4U6WA

Hsmetap (f220m) in complex with 1-amino-2-propylpentyl]phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6wA00
4ZNGA 2P9AA 1O0XA 2GU4A 3Q6DA 2EVOA 2GG9A 4FLLA 4IKUA 5CIKA 2GTXA 1Y1NA 4ZWPA 1YW8A 5JI6A 2B3HA 4S00A 3PKDA 2GGBA 4U6WA 2B3LA 4FO7A 2V3YA 3FM3A 4S2TP 4U69A 1C21A 1QXWA 2GA2A 3PKCA 4FLKA 3D27A 2P99A 1WL6A 1C22A 2HOWA 4OOKA 4PNCA 2GG7A 2BHAA 5CNXA 5CDLA 2ZSGA 4FLJA 4QR8A 4U1BA 2GZ5A 4PV4A 2GU6A 1C24A 2Q95A 4FUKA 1XGMA 3FMQA 2BHCA 4IDYA 1W2MA 4S2RP 5D6EA 2BWVA 1N51A 4U73A 1MATA 1JAWA 2MATA 1W7VA 3CB5A 5CLSA 4Z7MA 2BWWA 2GU5A 3MR1A 4IKRA 2ADUA 4R60A 4U6JA 3IU7A 3PKEA 4A6WA 4U6ZA 2B3KA 3MX6A 3TB5A 3BIPA 1YW7A 1WN1A 1B59A 4IU6A 1B6AA 1R5GA 1PV9A 1QXYA 4A6VA 1R58A 4RGZ1 5FCFA 1WL9A 5JHUA 4S01A 4KM3A 4IF7A 1BN5A 2BWUA 3TAVA 4RZZA 2P98A 1WBQA 2DFIA 4IECA 1WLRA 1R5HA 2BB7A 4JUQA 2GGCA 3BIQA 2Q92A 4ZWUA 2BWXA 2Q93A 5JFRA 4RZYA 3BITA 1KP0A 2BHDA 4EGEA 1KQ0A 1WKMA 2EVMA 3PKAA 2GU7A 1QXZA 4MATA 5D6FA 2BWSA 5CE6A 1BOAA 1A16A 3RVAA 1XGOA 4FKCA 2NQ7A 3MATA 4FLIA 2OAZA 2EVCA 4U70A 3RORA 3IU9A 3CTZA 1QZYA 1YJ3A 5CDVA 1YW9A 2BHBA 2GG8A 2V3ZA 4FO8A 2Q8KA 4U76A 1WY2A 2Q94A 1XGSA 2NQ6A 4U6CA 2EA4A 3PKBA 1XGNA 4ZWOA 1XNZA 4HXXA 5CDEA 2BWYA 2G6PA 1M35A 2V3XA 4U75A 4U71A 1C27A 2GG3A 5FCHA 4IKSA 2GG2A 2Q96A 3L24A 1YVMA 4B28A 2GG5A 2BN7A 2V6CA 2EA2A 2OKNA 3CB6A 3FMRA 3IG4A 4IKTA 5E5BA 1CHMA 2GG0A 3S6BA 1KQ9A 4IPAA 2IW2A 1C23A 2BH3A 4U6EA 3IU8A 3L7GA 2BWTA
chains in the Genus database with same CATH superfamily
4ZNGA 2P9AA 1O0XA 2GU4A 3Q6DA 2EVOA 2GG9A 4FLLA 4IKUA 5CIKA 2GTXA 1Y1NA 4ZWPA 1YW8A 5JI6A 2B3HA 4S00A 3PKDA 2GGBA 4U6WA 2B3LA 4FO7A 2V3YA 3FM3A 4S2TP 4U69A 1C21A 1QXWA 2GA2A 3PKCA 4FLKA 3D27A 2P99A 1WL6A 1C22A 2HOWA 4OOKA 4PNCA 2GG7A 2BHAA 5CNXA 5CDLA 2ZSGA 4FLJA 4QR8A 4U1BA 2GZ5A 4PV4A 2GU6A 1C24A 2Q95A 4FUKA 1XGMA 3FMQA 2BHCA 4IDYA 1W2MA 4S2RP 5D6EA 2BWVA 1N51A 4U73A 1MATA 1JAWA 2MATA 1W7VA 3CB5A 5CLSA 4Z7MA 2BWWA 2GU5A 3MR1A 4IKRA 2ADUA 4R60A 4U6JA 3IU7A 3PKEA 4A6WA 4U6ZA 2B3KA 3MX6A 3TB5A 3BIPA 1YW7A 1WN1A 1B59A 4IU6A 1B6AA 