4U6WA

Hsmetap (f220m) in complex with 1-amino-2-propylpentyl]phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6wA00
1XGNA 1R58A 2GU4A 3BIPA 4FKCA 2GG8A 2BWWA 4PNCA 3IG4A 1MATA 1WN1A 2GG3A 2V3YA 1WLRA 2MATA 2GU5A 4S01A 2NQ6A 1M35A 2GG7A 1PV9A 1XGSA 2EA4A 3D27A 5D6FA 3TAVA 4S2RP 4IKUA 4ZWPA 4U1BA 2BH3A 4ZNGA 4ZWOA 2BWSA 2BWTA 3PKCA 2P99A 3IU8A 4FLKA 4FUKA 1YW9A 1BN5A 2GGBA 4IKSA 5D6EA 1WKMA 1YW7A 4JUQA 1W7VA 4IU6A 2P9AA 1JAWA 2V3ZA 3BITA 4A6VA 2Q95A 4KM3A 2GG9A 1WL9A 4OOKA 2GG5A 3TB5A 4IF7A 2GGCA 1Y1NA 1B6AA 2GA2A 2B3KA 5CIKA 2GG0A 4FO8A 3CTZA 2BWXA 4S00A 4Z7MA 4U6JA 1C24A 3IU7A 4PV4A 4R60A 2Q92A 1A16A 3MX6A 3RVAA 2BB7A 4FLIA 2Q94A 2EVCA 1YVMA 4MATA 4U71A 5FCFA 5CDVA 2EVOA 4HXXA 2GZ5A 2EA2A 4IECA 5CNXA 2G6PA 3CB5A 1O0XA 1YW8A 5CE6A 2IW2A 3BIQA 2BWYA 2BHDA 5JHUA 3FMQA 3PKAA 1CHMA 3PKDA 4FLJA 2BWUA 1KP0A 4U76A 2BHCA 1W2MA 4ZWUA 5CDEA 3MR1A 1R5HA 4FLLA 4RZYA 4U6ZA 4QR8A 1C27A 2Q96A 3PKEA 2EVMA 4U70A 2GTXA 1XGOA 1QXWA 1WBQA 3S6BA 2V6CA 2DFIA 1C21A 4IPAA 2OKNA 4S2TP 2V3XA 4RGZ1 1YJ3A 4FO7A 4A6WA 1KQ9A 4U6EA 1QXYA 1WY2A 2BHBA 1XGMA 1XNZA 1WL6A 2B3HA 3CB6A 2P98A 1R5GA 5JI6A 4U73A 1C23A 4EGEA 5CLSA 4RZZA 2NQ7A 3IU9A 5CDLA 4IDYA 2ZSGA 5FCHA 2GU7A 4U6CA 3L24A 4U6WA 2B3LA 1KQ0A 2Q8KA 1N51A 2BHAA 2GU6A 2GG2A 3FMRA 1BOAA 4U75A 5JFRA 4IKRA 3L7GA 1QXZA 3RORA 3PKBA 1B59A 3Q6DA 2ADUA 1C22A 4B28A 5E5BA 1QZYA 2OAZA 2BN7A 2BWVA 3MATA 3FM3A 4IKTA 4U69A 2Q93A 2HOWA
chains in the Genus database with same CATH superfamily
1XGNA 1R58A 2GU4A 3BIPA 4FKCA 2GG8A 2BWWA 4PNCA 3IG4A 1MATA 1WN1A 2GG3A 2V3YA 1WLRA 2MATA 2GU5A 4S01A 2NQ6A 1M35A 2GG7A 1PV9A 1XGSA 2EA4A 3D27A 5D6FA 3TAVA 4S2RP 4IKUA 4ZWPA 4U1BA 2BH3A 4ZNGA 4ZWOA 2BWSA 2BWTA 3PKCA 2P99A 3IU8A 4FLKA 4FUKA 1YW9A 1BN5A 2GGBA 4IKSA 5D6EA 1WKMA 1YW7A 4JUQA 1W7VA 4IU6A 2P9AA 1JAWA 2V3ZA 3BITA 4A6VA 2Q95A 4KM3A 2GG9A 1WL9A 4OOKA 2GG5A 3TB5A 4IF7A 2GGCA 1Y1NA 1B6AA 2GA2A 2B3KA 5CIKA 2GG0A 4FO8A 3CTZA 2BWXA 4S00A 4Z7MA 4U6JA 1C24A 3IU7A 4PV4A 4R60A 2Q92A 1A16A 3MX6A 3RVAA 2BB7A 4FLIA 2Q94A 2EVCA 1YVMA 