4U6WA

Hsmetap (f220m) in complex with 1-amino-2-propylpentyl]phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6wA00
4U6JA 1WY2A 1C21A 2P99A 2P98A 2P9AA 2V3XA 4U71A 5CDEA 3TB5A 2BWWA 4R60A 4S00A 1YW7A 5JHUA 2OKNA 2EA2A 4FO7A 4U76A 1WKMA 4IU6A 1O0XA 2GA2A 1WL9A 2NQ6A 1M35A 2EVOA 3PKEA 4QR8A 3CB5A 3CTZA 4S2RP 2BWXA 4U6ZA 4RGZ1 1BOAA 2BB7A 5FCFA 4EGEA 4Z7MA 1YW9A 5CE6A 1BN5A 3IU9A 3S6BA 4FLLA 1QZYA 1PV9A 4IPAA 1QXZA 1QXYA 3FMRA 2BWVA 4U75A 1C24A 4U1BA 4PV4A 1JAWA 1YW8A 2GG2A 4A6WA 2V3ZA 1XGSA 2GU5A 4RZZA 2EVMA 3RORA 4A6VA 2BWTA 3FMQA 2V3YA 2EA4A 4OOKA 4IDYA 2GG8A 1R5HA 1XNZA 2GG3A 1C27A 2BWYA 3IG4A 2Q8KA 5CDVA 1KQ9A 4RZYA 5E5BA 2GG0A 2B3HA 1W2MA 1XGMA 2IW2A 1XGNA 2BHBA 3BIPA 3FM3A 3PKBA 4MATA 1R5GA 4FUKA 4U6CA 2BHCA 2ADUA 5CIKA 3PKCA 4U6EA 2GZ5A 1A16A 5JI6A 1W7VA 1XGOA 1WLRA 2BH3A 1YVMA 3MR1A 2BWUA 4FLKA 4IKSA 1YJ3A 2OAZA 3MATA 3IU7A 4ZWPA 1R58A 4PNCA 4B28A 2GG5A 1B6AA 5FCHA 2HOWA 2GG9A 3CB6A 1QXWA 2GGBA 4U70A 2NQ7A 3BIQA 4ZWUA 2EVCA 2BHAA 3L24A 5D6FA 2GU6A 4U69A 2DFIA 2BWSA 2G6PA 4ZWOA 1B59A 4U73A 3IU8A 3TAVA 4KM3A 4FKCA 5CLSA 4S01A 4JUQA 2V6CA 2GU7A 2Q93A 2Q96A 4FLIA 3D27A 4IKTA 5CDLA 1KQ0A 2BHDA 2GU4A 3BITA 4FO8A 5CNXA 4U6WA 1C22A 1N51A 2B3KA 2GGCA 2MATA 1CHMA 3PKDA 1C23A 1MATA 2BN7A 4IECA 4FLJA 4IKRA 1KP0A 4IKUA 1Y1NA 2ZSGA 1WN1A 3L7GA 2Q95A 1WBQA 1WL6A 3Q6DA 2B3LA 3PKAA 4HXXA 2GTXA 3RVAA 2Q94A 4S2TP 2Q92A 4IF7A 4ZNGA 2GG7A 5JFRA 5D6EA 3MX6A
chains in the Genus database with same CATH superfamily
4U6JA 1WY2A 1C21A 2P99A 2P98A 2P9AA 2V3XA 4U71A 5CDEA 3TB5A 2BWWA 4R60A 4S00A 1YW7A 5JHUA 2OKNA 2EA2A 4FO7A 4U76A 1WKMA 4IU6A 1O0XA 2GA2A 1WL9A 2NQ6A 1M35A 2EVOA 3PKEA 4QR8A 3CB5A 3CTZA 4S2RP 2BWXA 4U6ZA 4RGZ1 1BOAA 2BB7A 5FCFA 4EGEA 4Z7MA 1YW9A 5CE6A 1BN5A 3IU9A 3S6BA 4FLLA 1QZYA 1PV9A 4IPAA 1QXZA 1QXYA 3FMRA 2BWVA 4U75A 1C24A 4U1BA 4PV4A 1JAWA 1YW8A 2GG2A 4A6WA 2V3ZA 1XGSA 2GU5A 4RZZA 2EVMA 3RORA 4A6VA 2BWTA 3FMQA 2V3YA 2EA4A 4OOKA 4IDYA 2GG8A 1R5HA 1XNZA 2GG3A 1C27A 2BWYA 3IG4A 2Q8KA 5CDVA 1KQ9A 4RZYA 5E5BA 2GG0A 2B3HA 1W2MA 