4U6WA

Hsmetap (f220m) in complex with 1-amino-2-propylpentyl]phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6wA00
1BOAA 2OKNA 3CTZA 4JUQA 2GG2A 2Q94A 2IW2A 2EA4A 3IU8A 2B3KA 2BWSA 4MATA 4RZZA 4HXXA 3FM3A 4S01A 4ZWUA 1C24A 2P98A 1QXWA 3RORA 4FKCA 4U6EA 5CNXA 5E5BA 5CDLA 2BHAA 4S00A 1O0XA 5D6FA 2BWYA 1BN5A 1W7VA 3CB6A 2GZ5A 4A6WA 1QXYA 2GA2A 4ZWPA 2G6PA 2GU4A 2Q92A 2BWVA 2V6CA 1KQ0A 2ADUA 1XNZA 1A16A 4IKUA 4KM3A 3Q6DA 1M35A 5CE6A 2GG0A 2BH3A 2BWWA 2EVOA 3FMRA 1XGSA 4FLIA 2NQ7A 4FLJA 1KP0A 3BIPA 5CDEA 3PKEA 4IKRA 1WL6A 2ZSGA 2MATA 2GG7A 2BN7A 4ZNGA 1B59A 4FO8A 5JFRA 2GGCA 1WKMA 5CLSA 2P99A 4U73A 4ZWOA 1YW7A 1Y1NA 4IF7A 4QR8A 1XGOA 3L24A 3MATA 5FCHA 4OOKA 1YJ3A 4U76A 1PV9A 1XGMA 2GU5A 4U69A 4R60A 3PKAA 4U1BA 4U6JA 1N51A 2DFIA 3D27A 4PNCA 3TAVA 4B28A 1YW8A 5D6EA 2OAZA 4FLLA 5JHUA 3IG4A 2EVMA 5CIKA 2BHBA 4FLKA 2GGBA 2Q95A 4FO7A 3TB5A 4S2RP 2V3XA 3CB5A 4PV4A 1YW9A 2GU6A 2HOWA 1C22A 2NQ6A 4FUKA 4U6ZA 1C23A 1R5HA 1QXZA 4U75A 2GTXA 2GG5A 4IKSA 1WN1A 4U70A 1WY2A 2Q93A 1WL9A 4IECA 4U6CA 4IU6A 4S2TP 5CDVA 1WLRA 1CHMA 1XGNA 2BWUA 4IDYA 2Q8KA 1MATA 1WBQA 2BB7A 2V3YA 2B3LA 3IU9A 2B3HA 1YVMA 2P9AA 3PKDA 4RGZ1 4U6WA 2EA2A 4IPAA 2Q96A 5FCFA 3MX6A 3BIQA 1B6AA 2GG8A 2GU7A 3PKCA 2EVCA 1KQ9A 2GG9A 3RVAA 2GG3A 2BWTA 2V3ZA 1C21A 1R5GA 2BHDA 3MR1A 4EGEA 4U71A 3FMQA 4IKTA 4Z7MA 1W2MA 1JAWA 1C27A 3L7GA 1QZYA 3IU7A 4RZYA 3PKBA 1R58A 2BWXA 5JI6A 3BITA 3S6BA 2BHCA 4A6VA
chains in the Genus database with same CATH superfamily
1BOAA 2OKNA 3CTZA 4JUQA 2GG2A 2Q94A 2IW2A 2EA4A 3IU8A 2B3KA 2BWSA 4MATA 4RZZA 4HXXA 3FM3A 4S01A 4ZWUA 1C24A 2P98A 1QXWA 3RORA 4FKCA 4U6EA 5CNXA 5E5BA 5CDLA 2BHAA 4S00A 1O0XA 5D6FA 2BWYA 1BN5A 1W7VA 3CB6A 2GZ5A 4A6WA 1QXYA 2GA2A 4ZWPA 2G6PA 2GU4A 2Q92A 2BWVA 2V6CA 1KQ0A 2ADUA 1XNZA 1A16A 4IKUA 4KM3A 3Q6DA 1M35A 5CE6A 2GG0A 2BH3A 2BWWA 2EVOA 3FMRA 1XGSA 4FLIA 2NQ7A 4FLJA 1KP0A 3BIPA 5CDEA 3PKEA 4IKRA 1WL6A 2ZSGA 2MATA 2GG7A 2BN7A 4ZNGA 1B59A 4FO8A 5JFRA 2GGCA 1WKMA 5CLSA 2P99A 4U73A 4ZWOA 1YW7A 1Y1NA 4IF7A 4QR8A 1XGOA 3L24A 3MATA 