4MATA 4U71A 5FCFA 5CDVA 2EVOA 4HXXA 2GZ5A 2EA2A 4IECA 5CNXA 2G6PA 3CB5A 1O0XA 1YW8A 5CE6A 2IW2A 3BIQA 2BWYA 2BHDA 5JHUA 3FMQA 3PKAA 1CHMA 3PKDA 4FLJA 2BWUA 1KP0A 4U76A 2BHCA 1W2MA 4ZWUA 5CDEA 3MR1A 1R5HA 4FLLA 4RZYA 4U6ZA 4QR8A 1C27A 2Q96A 3PKEA 2EVMA 4U70A 2GTXA 1XGOA 1QXWA 1WBQA 3S6BA 2V6CA 2DFIA 1C21A 4IPAA 2OKNA 4S2TP 2V3XA 4RGZ1 1YJ3A 4FO7A 4A6WA 1KQ9A 4U6EA 1QXYA 1WY2A 2BHBA 1XGMA 1XNZA 1WL6A 2B3HA 3CB6A 2P98A 1R5GA 5JI6A 4U73A 1C23A 4EGEA 5CLSA 4RZZA 2NQ7A 3IU9A 5CDLA 4IDYA 2ZSGA 5FCHA 2GU7A 4U6CA 3L24A 4U6WA 2B3LA 1KQ0A 2Q8KA 1N51A 2BHAA 2GU6A 2GG2A 3FMRA 1BOAA 4U75A 5JFRA 4IKRA 3L7GA 1QXZA 3RORA 3PKBA 1B59A 3Q6DA 2ADUA 1C22A 4B28A 5E5BA 1QZYA 2OAZA 2BN7A 2BWVA 3MATA 3FM3A 4IKTA 4U69A 2Q93A 2HOWA
chains in the Genus database with same CATH topology
1XGNA 1R58A 2GU4A 3BIPA 4FKCA 2GG8A 2BWWA 4PNCA 3IG4A 1MATA 1WN1A 2GG3A 2V3YA 1WLRA 2MATA 2GU5A 4S01A 2NQ6A 1M35A 2GG7A 1PV9A 1XGSA 2EA4A 3D27A 5D6FA 3TAVA 4S2RP 4IKUA 4ZWPA 4U1BA 2BH3A 4ZNGA 4ZWOA 2BWSA 2BWTA 3PKCA 2P99A 3IU8A 4FLKA 4FUKA 1YW9A 1BN5A 2GGBA 4IKSA 5D6EA 1WKMA 1YW7A 4JUQA 1W7VA 4IU6A 2P9AA 1JAWA 2V3ZA 3BITA 4A6VA 2Q95A 4KM3A 2GG9A 1WL9A 4OOKA 2GG5A 3TB5A 4IF7A 2GGCA 1Y1NA 1B6AA 2GA2A 2B3KA 5CIKA 2GG0A 4FO8A 3CTZA 2BWXA 4S00A 4Z7MA 4U6JA 1C24A 3IU7A 4PV4A 4R60A 2Q92A 1A16A 3MX6A 3RVAA 2BB7A 4FLIA 2Q94A 2EVCA 1YVMA 4MATA 4U71A 5FCFA 5CDVA 2EVOA 4HXXA 2GZ5A 2EA2A 4IECA 5CNXA 2G6PA 3CB5A 1O0XA 1YW8A 5CE6A 2IW2A 3BIQA 2BWYA 2BHDA 5JHUA 3FMQA 3PKAA 1CHMA 3PKDA 4FLJA 2BWUA 1KP0A 4U76A 2BHCA 1W2MA 4ZWUA 5CDEA 3MR1A 1R5HA 4FLLA 4RZYA 4U6ZA 4QR8A 1C27A 2Q96A 3PKEA 2EVMA 4U70A 2GTXA 1XGOA 1QXWA 1WBQA 3S6BA 2V6CA 2DFIA 1C21A 4IPAA 2OKNA 4S2TP 2V3XA 4RGZ1 1YJ3A 4FO7A 4A6WA 1KQ9A 4U6EA 1QXYA 1WY2A 2BHBA 1XGMA 1XNZA 1WL6A 2B3HA 3CB6A 2P98A 1R5GA 5JI6A 4U73A 1C23A 4EGEA 5CLSA 4RZZA 2NQ7A 3IU9A 5CDLA 4IDYA 2ZSGA 5FCHA 2GU7A 4U6CA 3L24A 4U6WA 2B3LA 1KQ0A 2Q8KA 1N51A 2BHAA 2GU6A 2GG2A 3FMRA 1BOAA 4U75A 5JFRA 4IKRA 3L7GA 1QXZA 3RORA 3PKBA 1B59A 3Q6DA 2ADUA 1C22A 4B28A 5E5BA 1QZYA 