2BWUA 2G6PA 1YVMA 2BWSA 3IU8A 1A16A 3RORA 2V3YA 1B59A 1XGOA 2GG7A 2MATA 2Q95A 2B3LA 3L24A 4JUQA 1YW8A 4U69A 4FUKA 1XNZA 1WKMA 2EA2A 5D6EA 4ZWUA 3MX6A 4Z7MA 1YW7A 4B28A 4FLKA 1XGMA 2GG2A 4U73A 4A6WA 4IKTA 4OOKA 1WLRA 2GG3A 2EVCA 1QZYA 4U6JA 1WN1A 2GU5A 1WBQA 2NQ6A 2GZ5A 1Y1NA 2B3KA 4S2TP 3BIQA 5E5BA 4MATA 2GA2A 2NQ7A 4HXXA 4ZWOA 1QXWA 1M35A 3L7GA 2Q93A 1YJ3A 4S01A 2V3ZA 4PNCA 4R60A 2BWWA 5CDLA 2P98A 3Q6DA 2EVMA 1W2MA 4EGEA 2BWXA 2V3XA 5CLSA 5FCFA 2BH3A 1KP0A 4U6EA 1WL9A 3PKAA 4RZYA 2Q92A 1N51A 4U6CA 2B3HA 2BHAA 2DFIA 3CTZA 2BB7A 1WY2A 5JHUA 5CIKA 2GG5A 4IU6A 3FMQA 4U1BA 2HOWA 1BOAA 1KQ9A 2OAZA 2BN7A 1R5GA 4IKRA 2ZSGA 2V6CA 4S00A 2BWTA 2IW2A 4U71A 1C22A 4IDYA 3TAVA 2EA4A 2Q94A 4IKSA 1QXYA 1QXZA 1C24A 4QR8A 3S6BA 1JAWA 4FO8A 4RZZA 4FLIA 3PKCA 2BWVA 4PV4A 2P9AA 5D6FA 1B6AA 2GGBA 1YW9A 5FCHA 3RVAA 2GU7A 3MATA 3BIPA 4KM3A 5CE6A 2ADUA 1R58A 2GG0A 4FKCA 3PKDA 4ZWPA 4A6VA 3PKEA 1KQ0A 5JFRA 2BHDA 2GG8A 1C21A 1C23A 3IG4A 1O0XA 1W7VA 1PV9A 2EVOA 3IU7A 2GTXA 5JI6A 3FM3A 1R5HA 4ZNGA 2OKNA 1MATA 4U75A 4FLLA 4U76A 1WL6A 3CB5A 3MR1A 4FO7A 3BITA 3IU9A 4RGZ1 4IF7A 4IPAA 3D27A 3FMRA 4IKUA
chains in the Genus database with same CATH topology
1CHMA 4U6WA 2BWYA 5CNXA 1C27A 1BN5A 2GG9A 4S2RP 5CDEA 4U6ZA 3TB5A 2P99A 5CDVA 2BHBA 2GU6A 1XGSA 4U70A 4FLJA 3PKBA 2Q8KA 2GGCA 2Q96A 4IECA 3CB6A 2BHCA 1XGNA 2GU4A 2BWUA 2G6PA 1YVMA 2BWSA 3IU8A 1A16A 3RORA 2V3YA 1B59A 1XGOA 2GG7A 2MATA 2Q95A 2B3LA 3L24A 4JUQA 1YW8A 4U69A 4FUKA 1XNZA 1WKMA 2EA2A 5D6EA 4ZWUA 3MX6A 4Z7MA 1YW7A 4B28A 4FLKA 1XGMA 2GG2A 4U73A 4A6WA 4IKTA 4OOKA 1WLRA 2GG3A 2EVCA 1QZYA 4U6JA 1WN1A 2GU5A 1WBQA 2NQ6A 2GZ5A 1Y1NA 2B3KA 4S2TP 3BIQA 5E5BA 4MATA 2GA2A 2NQ7A 4HXXA 4ZWOA 1QXWA 1M35A 3L7GA 2Q93A 1YJ3A 4S01A 2V3ZA 4PNCA 4R60A 2BWWA 5CDLA 2P98A 3Q6DA 2EVMA 1W2MA 4EGEA 2BWXA 2V3XA 5CLSA 5FCFA 2BH3A 1KP0A 4U6EA 1WL9A 3PKAA 4RZYA 2Q92A 1N51A 4U6CA 2B3HA 2BHAA 2DFIA 3CTZA 2BB7A 1WY2A 5JHUA 5CIKA 2GG5A 4IU6A 3FMQA 4U1BA 2HOWA 1BOAA 1KQ9A 2OAZA 2BN7A 1R5GA 4IKRA 2ZSGA 2V6CA 4S00A 2BWTA 2IW2A 4U71A 1C22A 4IDYA 3TAVA 2EA4A 2Q94A 4IKSA 1QXYA 1QXZA 1C24A 4QR8A 3S6BA 1JAWA 4FO8A 4RZZA 4FLIA 3PKCA 