5FCHA 4OOKA 1YJ3A 4U76A 1PV9A 1XGMA 2GU5A 4U69A 4R60A 3PKAA 4U1BA 4U6JA 1N51A 2DFIA 3D27A 4PNCA 3TAVA 4B28A 1YW8A 5D6EA 2OAZA 4FLLA 5JHUA 3IG4A 2EVMA 5CIKA 2BHBA 4FLKA 2GGBA 2Q95A 4FO7A 3TB5A 4S2RP 2V3XA 3CB5A 4PV4A 1YW9A 2GU6A 2HOWA 1C22A 2NQ6A 4FUKA 4U6ZA 1C23A 1R5HA 1QXZA 4U75A 2GTXA 2GG5A 4IKSA 1WN1A 4U70A 1WY2A 2Q93A 1WL9A 4IECA 4U6CA 4IU6A 4S2TP 5CDVA 1WLRA 1CHMA 1XGNA 2BWUA 4IDYA 2Q8KA 1MATA 1WBQA 2BB7A 2V3YA 2B3LA 3IU9A 2B3HA 1YVMA 2P9AA 3PKDA 4RGZ1 4U6WA 2EA2A 4IPAA 2Q96A 5FCFA 3MX6A 3BIQA 1B6AA 2GG8A 2GU7A 3PKCA 2EVCA 1KQ9A 2GG9A 3RVAA 2GG3A 2BWTA 2V3ZA 1C21A 1R5GA 2BHDA 3MR1A 4EGEA 4U71A 3FMQA 4IKTA 4Z7MA 1W2MA 1JAWA 1C27A 3L7GA 1QZYA 3IU7A 4RZYA 3PKBA 1R58A 2BWXA 5JI6A 3BITA 3S6BA 2BHCA 4A6VA
chains in the Genus database with same CATH topology
1BOAA 2OKNA 3CTZA 4JUQA 2GG2A 2Q94A 2IW2A 2EA4A 3IU8A 2B3KA 2BWSA 4MATA 4RZZA 4HXXA 3FM3A 4S01A 4ZWUA 1C24A 2P98A 1QXWA 3RORA 4FKCA 4U6EA 5CNXA 5E5BA 5CDLA 2BHAA 4S00A 1O0XA 5D6FA 2BWYA 1BN5A 1W7VA 3CB6A 2GZ5A 4A6WA 1QXYA 2GA2A 4ZWPA 2G6PA 2GU4A 2Q92A 2BWVA 2V6CA 1KQ0A 2ADUA 1XNZA 1A16A 4IKUA 4KM3A 3Q6DA 1M35A 5CE6A 2GG0A 2BH3A 2BWWA 2EVOA 3FMRA 1XGSA 4FLIA 2NQ7A 4FLJA 1KP0A 3BIPA 5CDEA 3PKEA 4IKRA 1WL6A 2ZSGA 2MATA 2GG7A 2BN7A 4ZNGA 1B59A 4FO8A 5JFRA 2GGCA 1WKMA 5CLSA 2P99A 4U73A 4ZWOA 1YW7A 1Y1NA 4IF7A 4QR8A 1XGOA 3L24A 3MATA 5FCHA 4OOKA 1YJ3A 4U76A 1PV9A 1XGMA 2GU5A 4U69A 4R60A 3PKAA 4U1BA 4U6JA 1N51A 2DFIA 3D27A 4PNCA 3TAVA 4B28A 1YW8A 5D6EA 2OAZA 4FLLA 5JHUA 3IG4A 2EVMA 5CIKA 2BHBA 4FLKA 2GGBA 2Q95A 4FO7A 3TB5A 4S2RP 2V3XA 3CB5A 4PV4A 1YW9A 2GU6A 2HOWA 1C22A 2NQ6A 4FUKA 4U6ZA 1C23A 1R5HA 1QXZA 4U75A 2GTXA 2GG5A 4IKSA 1WN1A 4U70A 1WY2A 2Q93A 1WL9A 4IECA 4U6CA 4IU6A 4S2TP 5CDVA 1WLRA 1CHMA 1XGNA 2BWUA 4IDYA 2Q8KA 1MATA 1WBQA 2BB7A 2V3YA 2B3LA 3IU9A 2B3HA 1YVMA 2P9AA 3PKDA 4RGZ1 4U6WA 2EA2A 4IPAA 2Q96A 5FCFA 3MX6A 3BIQA 1B6AA 2GG8A 2GU7A 3PKCA 2EVCA 1KQ9A 2GG9A 3RVAA 2GG3A 2BWTA 2V3ZA 1C21A 1R5GA 2BHDA 3MR1A 4EGEA 4U71A 3FMQA 4IKTA 4Z7MA 1W2MA 1JAWA 1C27A 3L7GA 1QZYA 3IU7A 