2OAZA 2BN7A 2BWVA 3MATA 3FM3A 4IKTA 4U69A 2Q93A 2HOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGN A;  1R58 A;  2GU4 A;  3BIP A;  4FKC A;  2GG8 A;  2BWW A;  4PNC A;  3IG4 A;  1MAT A;  1WN1 A;  2GG3 A;  2V3Y A;  1WLR A;  2MAT A;  2GU5 A;  4S01 A;  2NQ6 A;  1M35 A;  2GG7 A;  1PV9 A;  1XGS A;  2EA4 A;  3D27 A;  5D6F A;  3TAV A;  4S2R P;  4IKU A;  4ZWP A;  4U1B A;  2BH3 A;  4ZNG A;  4ZWO A;  2BWS A;  2BWT A;  3PKC A;  2P99 A;  3IU8 A;  4FLK A;  4FUK A;  1YW9 A;  1BN5 A;  2GGB A;  4IKS A;  5D6E A;  1WKM A;  1YW7 A;  4JUQ A;  1W7V A;  4IU6 A;  2P9A A;  1JAW A;  2V3Z A;  3BIT A;  4A6V A;  2Q95 A;  4KM3 A;  2GG9 A;  1WL9 A;  4OOK A;  2GG5 A;  3TB5 A;  4IF7 A;  2GGC A;  1Y1N A;  1B6A A;  2GA2 A;  2B3K A;  5CIK A;  2GG0 A;  4FO8 A;  3CTZ A;  2BWX A;  4S00 A;  4Z7M A;  4U6J A;  1C24 A;  3IU7 A;  4PV4 A;  4R60 A;  2Q92 A;  1A16 A;  3MX6 A;  3RVA A;  2BB7 A;  4FLI A;  2Q94 A;  2EVC A;  1YVM A;  4MAT A;  4U71 A;  5FCF A;  5CDV A;  2EVO A;  4HXX A;  2GZ5 A;  2EA2 A;  4IEC A;  5CNX A;  2G6P A;  3CB5 A;  1O0X A;  1YW8 A;  5CE6 A;  2IW2 A;  3BIQ A;  2BWY A;  2BHD A;  5JHU A;  3FMQ A;  3PKA A;  1CHM A;  3PKD A;  4FLJ A;  2BWU A;  1KP0 A;  4U76 A;  2BHC A;  1W2M A;  4ZWU A;  5CDE A;  3MR1 A;  1R5H A;  4FLL A;  4RZY A;  4U6Z A;  4QR8 A;  1C27 A;  2Q96 A;  3PKE A;  2EVM A;  4U70 A;  2GTX A;  1XGO A;  1QXW A;  1WBQ A;  3S6B A;  2V6C A;  2DFI A;  1C21 A;  4IPA A;  2OKN A;  4S2T P;  2V3X A;  4RGZ 1;  1YJ3 A;  4FO7 A;  4A6W A;  1KQ9 A;  4U6E A;  1QXY A;  1WY2 A;  2BHB A;  1XGM A;  1XNZ A;  1WL6 A;  2B3H A;  3CB6 A;  2P98 A;  1R5G A;  5JI6 A;  4U73 A;  1C23 A;  4EGE A;  5CLS A;  4RZZ A;  2NQ7 A;  3IU9 A;  5CDL A;  4IDY A;  2ZSG A;  5FCH A;  2GU7 A;  4U6C A;  3L24 A;  4U6W A;  2B3L A;  1KQ0 A;  2Q8K A;  1N51 A;  2BHA A;  2GU6 A;  2GG2 A;  3FMR A;  1BOA A;  4U75 A;  5JFR A;  4IKR A;  3L7G A;  1QXZ A;  3ROR A;  3PKB A;  1B59 A;  3Q6D A;  2ADU A;  1C22 A;  4B28 A;  5E5B A;  1QZY A;  2OAZ A;  2BN7 A;  2BWV A;  3MAT A;  3FM3 A;  4IKT A;  4U69 A;  2Q93 A;  2HOW A; 