2BWVA 4PV4A 2P9AA 5D6FA 1B6AA 2GGBA 1YW9A 5FCHA 3RVAA 2GU7A 3MATA 3BIPA 4KM3A 5CE6A 2ADUA 1R58A 2GG0A 4FKCA 3PKDA 4ZWPA 4A6VA 3PKEA 1KQ0A 5JFRA 2BHDA 2GG8A 1C21A 1C23A 3IG4A 1O0XA 1W7VA 1PV9A 2EVOA 3IU7A 2GTXA 5JI6A 3FM3A 1R5HA 4ZNGA 2OKNA 1MATA 4U75A 4FLLA 4U76A 1WL6A 3CB5A 3MR1A 4FO7A 3BITA 3IU9A 4RGZ1 4IF7A 4IPAA 3D27A 3FMRA 4IKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHM A;  4U6W A;  2BWY A;  5CNX A;  1C27 A;  1BN5 A;  2GG9 A;  4S2R P;  5CDE A;  4U6Z A;  3TB5 A;  2P99 A;  5CDV A;  2BHB A;  2GU6 A;  1XGS A;  4U70 A;  4FLJ A;  3PKB A;  2Q8K A;  2GGC A;  2Q96 A;  4IEC A;  3CB6 A;  2BHC A;  1XGN A;  2GU4 A;  2BWU A;  2G6P A;  1YVM A;  2BWS A;  3IU8 A;  1A16 A;  3ROR A;  2V3Y A;  1B59 A;  1XGO A;  2GG7 A;  2MAT A;  2Q95 A;  2B3L A;  3L24 A;  4JUQ A;  1YW8 A;  4U69 A;  4FUK A;  1XNZ A;  1WKM A;  2EA2 A;  5D6E A;  4ZWU A;  3MX6 A;  4Z7M A;  1YW7 A;  4B28 A;  4FLK A;  1XGM A;  2GG2 A;  4U73 A;  4A6W A;  4IKT A;  4OOK A;  1WLR A;  2GG3 A;  2EVC A;  1QZY A;  4U6J A;  1WN1 A;  2GU5 A;  1WBQ A;  2NQ6 A;  2GZ5 A;  1Y1N A;  2B3K A;  4S2T P;  3BIQ A;  5E5B A;  4MAT A;  2GA2 A;  2NQ7 A;  4HXX A;  4ZWO A;  1QXW A;  1M35 A;  3L7G A;  2Q93 A;  1YJ3 A;  4S01 A;  2V3Z A;  4PNC A;  4R60 A;  2BWW A;  5CDL A;  2P98 A;  3Q6D A;  2EVM A;  1W2M A;  4EGE A;  2BWX A;  2V3X A;  5CLS A;  5FCF A;  2BH3 A;  1KP0 A;  4U6E A;  1WL9 A;  3PKA A;  4RZY A;  2Q92 A;  1N51 A;  4U6C A;  2B3H A;  2BHA A;  2DFI A;  3CTZ A;  2BB7 A;  1WY2 A;  5JHU A;  5CIK A;  2GG5 A;  4IU6 A;  3FMQ A;  4U1B A;  2HOW A;  1BOA A;  1KQ9 A;  2OAZ A;  2BN7 A;  1R5G A;  4IKR A;  2ZSG A;  2V6C A;  4S00 A;  2BWT A;  2IW2 A;  4U71 A;  1C22 A;  4IDY A;  3TAV A;  2EA4 A;  2Q94 A;  4IKS A;  1QXY A;  1QXZ A;  1C24 A;  4QR8 A;  3S6B A;  1JAW A;  4FO8 A;  4RZZ A;  4FLI A;  3PKC A;  2BWV A;  4PV4 A;  2P9A A;  5D6F A;  1B6A A;  2GGB A;  1YW9 A;  5FCH A;  3RVA A;  2GU7 A;  3MAT A;  3BIP A;  4KM3 A;  5CE6 A;  2ADU A;  1R58 A;  2GG0 A;  4FKC A;  3PKD A;  4ZWP A;  4A6V A;  3PKE A;  1KQ0 A;  5JFR A;  2BHD A;  2GG8 A;  1C21 A;  1C23 A;  3IG4 A;  1O0X A;  1W7V A;  1PV9 A;  2EVO A;  3IU7 A;  2GTX A;  5JI6 A;  3FM3 A;  1R5H A;  4ZNG A;  2OKN A;  1MAT A;  4U75 A;  4FLL A;  4U76 A;  1WL6 A;  3CB5 A;  3MR1 A;  4FO7 A;  3BIT A;  3IU9 A;  4RGZ 1;  4IF7 A;  4IPA A;  3D27 A;  3FMR A;  4IKU A; 
