2DFIA

Crystal structure of pf-map(1-292)-c
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
301
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 94
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dfiA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2dfiA01
1LB2A 2DQRA 2BH3A 2YR2A 1W4MA 2ZMEB 2L4AA 2IA0A 3BITA 2RKHA 4AVPA 4ZYHA 1G3TA 3RI4A 3QU6A 4RB2C 2XGXA 3KP6A 3IRQA 5ILSA 2BN7A 2QQAA 4I7HA 3IU8A 4I98B 3GFIA 3CTZA 5HS9A 2FSWA 2CSOA 3K9TA 4GGGA 5LGTA 2Z99A 3K1NA 4KA4A 2CWEA 2KKOA 2RNJA 1FSHA 1LJ9A 1S3JA 2KIUA 2H09A 2Q0OA 1UFMA 3IC7A 4BHBA 3CO7C 4AIKA 1IF1A 2P7CB 4M72A 2BWUA 3ZP5A 5F64A 4Q5SF 4XSZF 4IECA 4RGRA 1LDDA 2VODA 2VOOA 2KIMA 1LEBA 4ZYDA 2IVMA 2VBZA 3DFGA 4A6EA 3G73A 3R0AA 4P96A 3ZMUA 2Q2EA 2HOEA 1ZRDA 5BMZA 1DUXC 2L54A 1BC7C 2OKNA 2IA2A 2A69F 3HRTA 2FEZA 4RAZA 3MFKA 1OYYA 1GXQA 3KP4A 1LDJA 5ICFA 2ZSGA 4S05A 3VFZA 2HTJA 1DPUA 3PFIA 4OIQF 4HV5A 3RVAA 4OINF 2PG4A 5LHGA 2P99A 5JHUA 4RGUA 4IKSA 1WQ2A 2WTEA 3KETA 1W5SA 4Y15A 3LAPA 2GA2A 2UZKA 3P9IA 1Z1DA 4HF1A 4L5IA 4RGSA 2R7DA 5L3FA 4U1BA 1F1ZA 2DLLA 3ABTA 3SZPA 3REOA 2XAHA 3TKYA 4YG2F 2GG3A 1ZG1A 4AWXB 5E8GA 3DF8A 2HYFA 5L3EA 4DNCA 2NRAC 2M8EA 4NB5A 4GXOA 2X4HA 3CDHA 2BWTA 2ETHA 2JT1A 1K78B 3GLXA 2EV0A 1QQIA 1O3QA 2MA3A 4CZZA 3J80Z 2QQBA 1BI2A 3Q9VA 1O57A 4OOIA 1Z7UA 3IHUA 1PUEE 1O7FA 5AIQA 1SD7A 1QPMA 2NNNA 2XAGA 3PQKA 1YVMA 1KYZA 3FXUA 2GG9A 5FLXK 2QQ9A 5FFXA 2E1NA 2HTSA 2EVMA 4IRHA 4ZH4F 4GCVA 2YPRA 4AIJA 2DFIA 3IWZA 1WL6A 3PKAA 2C6YA 2O6GE 4WXCA 4KDPA 4EGEA 4FX0A 3EYIA 4N0BA 2CQKA 2IA1A 1U6GA 2P6SA 3HUGA 2L3DA 4RB1A 2COMA 4RS8A 3L09A 1P2FA 3VOEA 4U0YA 4ZWOA 4EQQA 3ZMVA 1BN5A 2NQ7A 4MATA 4U0WA 3I5UA 3I4PA 3PKDA 1BIBA 3KLOA 4A6VA 1USSA 4MTDA 4MNUA 2P7VB 4A5NA 2ZKZA 2XAQA 2BE5F 1C24A 3KZYA 2FF4A 1YLFA 1YW7A 3BJAA 2FMLA 3O2PE 5FGMA 3L7WA 2FBIA 1FBSA 3S2WA 2VT3A 1FWZA 2R7FA 