1XGMA 2IW2A 1XGNA 2BHBA 3BIPA 3FM3A 3PKBA 4MATA 1R5GA 4FUKA 4U6CA 2BHCA 2ADUA 5CIKA 3PKCA 4U6EA 2GZ5A 1A16A 5JI6A 1W7VA 1XGOA 1WLRA 2BH3A 1YVMA 3MR1A 2BWUA 4FLKA 4IKSA 1YJ3A 2OAZA 3MATA 3IU7A 4ZWPA 1R58A 4PNCA 4B28A 2GG5A 1B6AA 5FCHA 2HOWA 2GG9A 3CB6A 1QXWA 2GGBA 4U70A 2NQ7A 3BIQA 4ZWUA 2EVCA 2BHAA 3L24A 5D6FA 2GU6A 4U69A 2DFIA 2BWSA 2G6PA 4ZWOA 1B59A 4U73A 3IU8A 3TAVA 4KM3A 4FKCA 5CLSA 4S01A 4JUQA 2V6CA 2GU7A 2Q93A 2Q96A 4FLIA 3D27A 4IKTA 5CDLA 1KQ0A 2BHDA 2GU4A 3BITA 4FO8A 5CNXA 4U6WA 1C22A 1N51A 2B3KA 2GGCA 2MATA 1CHMA 3PKDA 1C23A 1MATA 2BN7A 4IECA 4FLJA 4IKRA 1KP0A 4IKUA 1Y1NA 2ZSGA 1WN1A 3L7GA 2Q95A 1WBQA 1WL6A 3Q6DA 2B3LA 3PKAA 4HXXA 2GTXA 3RVAA 2Q94A 4S2TP 2Q92A 4IF7A 4ZNGA 2GG7A 5JFRA 5D6EA 3MX6A
chains in the Genus database with same CATH topology
4U6JA 1WY2A 1C21A 2P99A 2P98A 2P9AA 2V3XA 4U71A 5CDEA 3TB5A 2BWWA 4R60A 4S00A 1YW7A 5JHUA 2OKNA 2EA2A 4FO7A 4U76A 1WKMA 4IU6A 1O0XA 2GA2A 1WL9A 2NQ6A 1M35A 2EVOA 3PKEA 4QR8A 3CB5A 3CTZA 4S2RP 2BWXA 4U6ZA 4RGZ1 1BOAA 2BB7A 5FCFA 4EGEA 4Z7MA 1YW9A 5CE6A 1BN5A 3IU9A 3S6BA 4FLLA 1QZYA 1PV9A 4IPAA 1QXZA 1QXYA 3FMRA 2BWVA 4U75A 1C24A 4U1BA 4PV4A 1JAWA 1YW8A 2GG2A 4A6WA 2V3ZA 1XGSA 2GU5A 4RZZA 2EVMA 3RORA 4A6VA 2BWTA 3FMQA 2V3YA 2EA4A 4OOKA 4IDYA 2GG8A 1R5HA 1XNZA 2GG3A 1C27A 2BWYA 3IG4A 2Q8KA 5CDVA 1KQ9A 4RZYA 5E5BA 2GG0A 2B3HA 1W2MA 1XGMA 2IW2A 1XGNA 2BHBA 3BIPA 3FM3A 3PKBA 4MATA 1R5GA 4FUKA 4U6CA 2BHCA 2ADUA 5CIKA 3PKCA 4U6EA 2GZ5A 1A16A 5JI6A 1W7VA 1XGOA 1WLRA 2BH3A 1YVMA 3MR1A 2BWUA 4FLKA 4IKSA 1YJ3A 2OAZA 3MATA 3IU7A 4ZWPA 1R58A 4PNCA 4B28A 2GG5A 1B6AA 5FCHA 2HOWA 2GG9A 3CB6A 1QXWA 2GGBA 4U70A 2NQ7A 3BIQA 4ZWUA 2EVCA 2BHAA 3L24A 5D6FA 2GU6A 4U69A 2DFIA 2BWSA 2G6PA 4ZWOA 1B59A 4U73A 3IU8A 3TAVA 4KM3A 4FKCA 5CLSA 4S01A 4JUQA 2V6CA 2GU7A 2Q93A 2Q96A 4FLIA 3D27A 4IKTA 5CDLA 1KQ0A 2BHDA 2GU4A 3BITA 4FO8A 5CNXA 4U6WA 1C22A 1N51A 2B3KA 2GGCA 2MATA 1CHMA 3PKDA 1C23A 1MATA 2BN7A 4IECA 4FLJA 4IKRA 1KP0A 4IKUA 1Y1NA 2ZSGA 1WN1A 3L7GA 2Q95A 1WBQA 1WL6A 3Q6DA 2B3LA 3PKAA 4HXXA 2GTXA 3RVAA 