#chains in the Genus database with same CATH topology
 1CHM A;  4U6W A;  2BWY A;  5CNX A;  1C27 A;  1BN5 A;  2GG9 A;  4S2R P;  5CDE A;  4U6Z A;  3TB5 A;  2P99 A;  5CDV A;  2BHB A;  2GU6 A;  1XGS A;  4U70 A;  4FLJ A;  3PKB A;  2Q8K A;  2GGC A;  2Q96 A;  4IEC A;  3CB6 A;  2BHC A;  1XGN A;  2GU4 A;  2BWU A;  2G6P A;  1YVM A;  2BWS A;  3IU8 A;  1A16 A;  3ROR A;  2V3Y A;  1B59 A;  1XGO A;  2GG7 A;  2MAT A;  2Q95 A;  2B3L A;  3L24 A;  4JUQ A;  1YW8 A;  4U69 A;  4FUK A;  1XNZ A;  1WKM A;  2EA2 A;  5D6E A;  4ZWU A;  3MX6 A;  4Z7M A;  1YW7 A;  4B28 A;  4FLK A;  1XGM A;  2GG2 A;  4U73 A;  4A6W A;  4IKT A;  4OOK A;  1WLR A;  2GG3 A;  2EVC A;  1QZY A;  4U6J A;  1WN1 A;  2GU5 A;  1WBQ A;  2NQ6 A;  2GZ5 A;  1Y1N A;  2B3K A;  4S2T P;  3BIQ A;  5E5B A;  4MAT A;  2GA2 A;  2NQ7 A;  4HXX A;  4ZWO A;  1QXW A;  1M35 A;  3L7G A;  2Q93 A;  1YJ3 A;  4S01 A;  2V3Z A;  4PNC A;  4R60 A;  2BWW A;  5CDL A;  2P98 A;  3Q6D A;  2EVM A;  1W2M A;  4EGE A;  2BWX A;  2V3X A;  5CLS A;  5FCF A;  2BH3 A;  1KP0 A;  4U6E A;  1WL9 A;  3PKA A;  4RZY A;  2Q92 A;  1N51 A;  4U6C A;  2B3H A;  2BHA A;  2DFI A;  3CTZ A;  2BB7 A;  1WY2 A;  5JHU A;  5CIK A;  2GG5 A;  4IU6 A;  3FMQ A;  4U1B A;  2HOW A;  1BOA A;  1KQ9 A;  2OAZ A;  2BN7 A;  1R5G A;  4IKR A;  2ZSG A;  2V6C A;  4S00 A;  2BWT A;  2IW2 A;  4U71 A;  1C22 A;  4IDY A;  3TAV A;  2EA4 A;  2Q94 A;  4IKS A;  1QXY A;  1QXZ A;  1C24 A;  4QR8 A;  3S6B A;  1JAW A;  4FO8 A;  4RZZ A;  4FLI A;  3PKC A;  2BWV A;  4PV4 A;  2P9A A;  5D6F A;  1B6A A;  2GGB A;  1YW9 A;  5FCH A;  3RVA A;  2GU7 A;  3MAT A;  3BIP A;  4KM3 A;  5CE6 A;  2ADU A;  1R58 A;  2GG0 A;  4FKC A;  3PKD A;  4ZWP A;  4A6V A;  3PKE A;  1KQ0 A;  5JFR A;  2BHD A;  2GG8 A;  1C21 A;  1C23 A;  3IG4 A;  1O0X A;  1W7V A;  1PV9 A;  2EVO A;  3IU7 A;  2GTX A;  5JI6 A;  3FM3 A;  1R5H A;  4ZNG A;  2OKN A;  1MAT A;  4U75 A;  4FLL A;  4U76 A;  1WL6 A;  3CB5 A;  3MR1 A;  4FO7 A;  3BIT A;  3IU9 A;  4RGZ 1;  4IF7 A;  4IPA A;  3D27 A;  3FMR A;  4IKU A; 