1R5GA 1PV9A 1QXYA 4A6VA 1R58A 4RGZ1 5FCFA 1WL9A 5JHUA 4S01A 4KM3A 4IF7A 1BN5A 2BWUA 3TAVA 4RZZA 2P98A 1WBQA 2DFIA 4IECA 1WLRA 1R5HA 2BB7A 4JUQA 2GGCA 3BIQA 2Q92A 4ZWUA 2BWXA 2Q93A 5JFRA 4RZYA 3BITA 1KP0A 2BHDA 4EGEA 1KQ0A 1WKMA 2EVMA 3PKAA 2GU7A 1QXZA 4MATA 5D6FA 2BWSA 5CE6A 1BOAA 1A16A 3RVAA 1XGOA 4FKCA 2NQ7A 3MATA 4FLIA 2OAZA 2EVCA 4U70A 3RORA 3IU9A 3CTZA 1QZYA 1YJ3A 5CDVA 1YW9A 2BHBA 2GG8A 2V3ZA 4FO8A 2Q8KA 4U76A 1WY2A 2Q94A 1XGSA 2NQ6A 4U6CA 2EA4A 3PKBA 1XGNA 4ZWOA 1XNZA 4HXXA 5CDEA 2BWYA 2G6PA 1M35A 2V3XA 4U75A 4U71A 1C27A 2GG3A 5FCHA 4IKSA 2GG2A 2Q96A 3L24A 1YVMA 4B28A 2GG5A 2BN7A 2V6CA 2EA2A 2OKNA 3CB6A 3FMRA 3IG4A 4IKTA 5E5BA 1CHMA 2GG0A 3S6BA 1KQ9A 4IPAA 2IW2A 1C23A 2BH3A 4U6EA 3IU8A 3L7GA 2BWTA
chains in the Genus database with same CATH topology
4ZNGA 2P9AA 1O0XA 2GU4A 3Q6DA 2EVOA 2GG9A 4FLLA 4IKUA 5CIKA 2GTXA 1Y1NA 4ZWPA 1YW8A 5JI6A 2B3HA 4S00A 3PKDA 2GGBA 4U6WA 2B3LA 4FO7A 2V3YA 3FM3A 4S2TP 4U69A 1C21A 1QXWA 2GA2A 3PKCA 4FLKA 3D27A 2P99A 1WL6A 1C22A 2HOWA 4OOKA 4PNCA 2GG7A 2BHAA 5CNXA 5CDLA 2ZSGA 4FLJA 4QR8A 4U1BA 2GZ5A 4PV4A 2GU6A 1C24A 2Q95A 4FUKA 1XGMA 3FMQA 2BHCA 4IDYA 1W2MA 4S2RP 5D6EA 2BWVA 1N51A 4U73A 1MATA 1JAWA 2MATA 1W7VA 3CB5A 5CLSA 4Z7MA 2BWWA 2GU5A 3MR1A 4IKRA 2ADUA 4R60A 4U6JA 3IU7A 3PKEA 4A6WA 4U6ZA 2B3KA 3MX6A 3TB5A 3BIPA 1YW7A 1WN1A 1B59A 4IU6A 1B6AA 1R5GA 1PV9A 1QXYA 4A6VA 1R58A 4RGZ1 5FCFA 1WL9A 5JHUA 4S01A 4KM3A 4IF7A 1BN5A 2BWUA 3TAVA 4RZZA 2P98A 1WBQA 2DFIA 4IECA 1WLRA 1R5HA 2BB7A 4JUQA 2GGCA 3BIQA 2Q92A 4ZWUA 2BWXA 2Q93A 5JFRA 4RZYA 3BITA 1KP0A 2BHDA 4EGEA 1KQ0A 1WKMA 2EVMA 3PKAA 2GU7A 1QXZA 4MATA 5D6FA 2BWSA 5CE6A 1BOAA 1A16A 3RVAA 1XGOA 4FKCA 2NQ7A 3MATA 4FLIA 2OAZA 2EVCA 4U70A 3RORA 3IU9A 3CTZA 1QZYA 1YJ3A 5CDVA 1YW9A 2BHBA 2GG8A 2V3ZA 4FO8A 2Q8KA 4U76A 1WY2A 2Q94A 1XGSA 2NQ6A 4U6CA 2EA4A 3PKBA 1XGNA 4ZWOA 1XNZA 4HXXA 5CDEA 2BWYA 2G6PA 1M35A 2V3XA 4U75A 4U71A 1C27A 2GG3A 5FCHA 4IKSA 2GG2A 2Q96A 3L24A 1YVMA 4B28A 2GG5A 2BN7A 2V6CA 2EA2A 2OKNA 3CB6A 3FMRA 3IG4A 4IKTA 5E5BA 1CHMA 2GG0A 3S6BA 