3GW2A 3MCZA 3N4MA 4YFNF 1HSTA 3J81Z 1OPCA 3LFKA 1RNLA 2O0YA 4IPAA 1J2XA 4KMUX 1CF7A 2EWNA 3RJPA 2V3ZA 2GA1A 4HW0A 3F8MA 2CO5A 3MR1A 3BY6A 3ZMTA 4EGZA 1K78A 1W2MA 5L3BA 2GG2A 5FLXZ 4MEXF 3H3ZA 3VB2A 4M9XA 4MTEA 4WCGA 3C1DA 1U78A 2MBFA 4ZWUA 2GG5A 2NQ6A 5J8CA 5CVUA 3E3VA 2K7LA 1HW2A 2E7XA 1FYKA 2P4WA 2XASA 2FNPA 2ZBKA 4LK0F 1MJ9A 3TOBA 2ADUA 5D6EA 1F5TA 1I1SA 4OIOF 2HWVA 4LLLA 5BS6A 4PGGA 4UVBA 3BPXA 1NHAA 3KP3A 3B73A 4WXHA 1O3SA 1BM9A 4HX8A 1RZ4A 4HF0A 4O3MA 2BWVA 3JAMZ 2G7HA 5K5QA 4RB0A 3HOTA 4OIPF 1C23A 2V79A 1KP0A 4FUKA 4XLNF 2H27A 1S29A 4DQ2A 1MKMA 4RAYA 4A5MA 3DKWA 3BPVA 4KNYA 1XB4A 3BP8A 2M45A 4TV7A 3GF2A 1P92A 5DEQA 3S6BA 3NRVA 1LVAA 2A6HF 2OZ6A 4A0XA 4LFUA 1TQMA 3VODA 5HS8A 1D3YA 3HSRA 3MAJA 2BWSA 2RGVA 2EFPA 2XKOA 4IHSA 3W6KB 2EV6A 2B3LA 2ISZA 1ZLJA 5DUIA 2LF8A 1YIOA 3D0SA 2O61A 3ULQB 5K5OA 3K1MA 3MZYA 3R60A 1R1TA 2JRTA 2MLKA 1KU9A 2E7WA 3F6VA 4ESBA 4HV6A 2P6TA 4G8XA 3TO6A 5D5UB 4FX4A 1W7PB 5LBQA 3I59B 1MD0A 4ENJA 1BI0A 1ONVA 1ODDA 1O7LA 3KP7A 1YS7A 3PKBA 3SZTA 3ZN1A 2Y0MA 1KU7A 2VONA 3KZZA 1RUNA 4M6YA 2XAJA 1XMKA 4ESJA 4ZYGA 2A3SA 2L01A 3RYRA 2BHBA 3DQVC 2J5PA 2CFXA 5HS7A 2H6CA 4GYGA 1T6SA 1ZGAA 3E97A 3OV8A 4CICA 4FO7A 1R22A 2PN6A 1Y1NA 4LB6B 3WTYC 1BI1A 1XDUA 2YU3A 2EFQA 4EV0A 3R6SA 1WRJA 3BJ6A 3HHGA 2P5KA 3IRRA 2W25A 1SD4A 4MGRA 4O6JA 1W7VA 1J7KA 3KP5A 2V3YA 1TQIA 5DD8A 2BV6A 5H20A 5FO5A 1XN7A 2FRHA 5BQTA 4LG0B 3IU9A 2JZYA 1ZRCA 2PMUA 1XGMA 5DUKA 1WBQA 2W57A 4FLJA 4GYIA 2MD5A 2NS0A 1L0OC 5DCFA 2HR3A 4U7DA 1QZYA 1ZG3A 2DT5A 2F2EA 3HTUA 4WXDA 4S2RP 1F4KA 4U88A 3WTZA 3FXQA 4HBLA 5KVRA 2XV4S 2XRNA 1BI3A 4IU6A 2VT2A 2WWYA 3JSPA 5FCFA 4M73A 1IN8A 5TRDA 4PGHA 1W7PA 1KYWA 1JGSA 1EH8A 2V6CA 1R23A 3I59A 4HDVA 2GU6A 5FB2A 3F8CA 3QU3A 2NNYA 5K1YA 2QWWA 4FT8A 2O03A 4OIRF 3N97A 2BYVE 3LWFA 1I5ZA 1BBYA 1QGPA 4KM3A 2PMHA 1ULYA 1D5VA 1WN1A 3F3XA 3P7NA 