2Q94A 4S2TP 2Q92A 4IF7A 4ZNGA 2GG7A 5JFRA 5D6EA 3MX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6J A;  1WY2 A;  1C21 A;  2P99 A;  2P98 A;  2P9A A;  2V3X A;  4U71 A;  5CDE A;  3TB5 A;  2BWW A;  4R60 A;  4S00 A;  1YW7 A;  5JHU A;  2OKN A;  2EA2 A;  4FO7 A;  4U76 A;  1WKM A;  4IU6 A;  1O0X A;  2GA2 A;  1WL9 A;  2NQ6 A;  1M35 A;  2EVO A;  3PKE A;  4QR8 A;  3CB5 A;  3CTZ A;  4S2R P;  2BWX A;  4U6Z A;  4RGZ 1;  1BOA A;  2BB7 A;  5FCF A;  4EGE A;  4Z7M A;  1YW9 A;  5CE6 A;  1BN5 A;  3IU9 A;  3S6B A;  4FLL A;  1QZY A;  1PV9 A;  4IPA A;  1QXZ A;  1QXY A;  3FMR A;  2BWV A;  4U75 A;  1C24 A;  4U1B A;  4PV4 A;  1JAW A;  1YW8 A;  2GG2 A;  4A6W A;  2V3Z A;  1XGS A;  2GU5 A;  4RZZ A;  2EVM A;  3ROR A;  4A6V A;  2BWT A;  3FMQ A;  2V3Y A;  2EA4 A;  4OOK A;  4IDY A;  2GG8 A;  1R5H A;  1XNZ A;  2GG3 A;  1C27 A;  2BWY A;  3IG4 A;  2Q8K A;  5CDV A;  1KQ9 A;  4RZY A;  5E5B A;  2GG0 A;  2B3H A;  1W2M A;  1XGM A;  2IW2 A;  1XGN A;  2BHB A;  3BIP A;  3FM3 A;  3PKB A;  4MAT A;  1R5G A;  4FUK A;  4U6C A;  2BHC A;  2ADU A;  5CIK A;  3PKC A;  4U6E A;  2GZ5 A;  1A16 A;  5JI6 A;  1W7V A;  1XGO A;  1WLR A;  2BH3 A;  1YVM A;  3MR1 A;  2BWU A;  4FLK A;  4IKS A;  1YJ3 A;  2OAZ A;  3MAT A;  3IU7 A;  4ZWP A;  1R58 A;  4PNC A;  4B28 A;  2GG5 A;  1B6A A;  5FCH A;  2HOW A;  2GG9 A;  3CB6 A;  1QXW A;  2GGB A;  4U70 A;  2NQ7 A;  3BIQ A;  4ZWU A;  2EVC A;  2BHA A;  3L24 A;  5D6F A;  2GU6 A;  4U69 A;  2DFI A;  2BWS A;  2G6P A;  4ZWO A;  1B59 A;  4U73 A;  3IU8 A;  3TAV A;  4KM3 A;  4FKC A;  5CLS A;  4S01 A;  4JUQ A;  2V6C A;  2GU7 A;  2Q93 A;  2Q96 A;  4FLI A;  3D27 A;  4IKT A;  5CDL A;  1KQ0 A;  2BHD A;  2GU4 A;  3BIT A;  4FO8 A;  5CNX A;  4U6W A;  1C22 A;  1N51 A;  2B3K A;  2GGC A;  2MAT A;  1CHM A;  3PKD A;  1C23 A;  1MAT A;  2BN7 A;  4IEC A;  4FLJ A;  4IKR A;  1KP0 A;  4IKU A;  1Y1N A;  2ZSG A;  1WN1 A;  3L7G A;  2Q95 A;  1WBQ A;  1WL6 A;  3Q6D A;  2B3L A;  3PKA A;  4HXX A;  2GTX A;  3RVA A;  2Q94 A;  4S2T P;  2Q92 A;  4IF7 A;  4ZNG A;  2GG7 A;  5JFR A;  5D6E A;  3MX6 A; 