1KQ9A 4IPAA 2IW2A 1C23A 2BH3A 4U6EA 3IU8A 3L7GA 2BWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZNG A;  2P9A A;  1O0X A;  2GU4 A;  3Q6D A;  2EVO A;  2GG9 A;  4FLL A;  4IKU A;  5CIK A;  2GTX A;  1Y1N A;  4ZWP A;  1YW8 A;  5JI6 A;  2B3H A;  4S00 A;  3PKD A;  2GGB A;  4U6W A;  2B3L A;  4FO7 A;  2V3Y A;  3FM3 A;  4S2T P;  4U69 A;  1C21 A;  1QXW A;  2GA2 A;  3PKC A;  4FLK A;  3D27 A;  2P99 A;  1WL6 A;  1C22 A;  2HOW A;  4OOK A;  4PNC A;  2GG7 A;  2BHA A;  5CNX A;  5CDL A;  2ZSG A;  4FLJ A;  4QR8 A;  4U1B A;  2GZ5 A;  4PV4 A;  2GU6 A;  1C24 A;  2Q95 A;  4FUK A;  1XGM A;  3FMQ A;  2BHC A;  4IDY A;  1W2M A;  4S2R P;  5D6E A;  2BWV A;  1N51 A;  4U73 A;  1MAT A;  1JAW A;  2MAT A;  1W7V A;  3CB5 A;  5CLS A;  4Z7M A;  2BWW A;  2GU5 A;  3MR1 A;  4IKR A;  2ADU A;  4R60 A;  4U6J A;  3IU7 A;  3PKE A;  4A6W A;  4U6Z A;  2B3K A;  3MX6 A;  3TB5 A;  3BIP A;  1YW7 A;  1WN1 A;  1B59 A;  4IU6 A;  1B6A A;  1R5G A;  1PV9 A;  1QXY A;  4A6V A;  1R58 A;  4RGZ 1;  5FCF A;  1WL9 A;  5JHU A;  4S01 A;  4KM3 A;  4IF7 A;  1BN5 A;  2BWU A;  3TAV A;  4RZZ A;  2P98 A;  1WBQ A;  2DFI A;  4IEC A;  1WLR A;  1R5H A;  2BB7 A;  4JUQ A;  2GGC A;  3BIQ A;  2Q92 A;  4ZWU A;  2BWX A;  2Q93 A;  5JFR A;  4RZY A;  3BIT A;  1KP0 A;  2BHD A;  4EGE A;  1KQ0 A;  1WKM A;  2EVM A;  3PKA A;  2GU7 A;  1QXZ A;  4MAT A;  5D6F A;  2BWS A;  5CE6 A;  1BOA A;  1A16 A;  3RVA A;  1XGO A;  4FKC A;  2NQ7 A;  3MAT A;  4FLI A;  2OAZ A;  2EVC A;  4U70 A;  3ROR A;  3IU9 A;  3CTZ A;  1QZY A;  1YJ3 A;  5CDV A;  1YW9 A;  2BHB A;  2GG8 A;  2V3Z A;  4FO8 A;  2Q8K A;  4U76 A;  1WY2 A;  2Q94 A;  1XGS A;  2NQ6 A;  4U6C A;  2EA4 A;  3PKB A;  1XGN A;  4ZWO A;  1XNZ A;  4HXX A;  5CDE A;  2BWY A;  2G6P A;  1M35 A;  2V3X A;  4U75 A;  4U71 A;  1C27 A;  2GG3 A;  5FCH A;  4IKS A;  2GG2 A;  2Q96 A;  3L24 A;  1YVM A;  4B28 A;  2GG5 A;  2BN7 A;  2V6C A;  2EA2 A;  2OKN A;  3CB6 A;  3FMR A;  3IG4 A;  4IKT A;  5E5B A;  1CHM A;  2GG0 A;  3S6B A;  1KQ9 A;  4IPA A;  2IW2 A;  1C23 A;  2BH3 A;  4U6E A;  3IU8 A;  3L7G A;  2BWT A; 