2W84A 2DAOA 3K1PA 1IAWA 5A2QK 4G9YA 3SHFA 2Z5UA 2GG8A 2MATA 2HFHA 3C3WA 1IUYA 1O3RA 3SQNA 4OOKA 4UXNA 2V1DA 3QRFF 3KLNA 5CDVA 5IT3A 1HKQA 2AXLA 1Z9CA 1OMIA 1EH7A 4I2OA 4KN7X 1XGNA 3O3KA 4ZNGA 1MDMA 2P98A 3V4GA 3DV8A 1T98A 1FLIA 1WSUA 1YYVA 4UHTA 2LDUA 4HQEA 3LQQA 3L24A 4IDYA 4IKUA 4KMFA 2GQQA 3F72A 5AONA 1BOAA 1FP2A 4Y17A 4U6JA 2EA4A 2XAFA 4LG0A 2IW5A 4EM1A 2DK8A 5FD5A 4MHGA 2ACJA 4JBAA 1M35A 3V7CA 1IN4A 2DU9A 2M30A 1K7AA 1KU3A 5J8FA 2HEOA 2HOWA 2OQGA 2STWA 4HXXA 2QM3A 3IL2A 1HW5A 5D4RA 2ESNA 3VEPA 1IRFA 4A2UA 2GWRA 4ZZLA 2ZNZA 2OA4A 2VOPA 3ZMZA 3B02A 2ZMEA 3Q5FA 2HDCA 3WTWC 1R5GA 4CDGA 2IT0A 3NEUA 2OAZA 3ROUA 1KGSA 4P9UA 5A2QZ 1KQ8A 2VN2A 1ZH5A 1SD5A 5CYVA 5K5RA 1TQPA 3LA3A 1N51A 2XUBA 2D2WA 4YFKF 2O8XA 1G6NA 4EJVA 1QNTA 5J6XA 1T2KA 2IRFG 4N9HA 1OYIA 4ASNA 3TOAA 3WTSC 5EEHA 4EMSA 2VC0A 4RZYA 3QP5A 5LHHA 2KRFA 4HYEA 2JTVA 3WG9A 1B9MA 1UHMA 4FO8A 4EM2A 1GVJA 3BIPA 5TJJA 1O0XA 1P4XA 3V7SA 2IPQX 3E6BA 2A6EF 2Y75A 1WY2A 2F5EA 4RGZ1 3QPTA 5HLHA 3FM3A 4M9ZA 2CW0F 2K86A 3Q9SA 3TDZC 3BZ6A 3R4KA 3WE2A 3L9FA 3ABUA 1QO0D 3G3ZA 2E1CA 1ON2A 3I71A 1K79A 2GZWA 2STTA 2QZ8A 3I64A 4KIGA 1IRGA 4HX4A 2Q95A 4Q47A 3DEUA 3GZ5A 5E8IA 2HQRA 2L4MA 3H3UA 2HGCA 3WGGA 2OU2A 5HDNA 4ON0A 1IN6A 2DTRA 1K6OA 1Z6RA 4LLNA 3L7GA 2EV5A 2B3HA 3F8NA 5L3GA 1QBJA 3CUQB 2B0LA 1F9NA 5DD4A 2G7UA 4I02A 1XSDA 3GWZA 1H9GA 1XDSA 4YIIA 1U8RA 1ZN2A 1OR7A 4ENNA 2ESHA 5CNXA 4EJUA 2ELHA 4R1HA 2GG0A 2Q94A 2QENA 4L5JA 2MH2A 3BDDA 3FF5A 4G6QA 3MATA 2BHCA 1P4WA 4D0PA 3GX4X 3FX3A 2KJBA 1TNTA 5ICCA 4OU0A 4L0YB 4M71A 2OQRA 4HQMA 1HXDA 4P55A 2D45A 4MQ9F 2VXZA 4A0YA 1IXSB 3MQ0A 1U3EM 2QBYB 4M74A 1TBXA 2YX7A 1ZAOA 3M1EA 3U9GA 1WLRA 4KIFA 4IKTA 5E18F 1SFXA 1HW1A 4BNCA 1FSEA 3JTHA 2Z3YA 3MX6A 3P9CA 3HRUA 1G3WA 4FLIA 4U76A 2X0LA 2DO7A 3MWMA 3ECOA 4HAMA 4FLLA 4L18B 1S6LA 4HF2A 3M9AA 1U5TB 1EV7A 1USTA 2ISYA 1W5TA 5KK1A 