4RZYA 3PKBA 1R58A 2BWXA 5JI6A 3BITA 3S6BA 2BHCA 4A6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOA A;  2OKN A;  3CTZ A;  4JUQ A;  2GG2 A;  2Q94 A;  2IW2 A;  2EA4 A;  3IU8 A;  2B3K A;  2BWS A;  4MAT A;  4RZZ A;  4HXX A;  3FM3 A;  4S01 A;  4ZWU A;  1C24 A;  2P98 A;  1QXW A;  3ROR A;  4FKC A;  4U6E A;  5CNX A;  5E5B A;  5CDL A;  2BHA A;  4S00 A;  1O0X A;  5D6F A;  2BWY A;  1BN5 A;  1W7V A;  3CB6 A;  2GZ5 A;  4A6W A;  1QXY A;  2GA2 A;  4ZWP A;  2G6P A;  2GU4 A;  2Q92 A;  2BWV A;  2V6C A;  1KQ0 A;  2ADU A;  1XNZ A;  1A16 A;  4IKU A;  4KM3 A;  3Q6D A;  1M35 A;  5CE6 A;  2GG0 A;  2BH3 A;  2BWW A;  2EVO A;  3FMR A;  1XGS A;  4FLI A;  2NQ7 A;  4FLJ A;  1KP0 A;  3BIP A;  5CDE A;  3PKE A;  4IKR A;  1WL6 A;  2ZSG A;  2MAT A;  2GG7 A;  2BN7 A;  4ZNG A;  1B59 A;  4FO8 A;  5JFR A;  2GGC A;  1WKM A;  5CLS A;  2P99 A;  4U73 A;  4ZWO A;  1YW7 A;  1Y1N A;  4IF7 A;  4QR8 A;  1XGO A;  3L24 A;  3MAT A;  5FCH A;  4OOK A;  1YJ3 A;  4U76 A;  1PV9 A;  1XGM A;  2GU5 A;  4U69 A;  4R60 A;  3PKA A;  4U1B A;  4U6J A;  1N51 A;  2DFI A;  3D27 A;  4PNC A;  3TAV A;  4B28 A;  1YW8 A;  5D6E A;  2OAZ A;  4FLL A;  5JHU A;  3IG4 A;  2EVM A;  5CIK A;  2BHB A;  4FLK A;  2GGB A;  2Q95 A;  4FO7 A;  3TB5 A;  4S2R P;  2V3X A;  3CB5 A;  4PV4 A;  1YW9 A;  2GU6 A;  2HOW A;  1C22 A;  2NQ6 A;  4FUK A;  4U6Z A;  1C23 A;  1R5H A;  1QXZ A;  4U75 A;  2GTX A;  2GG5 A;  4IKS A;  1WN1 A;  4U70 A;  1WY2 A;  2Q93 A;  1WL9 A;  4IEC A;  4U6C A;  4IU6 A;  4S2T P;  5CDV A;  1WLR A;  1CHM A;  1XGN A;  2BWU A;  4IDY A;  2Q8K A;  1MAT A;  1WBQ A;  2BB7 A;  2V3Y A;  2B3L A;  3IU9 A;  2B3H A;  1YVM A;  2P9A A;  3PKD A;  4RGZ 1;  4U6W A;  2EA2 A;  4IPA A;  2Q96 A;  5FCF A;  3MX6 A;  3BIQ A;  1B6A A;  2GG8 A;  2GU7 A;  3PKC A;  2EVC A;  1KQ9 A;  2GG9 A;  3RVA A;  2GG3 A;  2BWT A;  2V3Z A;  1C21 A;  1R5G A;  2BHD A;  3MR1 A;  4EGE A;  4U71 A;  3FMQ A;  4IKT A;  4Z7M A;  1W2M A;  1JAW A;  1C27 A;  3L7G A;  1QZY A;  3IU7 A;  4RZY A;  3PKB A;  1R58 A;  2BWX A;  5JI6 A;  3BIT A;  3S6B A;  2BHC A;  4A6V A; 