#chains in the Genus database with same CATH topology
 4ZNG A;  2P9A A;  1O0X A;  2GU4 A;  3Q6D A;  2EVO A;  2GG9 A;  4FLL A;  4IKU A;  5CIK A;  2GTX A;  1Y1N A;  4ZWP A;  1YW8 A;  5JI6 A;  2B3H A;  4S00 A;  3PKD A;  2GGB A;  4U6W A;  2B3L A;  4FO7 A;  2V3Y A;  3FM3 A;  4S2T P;  4U69 A;  1C21 A;  1QXW A;  2GA2 A;  3PKC A;  4FLK A;  3D27 A;  2P99 A;  1WL6 A;  1C22 A;  2HOW A;  4OOK A;  4PNC A;  2GG7 A;  2BHA A;  5CNX A;  5CDL A;  2ZSG A;  4FLJ A;  4QR8 A;  4U1B A;  2GZ5 A;  4PV4 A;  2GU6 A;  1C24 A;  2Q95 A;  4FUK A;  1XGM A;  3FMQ A;  2BHC A;  4IDY A;  1W2M A;  4S2R P;  5D6E A;  2BWV A;  1N51 A;  4U73 A;  1MAT A;  1JAW A;  2MAT A;  1W7V A;  3CB5 A;  5CLS A;  4Z7M A;  2BWW A;  2GU5 A;  3MR1 A;  4IKR A;  2ADU A;  4R60 A;  4U6J A;  3IU7 A;  3PKE A;  4A6W A;  4U6Z A;  2B3K A;  3MX6 A;  3TB5 A;  3BIP A;  1YW7 A;  1WN1 A;  1B59 A;  4IU6 A;  1B6A A;  1R5G A;  1PV9 A;  1QXY A;  4A6V A;  1R58 A;  4RGZ 1;  5FCF A;  1WL9 A;  5JHU A;  4S01 A;  4KM3 A;  4IF7 A;  1BN5 A;  2BWU A;  3TAV A;  4RZZ A;  2P98 A;  1WBQ A;  2DFI A;  4IEC A;  1WLR A;  1R5H A;  2BB7 A;  4JUQ A;  2GGC A;  3BIQ A;  2Q92 A;  4ZWU A;  2BWX A;  2Q93 A;  5JFR A;  4RZY A;  3BIT A;  1KP0 A;  2BHD A;  4EGE A;  1KQ0 A;  1WKM A;  2EVM A;  3PKA A;  2GU7 A;  1QXZ A;  4MAT A;  5D6F A;  2BWS A;  5CE6 A;  1BOA A;  1A16 A;  3RVA A;  1XGO A;  4FKC A;  2NQ7 A;  3MAT A;  4FLI A;  2OAZ A;  2EVC A;  4U70 A;  3ROR A;  3IU9 A;  3CTZ A;  1QZY A;  1YJ3 A;  5CDV A;  1YW9 A;  2BHB A;  2GG8 A;  2V3Z A;  4FO8 A;  2Q8K A;  4U76 A;  1WY2 A;  2Q94 A;  1XGS A;  2NQ6 A;  4U6C A;  2EA4 A;  3PKB A;  1XGN A;  4ZWO A;  1XNZ A;  4HXX A;  5CDE A;  2BWY A;  2G6P A;  1M35 A;  2V3X A;  4U75 A;  4U71 A;  1C27 A;  2GG3 A;  5FCH A;  4IKS A;  2GG2 A;  2Q96 A;  3L24 A;  1YVM A;  4B28 A;  2GG5 A;  2BN7 A;  2V6C A;  2EA2 A;  2OKN A;  3CB6 A;  3FMR A;  3IG4 A;  4IKT A;  5E5B A;  1CHM A;  2GG0 A;  3S6B A;  1KQ9 A;  4IPA A;  2IW2 A;  1C23 A;  2BH3 A;  4U6E A;  3IU8 A;  3L7G A;  2BWT A; 