#chains in the Genus database with same CATH topology
 1XGN A;  1R58 A;  2GU4 A;  3BIP A;  4FKC A;  2GG8 A;  2BWW A;  4PNC A;  3IG4 A;  1MAT A;  1WN1 A;  2GG3 A;  2V3Y A;  1WLR A;  2MAT A;  2GU5 A;  4S01 A;  2NQ6 A;  1M35 A;  2GG7 A;  1PV9 A;  1XGS A;  2EA4 A;  3D27 A;  5D6F A;  3TAV A;  4S2R P;  4IKU A;  4ZWP A;  4U1B A;  2BH3 A;  4ZNG A;  4ZWO A;  2BWS A;  2BWT A;  3PKC A;  2P99 A;  3IU8 A;  4FLK A;  4FUK A;  1YW9 A;  1BN5 A;  2GGB A;  4IKS A;  5D6E A;  1WKM A;  1YW7 A;  4JUQ A;  1W7V A;  4IU6 A;  2P9A A;  1JAW A;  2V3Z A;  3BIT A;  4A6V A;  2Q95 A;  4KM3 A;  2GG9 A;  1WL9 A;  4OOK A;  2GG5 A;  3TB5 A;  4IF7 A;  2GGC A;  1Y1N A;  1B6A A;  2GA2 A;  2B3K A;  5CIK A;  2GG0 A;  4FO8 A;  3CTZ A;  2BWX A;  4S00 A;  4Z7M A;  4U6J A;  1C24 A;  3IU7 A;  4PV4 A;  4R60 A;  2Q92 A;  1A16 A;  3MX6 A;  3RVA A;  2BB7 A;  4FLI A;  2Q94 A;  2EVC A;  1YVM A;  4MAT A;  4U71 A;  5FCF A;  5CDV A;  2EVO A;  4HXX A;  2GZ5 A;  2EA2 A;  4IEC A;  5CNX A;  2G6P A;  3CB5 A;  1O0X A;  1YW8 A;  5CE6 A;  2IW2 A;  3BIQ A;  2BWY A;  2BHD A;  5JHU A;  3FMQ A;  3PKA A;  1CHM A;  3PKD A;  4FLJ A;  2BWU A;  1KP0 A;  4U76 A;  2BHC A;  1W2M A;  4ZWU A;  5CDE A;  3MR1 A;  1R5H A;  4FLL A;  4RZY A;  4U6Z A;  4QR8 A;  1C27 A;  2Q96 A;  3PKE A;  2EVM A;  4U70 A;  2GTX A;  1XGO A;  1QXW A;  1WBQ A;  3S6B A;  2V6C A;  2DFI A;  1C21 A;  4IPA A;  2OKN A;  4S2T P;  2V3X A;  4RGZ 1;  1YJ3 A;  4FO7 A;  4A6W A;  1KQ9 A;  4U6E A;  1QXY A;  1WY2 A;  2BHB A;  1XGM A;  1XNZ A;  1WL6 A;  2B3H A;  3CB6 A;  2P98 A;  1R5G A;  5JI6 A;  4U73 A;  1C23 A;  4EGE A;  5CLS A;  4RZZ A;  2NQ7 A;  3IU9 A;  5CDL A;  4IDY A;  2ZSG A;  5FCH A;  2GU7 A;  4U6C A;  3L24 A;  4U6W A;  2B3L A;  1KQ0 A;  2Q8K A;  1N51 A;  2BHA A;  2GU6 A;  2GG2 A;  3FMR A;  1BOA A;  4U75 A;  5JFR A;  4IKR A;  3L7G A;  1QXZ A;  3ROR A;  3PKB A;  1B59 A;  3Q6D A;  2ADU A;  1C22 A;  4B28 A;  5E5B A;  1QZY A;  2OAZ A;  2BN7 A;  2BWV A;  3MAT A;  3FM3 A;  4IKT A;  4U69 A;  2Q93 A;  2HOW A; 