#chains in the Genus database with same CATH topology
 1BOA A;  2OKN A;  3CTZ A;  4JUQ A;  2GG2 A;  2Q94 A;  2IW2 A;  2EA4 A;  3IU8 A;  2B3K A;  2BWS A;  4MAT A;  4RZZ A;  4HXX A;  3FM3 A;  4S01 A;  4ZWU A;  1C24 A;  2P98 A;  1QXW A;  3ROR A;  4FKC A;  4U6E A;  5CNX A;  5E5B A;  5CDL A;  2BHA A;  4S00 A;  1O0X A;  5D6F A;  2BWY A;  1BN5 A;  1W7V A;  3CB6 A;  2GZ5 A;  4A6W A;  1QXY A;  2GA2 A;  4ZWP A;  2G6P A;  2GU4 A;  2Q92 A;  2BWV A;  2V6C A;  1KQ0 A;  2ADU A;  1XNZ A;  1A16 A;  4IKU A;  4KM3 A;  3Q6D A;  1M35 A;  5CE6 A;  2GG0 A;  2BH3 A;  2BWW A;  2EVO A;  3FMR A;  1XGS A;  4FLI A;  2NQ7 A;  4FLJ A;  1KP0 A;  3BIP A;  5CDE A;  3PKE A;  4IKR A;  1WL6 A;  2ZSG A;  2MAT A;  2GG7 A;  2BN7 A;  4ZNG A;  1B59 A;  4FO8 A;  5JFR A;  2GGC A;  1WKM A;  5CLS A;  2P99 A;  4U73 A;  4ZWO A;  1YW7 A;  1Y1N A;  4IF7 A;  4QR8 A;  1XGO A;  3L24 A;  3MAT A;  5FCH A;  4OOK A;  1YJ3 A;  4U76 A;  1PV9 A;  1XGM A;  2GU5 A;  4U69 A;  4R60 A;  3PKA A;  4U1B A;  4U6J A;  1N51 A;  2DFI A;  3D27 A;  4PNC A;  3TAV A;  4B28 A;  1YW8 A;  5D6E A;  2OAZ A;  4FLL A;  5JHU A;  3IG4 A;  2EVM A;  5CIK A;  2BHB A;  4FLK A;  2GGB A;  2Q95 A;  4FO7 A;  3TB5 A;  4S2R P;  2V3X A;  3CB5 A;  4PV4 A;  1YW9 A;  2GU6 A;  2HOW A;  1C22 A;  2NQ6 A;  4FUK A;  4U6Z A;  1C23 A;  1R5H A;  1QXZ A;  4U75 A;  2GTX A;  2GG5 A;  4IKS A;  1WN1 A;  4U70 A;  1WY2 A;  2Q93 A;  1WL9 A;  4IEC A;  4U6C A;  4IU6 A;  4S2T P;  5CDV A;  1WLR A;  1CHM A;  1XGN A;  2BWU A;  4IDY A;  2Q8K A;  1MAT A;  1WBQ A;  2BB7 A;  2V3Y A;  2B3L A;  3IU9 A;  2B3H A;  1YVM A;  2P9A A;  3PKD A;  4RGZ 1;  4U6W A;  2EA2 A;  4IPA A;  2Q96 A;  5FCF A;  3MX6 A;  3BIQ A;  1B6A A;  2GG8 A;  2GU7 A;  3PKC A;  2EVC A;  1KQ9 A;  2GG9 A;  3RVA A;  2GG3 A;  2BWT A;  2V3Z A;  1C21 A;  1R5G A;  2BHD A;  3MR1 A;  4EGE A;  4U71 A;  3FMQ A;  4IKT A;  4Z7M A;  1W2M A;  1JAW A;  1C27 A;  3L7G A;  1QZY A;  3IU7 A;  4RZY A;  3PKB A;  1R58 A;  2BWX A;  5JI6 A;  3BIT A;  3S6B A;  2BHC A;  4A6V A; 