#chains in the Genus database with same CATH homology
 1CHM A;  4U6W A;  2BWY A;  5CNX A;  1C27 A;  1BN5 A;  2GG9 A;  4S2R P;  5CDE A;  4U6Z A;  3TB5 A;  2P99 A;  5CDV A;  2BHB A;  2GU6 A;  1XGS A;  4U70 A;  4FLJ A;  3PKB A;  2Q8K A;  2GGC A;  2Q96 A;  4IEC A;  3CB6 A;  2BHC A;  1XGN A;  2GU4 A;  2BWU A;  2G6P A;  1YVM A;  2BWS A;  3IU8 A;  1A16 A;  3ROR A;  2V3Y A;  1B59 A;  1XGO A;  2GG7 A;  2MAT A;  2Q95 A;  2B3L A;  3L24 A;  4JUQ A;  1YW8 A;  4U69 A;  4FUK A;  1XNZ A;  1WKM A;  2EA2 A;  5D6E A;  4ZWU A;  3MX6 A;  4Z7M A;  1YW7 A;  4B28 A;  4FLK A;  1XGM A;  2GG2 A;  4U73 A;  4A6W A;  4IKT A;  4OOK A;  1WLR A;  2GG3 A;  2EVC A;  1QZY A;  4U6J A;  1WN1 A;  2GU5 A;  1WBQ A;  2NQ6 A;  2GZ5 A;  1Y1N A;  2B3K A;  4S2T P;  3BIQ A;  5E5B A;  4MAT A;  2GA2 A;  2NQ7 A;  4HXX A;  4ZWO A;  1QXW A;  1M35 A;  3L7G A;  2Q93 A;  1YJ3 A;  4S01 A;  2V3Z A;  4PNC A;  4R60 A;  2BWW A;  5CDL A;  2P98 A;  3Q6D A;  2EVM A;  1W2M A;  4EGE A;  2BWX A;  2V3X A;  5CLS A;  5FCF A;  2BH3 A;  1KP0 A;  4U6E A;  1WL9 A;  3PKA A;  4RZY A;  2Q92 A;  1N51 A;  4U6C A;  2B3H A;  2BHA A;  2DFI A;  3CTZ A;  2BB7 A;  1WY2 A;  5JHU A;  5CIK A;  2GG5 A;  4IU6 A;  3FMQ A;  4U1B A;  2HOW A;  1BOA A;  1KQ9 A;  2OAZ A;  2BN7 A;  1R5G A;  4IKR A;  2ZSG A;  2V6C A;  4S00 A;  2BWT A;  2IW2 A;  4U71 A;  1C22 A;  4IDY A;  3TAV A;  2EA4 A;  2Q94 A;  4IKS A;  1QXY A;  1QXZ A;  1C24 A;  4QR8 A;  3S6B A;  1JAW A;  4FO8 A;  4RZZ A;  4FLI A;  3PKC A;  2BWV A;  4PV4 A;  2P9A A;  5D6F A;  1B6A A;  2GGB A;  1YW9 A;  5FCH A;  3RVA A;  2GU7 A;  3MAT A;  3BIP A;  4KM3 A;  5CE6 A;  2ADU A;  1R58 A;  2GG0 A;  4FKC A;  3PKD A;  4ZWP A;  4A6V A;  3PKE A;  1KQ0 A;  5JFR A;  2BHD A;  2GG8 A;  1C21 A;  1C23 A;  3IG4 A;  1O0X A;  1W7V A;  1PV9 A;  2EVO A;  3IU7 A;  2GTX A;  5JI6 A;  3FM3 A;  1R5H A;  4ZNG A;  2OKN A;  1MAT A;  4U75 A;  4FLL A;  4U76 A;  1WL6 A;  3CB5 A;  3MR1 A;  4FO7 A;  3BIT A;  3IU9 A;  4RGZ 1;  4IF7 A;  4IPA A;  3D27 A;  3FMR A;  4IKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...