#chains in the Genus database with same CATH homology
 4ZNG A;  2P9A A;  1O0X A;  2GU4 A;  3Q6D A;  2EVO A;  2GG9 A;  4FLL A;  4IKU A;  5CIK A;  2GTX A;  1Y1N A;  4ZWP A;  1YW8 A;  5JI6 A;  2B3H A;  4S00 A;  3PKD A;  2GGB A;  4U6W A;  2B3L A;  4FO7 A;  2V3Y A;  3FM3 A;  4S2T P;  4U69 A;  1C21 A;  1QXW A;  2GA2 A;  3PKC A;  4FLK A;  3D27 A;  2P99 A;  1WL6 A;  1C22 A;  2HOW A;  4OOK A;  4PNC A;  2GG7 A;  2BHA A;  5CNX A;  5CDL A;  2ZSG A;  4FLJ A;  4QR8 A;  4U1B A;  2GZ5 A;  4PV4 A;  2GU6 A;  1C24 A;  2Q95 A;  4FUK A;  1XGM A;  3FMQ A;  2BHC A;  4IDY A;  1W2M A;  4S2R P;  5D6E A;  2BWV A;  1N51 A;  4U73 A;  1MAT A;  1JAW A;  2MAT A;  1W7V A;  3CB5 A;  5CLS A;  4Z7M A;  2BWW A;  2GU5 A;  3MR1 A;  4IKR A;  2ADU A;  4R60 A;  4U6J A;  3IU7 A;  3PKE A;  4A6W A;  4U6Z A;  2B3K A;  3MX6 A;  3TB5 A;  3BIP A;  1YW7 A;  1WN1 A;  1B59 A;  4IU6 A;  1B6A A;  1R5G A;  1PV9 A;  1QXY A;  4A6V A;  1R58 A;  4RGZ 1;  5FCF A;  1WL9 A;  5JHU A;  4S01 A;  4KM3 A;  4IF7 A;  1BN5 A;  2BWU A;  3TAV A;  4RZZ A;  2P98 A;  1WBQ A;  2DFI A;  4IEC A;  1WLR A;  1R5H A;  2BB7 A;  4JUQ A;  2GGC A;  3BIQ A;  2Q92 A;  4ZWU A;  2BWX A;  2Q93 A;  5JFR A;  4RZY A;  3BIT A;  1KP0 A;  2BHD A;  4EGE A;  1KQ0 A;  1WKM A;  2EVM A;  3PKA A;  2GU7 A;  1QXZ A;  4MAT A;  5D6F A;  2BWS A;  5CE6 A;  1BOA A;  1A16 A;  3RVA A;  1XGO A;  4FKC A;  2NQ7 A;  3MAT A;  4FLI A;  2OAZ A;  2EVC A;  4U70 A;  3ROR A;  3IU9 A;  3CTZ A;  1QZY A;  1YJ3 A;  5CDV A;  1YW9 A;  2BHB A;  2GG8 A;  2V3Z A;  4FO8 A;  2Q8K A;  4U76 A;  1WY2 A;  2Q94 A;  1XGS A;  2NQ6 A;  4U6C A;  2EA4 A;  3PKB A;  1XGN A;  4ZWO A;  1XNZ A;  4HXX A;  5CDE A;  2BWY A;  2G6P A;  1M35 A;  2V3X A;  4U75 A;  4U71 A;  1C27 A;  2GG3 A;  5FCH A;  4IKS A;  2GG2 A;  2Q96 A;  3L24 A;  1YVM A;  4B28 A;  2GG5 A;  2BN7 A;  2V6C A;  2EA2 A;  2OKN A;  3CB6 A;  3FMR A;  3IG4 A;  4IKT A;  5E5B A;  1CHM A;  2GG0 A;  3S6B A;  1KQ9 A;  4IPA A;  2IW2 A;  1C23 A;  2BH3 A;  4U6E A;  3IU8 A;  3L7G A;  2BWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...