#chains in the Genus database with same CATH topology
 4U6J A;  1WY2 A;  1C21 A;  2P99 A;  2P98 A;  2P9A A;  2V3X A;  4U71 A;  5CDE A;  3TB5 A;  2BWW A;  4R60 A;  4S00 A;  1YW7 A;  5JHU A;  2OKN A;  2EA2 A;  4FO7 A;  4U76 A;  1WKM A;  4IU6 A;  1O0X A;  2GA2 A;  1WL9 A;  2NQ6 A;  1M35 A;  2EVO A;  3PKE A;  4QR8 A;  3CB5 A;  3CTZ A;  4S2R P;  2BWX A;  4U6Z A;  4RGZ 1;  1BOA A;  2BB7 A;  5FCF A;  4EGE A;  4Z7M A;  1YW9 A;  5CE6 A;  1BN5 A;  3IU9 A;  3S6B A;  4FLL A;  1QZY A;  1PV9 A;  4IPA A;  1QXZ A;  1QXY A;  3FMR A;  2BWV A;  4U75 A;  1C24 A;  4U1B A;  4PV4 A;  1JAW A;  1YW8 A;  2GG2 A;  4A6W A;  2V3Z A;  1XGS A;  2GU5 A;  4RZZ A;  2EVM A;  3ROR A;  4A6V A;  2BWT A;  3FMQ A;  2V3Y A;  2EA4 A;  4OOK A;  4IDY A;  2GG8 A;  1R5H A;  1XNZ A;  2GG3 A;  1C27 A;  2BWY A;  3IG4 A;  2Q8K A;  5CDV A;  1KQ9 A;  4RZY A;  5E5B A;  2GG0 A;  2B3H A;  1W2M A;  1XGM A;  2IW2 A;  1XGN A;  2BHB A;  3BIP A;  3FM3 A;  3PKB A;  4MAT A;  1R5G A;  4FUK A;  4U6C A;  2BHC A;  2ADU A;  5CIK A;  3PKC A;  4U6E A;  2GZ5 A;  1A16 A;  5JI6 A;  1W7V A;  1XGO A;  1WLR A;  2BH3 A;  1YVM A;  3MR1 A;  2BWU A;  4FLK A;  4IKS A;  1YJ3 A;  2OAZ A;  3MAT A;  3IU7 A;  4ZWP A;  1R58 A;  4PNC A;  4B28 A;  2GG5 A;  1B6A A;  5FCH A;  2HOW A;  2GG9 A;  3CB6 A;  1QXW A;  2GGB A;  4U70 A;  2NQ7 A;  3BIQ A;  4ZWU A;  2EVC A;  2BHA A;  3L24 A;  5D6F A;  2GU6 A;  4U69 A;  2DFI A;  2BWS A;  2G6P A;  4ZWO A;  1B59 A;  4U73 A;  3IU8 A;  3TAV A;  4KM3 A;  4FKC A;  5CLS A;  4S01 A;  4JUQ A;  2V6C A;  2GU7 A;  2Q93 A;  2Q96 A;  4FLI A;  3D27 A;  4IKT A;  5CDL A;  1KQ0 A;  2BHD A;  2GU4 A;  3BIT A;  4FO8 A;  5CNX A;  4U6W A;  1C22 A;  1N51 A;  2B3K A;  2GGC A;  2MAT A;  1CHM A;  3PKD A;  1C23 A;  1MAT A;  2BN7 A;  4IEC A;  4FLJ A;  4IKR A;  1KP0 A;  4IKU A;  1Y1N A;  2ZSG A;  1WN1 A;  3L7G A;  2Q95 A;  1WBQ A;  1WL6 A;  3Q6D A;  2B3L A;  3PKA A;  4HXX A;  2GTX A;  3RVA A;  2Q94 A;  4S2T P;  2Q92 A;  4IF7 A;  4ZNG A;  2GG7 A;  5JFR A;  5D6E A;  3MX6 A; 