#chains in the Genus database with same CATH homology
 1BOA A;  2OKN A;  3CTZ A;  4JUQ A;  2GG2 A;  2Q94 A;  2IW2 A;  2EA4 A;  3IU8 A;  2B3K A;  2BWS A;  4MAT A;  4RZZ A;  4HXX A;  3FM3 A;  4S01 A;  4ZWU A;  1C24 A;  2P98 A;  1QXW A;  3ROR A;  4FKC A;  4U6E A;  5CNX A;  5E5B A;  5CDL A;  2BHA A;  4S00 A;  1O0X A;  5D6F A;  2BWY A;  1BN5 A;  1W7V A;  3CB6 A;  2GZ5 A;  4A6W A;  1QXY A;  2GA2 A;  4ZWP A;  2G6P A;  2GU4 A;  2Q92 A;  2BWV A;  2V6C A;  1KQ0 A;  2ADU A;  1XNZ A;  1A16 A;  4IKU A;  4KM3 A;  3Q6D A;  1M35 A;  5CE6 A;  2GG0 A;  2BH3 A;  2BWW A;  2EVO A;  3FMR A;  1XGS A;  4FLI A;  2NQ7 A;  4FLJ A;  1KP0 A;  3BIP A;  5CDE A;  3PKE A;  4IKR A;  1WL6 A;  2ZSG A;  2MAT A;  2GG7 A;  2BN7 A;  4ZNG A;  1B59 A;  4FO8 A;  5JFR A;  2GGC A;  1WKM A;  5CLS A;  2P99 A;  4U73 A;  4ZWO A;  1YW7 A;  1Y1N A;  4IF7 A;  4QR8 A;  1XGO A;  3L24 A;  3MAT A;  5FCH A;  4OOK A;  1YJ3 A;  4U76 A;  1PV9 A;  1XGM A;  2GU5 A;  4U69 A;  4R60 A;  3PKA A;  4U1B A;  4U6J A;  1N51 A;  2DFI A;  3D27 A;  4PNC A;  3TAV A;  4B28 A;  1YW8 A;  5D6E A;  2OAZ A;  4FLL A;  5JHU A;  3IG4 A;  2EVM A;  5CIK A;  2BHB A;  4FLK A;  2GGB A;  2Q95 A;  4FO7 A;  3TB5 A;  4S2R P;  2V3X A;  3CB5 A;  4PV4 A;  1YW9 A;  2GU6 A;  2HOW A;  1C22 A;  2NQ6 A;  4FUK A;  4U6Z A;  1C23 A;  1R5H A;  1QXZ A;  4U75 A;  2GTX A;  2GG5 A;  4IKS A;  1WN1 A;  4U70 A;  1WY2 A;  2Q93 A;  1WL9 A;  4IEC A;  4U6C A;  4IU6 A;  4S2T P;  5CDV A;  1WLR A;  1CHM A;  1XGN A;  2BWU A;  4IDY A;  2Q8K A;  1MAT A;  1WBQ A;  2BB7 A;  2V3Y A;  2B3L A;  3IU9 A;  2B3H A;  1YVM A;  2P9A A;  3PKD A;  4RGZ 1;  4U6W A;  2EA2 A;  4IPA A;  2Q96 A;  5FCF A;  3MX6 A;  3BIQ A;  1B6A A;  2GG8 A;  2GU7 A;  3PKC A;  2EVC A;  1KQ9 A;  2GG9 A;  3RVA A;  2GG3 A;  2BWT A;  2V3Z A;  1C21 A;  1R5G A;  2BHD A;  3MR1 A;  4EGE A;  4U71 A;  3FMQ A;  4IKT A;  4Z7M A;  1W2M A;  1JAW A;  1C27 A;  3L7G A;  1QZY A;  3IU7 A;  4RZY A;  3PKB A;  1R58 A;  2BWX A;  5JI6 A;  3BIT A;  3S6B A;  2BHC A;  4A6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...