#chains in the Genus database with same CATH homology
 1XGN A;  1R58 A;  2GU4 A;  3BIP A;  4FKC A;  2GG8 A;  2BWW A;  4PNC A;  3IG4 A;  1MAT A;  1WN1 A;  2GG3 A;  2V3Y A;  1WLR A;  2MAT A;  2GU5 A;  4S01 A;  2NQ6 A;  1M35 A;  2GG7 A;  1PV9 A;  1XGS A;  2EA4 A;  3D27 A;  5D6F A;  3TAV A;  4S2R P;  4IKU A;  4ZWP A;  4U1B A;  2BH3 A;  4ZNG A;  4ZWO A;  2BWS A;  2BWT A;  3PKC A;  2P99 A;  3IU8 A;  4FLK A;  4FUK A;  1YW9 A;  1BN5 A;  2GGB A;  4IKS A;  5D6E A;  1WKM A;  1YW7 A;  4JUQ A;  1W7V A;  4IU6 A;  2P9A A;  1JAW A;  2V3Z A;  3BIT A;  4A6V A;  2Q95 A;  4KM3 A;  2GG9 A;  1WL9 A;  4OOK A;  2GG5 A;  3TB5 A;  4IF7 A;  2GGC A;  1Y1N A;  1B6A A;  2GA2 A;  2B3K A;  5CIK A;  2GG0 A;  4FO8 A;  3CTZ A;  2BWX A;  4S00 A;  4Z7M A;  4U6J A;  1C24 A;  3IU7 A;  4PV4 A;  4R60 A;  2Q92 A;  1A16 A;  3MX6 A;  3RVA A;  2BB7 A;  4FLI A;  2Q94 A;  2EVC A;  1YVM A;  4MAT A;  4U71 A;  5FCF A;  5CDV A;  2EVO A;  4HXX A;  2GZ5 A;  2EA2 A;  4IEC A;  5CNX A;  2G6P A;  3CB5 A;  1O0X A;  1YW8 A;  5CE6 A;  2IW2 A;  3BIQ A;  2BWY A;  2BHD A;  5JHU A;  3FMQ A;  3PKA A;  1CHM A;  3PKD A;  4FLJ A;  2BWU A;  1KP0 A;  4U76 A;  2BHC A;  1W2M A;  4ZWU A;  5CDE A;  3MR1 A;  1R5H A;  4FLL A;  4RZY A;  4U6Z A;  4QR8 A;  1C27 A;  2Q96 A;  3PKE A;  2EVM A;  4U70 A;  2GTX A;  1XGO A;  1QXW A;  1WBQ A;  3S6B A;  2V6C A;  2DFI A;  1C21 A;  4IPA A;  2OKN A;  4S2T P;  2V3X A;  4RGZ 1;  1YJ3 A;  4FO7 A;  4A6W A;  1KQ9 A;  4U6E A;  1QXY A;  1WY2 A;  2BHB A;  1XGM A;  1XNZ A;  1WL6 A;  2B3H A;  3CB6 A;  2P98 A;  1R5G A;  5JI6 A;  4U73 A;  1C23 A;  4EGE A;  5CLS A;  4RZZ A;  2NQ7 A;  3IU9 A;  5CDL A;  4IDY A;  2ZSG A;  5FCH A;  2GU7 A;  4U6C A;  3L24 A;  4U6W A;  2B3L A;  1KQ0 A;  2Q8K A;  1N51 A;  2BHA A;  2GU6 A;  2GG2 A;  3FMR A;  1BOA A;  4U75 A;  5JFR A;  4IKR A;  3L7G A;  1QXZ A;  3ROR A;  3PKB A;  1B59 A;  3Q6D A;  2ADU A;  1C22 A;  4B28 A;  5E5B A;  1QZY A;  2OAZ A;  2BN7 A;  2BWV A;  3MAT A;  3FM3 A;  4IKT A;  4U69 A;  2Q93 A;  2HOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...