#chains in the Genus database with same CATH homology
 4U6J A;  1WY2 A;  1C21 A;  2P99 A;  2P98 A;  2P9A A;  2V3X A;  4U71 A;  5CDE A;  3TB5 A;  2BWW A;  4R60 A;  4S00 A;  1YW7 A;  5JHU A;  2OKN A;  2EA2 A;  4FO7 A;  4U76 A;  1WKM A;  4IU6 A;  1O0X A;  2GA2 A;  1WL9 A;  2NQ6 A;  1M35 A;  2EVO A;  3PKE A;  4QR8 A;  3CB5 A;  3CTZ A;  4S2R P;  2BWX A;  4U6Z A;  4RGZ 1;  1BOA A;  2BB7 A;  5FCF A;  4EGE A;  4Z7M A;  1YW9 A;  5CE6 A;  1BN5 A;  3IU9 A;  3S6B A;  4FLL A;  1QZY A;  1PV9 A;  4IPA A;  1QXZ A;  1QXY A;  3FMR A;  2BWV A;  4U75 A;  1C24 A;  4U1B A;  4PV4 A;  1JAW A;  1YW8 A;  2GG2 A;  4A6W A;  2V3Z A;  1XGS A;  2GU5 A;  4RZZ A;  2EVM A;  3ROR A;  4A6V A;  2BWT A;  3FMQ A;  2V3Y A;  2EA4 A;  4OOK A;  4IDY A;  2GG8 A;  1R5H A;  1XNZ A;  2GG3 A;  1C27 A;  2BWY A;  3IG4 A;  2Q8K A;  5CDV A;  1KQ9 A;  4RZY A;  5E5B A;  2GG0 A;  2B3H A;  1W2M A;  1XGM A;  2IW2 A;  1XGN A;  2BHB A;  3BIP A;  3FM3 A;  3PKB A;  4MAT A;  1R5G A;  4FUK A;  4U6C A;  2BHC A;  2ADU A;  5CIK A;  3PKC A;  4U6E A;  2GZ5 A;  1A16 A;  5JI6 A;  1W7V A;  1XGO A;  1WLR A;  2BH3 A;  1YVM A;  3MR1 A;  2BWU A;  4FLK A;  4IKS A;  1YJ3 A;  2OAZ A;  3MAT A;  3IU7 A;  4ZWP A;  1R58 A;  4PNC A;  4B28 A;  2GG5 A;  1B6A A;  5FCH A;  2HOW A;  2GG9 A;  3CB6 A;  1QXW A;  2GGB A;  4U70 A;  2NQ7 A;  3BIQ A;  4ZWU A;  2EVC A;  2BHA A;  3L24 A;  5D6F A;  2GU6 A;  4U69 A;  2DFI A;  2BWS A;  2G6P A;  4ZWO A;  1B59 A;  4U73 A;  3IU8 A;  3TAV A;  4KM3 A;  4FKC A;  5CLS A;  4S01 A;  4JUQ A;  2V6C A;  2GU7 A;  2Q93 A;  2Q96 A;  4FLI A;  3D27 A;  4IKT A;  5CDL A;  1KQ0 A;  2BHD A;  2GU4 A;  3BIT A;  4FO8 A;  5CNX A;  4U6W A;  1C22 A;  1N51 A;  2B3K A;  2GGC A;  2MAT A;  1CHM A;  3PKD A;  1C23 A;  1MAT A;  2BN7 A;  4IEC A;  4FLJ A;  4IKR A;  1KP0 A;  4IKU A;  1Y1N A;  2ZSG A;  1WN1 A;  3L7G A;  2Q95 A;  1WBQ A;  1WL6 A;  3Q6D A;  2B3L A;  3PKA A;  4HXX A;  2GTX A;  3RVA A;  2Q94 A;  4S2T P;  2Q92 A;  4IF7 A;  4ZNG A;  2GG7 A;  5JFR A;  5D6E A;  3MX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...