1B4AA 5CDLA 2GU5A 3KFWX 3GFJA 2J5OA 1H9TA 1FP1D 3TO9A 2PQ8A 3KCCA 3I53A 3TGNA 3T5XA 3DXJF 1ON1A 1J0RA 2WV0A 1C27A 3H92A 1QXZA 4EJTA 4OMZA 3C18A 3C7JA 1ZREA 2ZFWA 1LEAA 1YW8A 1XNZA 3FWEA 3FMRA 1GXPA 3ZMSA 2W85A 3M7GA 5D5XB 1FNNA 2RV8A 2P5LC 2ZJ2A 4IJAA 5D6FA 3ZQ7A 5D4SA 3KP2A 3M8FA 2JPBA 1Z05A 2VBXA 1BJAA 4QR8A 2EB7A 5DYMA 2RN7A 4BXUA 1KA8A 2M87A 5HDKA 3GXOA 4KICA 1LNWA 3CB6A 1Y0UA 5E5BA 3M8EA 4BH9A 1R1UA 4O5VA 1VTNC 2QLZA 3ELKA 2Q96A 2NYXA 4JUQA 1TW2A 4XRFA 4BHCA 1FY7A 4JK1X 2EVOA 4K2EA 3EDPA 1SFUA 2BEOA 3LA2A 3T1BA 4A0ZA 5E1ZB 5H6QA 1SD6A 2TDXA 4B09A 4I0BA 4KT5C 5FCHA 2VE8A 4EVIA 2DK5A 1V3FA 1JHHA 3WTVC 2AS5F 5CVRA 2RDPA 2QBYA 2MLGA 3MZHA 4KN4X 4E70A 4Q48A 2GXGA 4U6WA 3T0YA 1PV9A 1YQAA 3F8FA 3RKXA 4U7BA 4CXFA 3IKVA 3WGHA 1TNSA 3NQOA 1B1BA 2FA5A 2EFOA 1XSXA 1LDKB 2KIFA 4BHPA 3V8LA 4RB3C 2PI0A 2BHAA 2P5VA 1MGTA 1RIOH 4B28A 2RC4A 1REPC 1U5TA 2CGPA 2EK5A 1RI7A 3WGIA 1MJBA 2GIVA 3HRSA 3F6OA 2VC1A 2LSOA 2BGCA 3BWGA 3QAHA 1YG2A 1ZRFA 3WTUC 2A5YB 1FYLA 2HQNA 2W24A 2F5CA 4R8HA 2EFNA 3TAVA 1SAXA 3PKCA 3GUDA 3ERED 2QVOA 1UCRA 2IJLA 3HIFA 2K02A 2ZCWA 1R36A 1XCVA 1HBXG 1MZBA 3EETA 4G6DA 2G6PA 3FMQA 1CGPA 2D1HA 1G3SA 1QXYA 1I1GA 3QPHA 3KEOA 5CIKA 2R3SA 2HZTA 3CJNA 5D5WB 1STZA 3GO5A 1C21A 4LMYA 3GEZA 4JQFA 4U70A 2HKXA 5BPDA 3CB5A 3R61A 4U6ZA 1ZG5A 1XD7A 3L2CA 1SMYF 2FBKA 4LLGF 2Y48A 4FLKA 4AD9A 4L9VA 4CYDA 1R00A 2LNBA 4HLYA 5JFRA 4RZZA 4HZFA 4EGYA 2HYGD 1G4DA 1Z6TA 3RYPA 2F5DA 4UUVA 5CJ9A 1O3TA 5D5VB 1OKRA 4IRGA 4P9FA 3GFLA 3I58A 4L0ZB 4M6XA 4CGZA 1UB9A 5FFZA 1BIAA 4Z7MA 1FZPB 4IF7A 4BYYA 2BWWA 2BBYA 3GFMA 3J80K 2XROA 3R0JA 5EEGA 1T0FA 4U0VA 3FHZA 1FC3A 2LKPA 3WU0A 2DPDA 3CUOA 2Q92A 3J7AO 2A68F 3WU1B 1YO5C 2IW2A 5ILVA 4WF2A 4UV8A 1JE8A 1SFEA 1YFHA 4G7OF 2PBIA 5HDGA 2OD5A 1XMAA 2H94A 1DPRA 3WTXC 2FXAA 1FOKA 4XLPF 4CO8A 1PDNC 3WE3A 4OMYA 1HKTA 2OBPA 2Q93A 2Z9OA 2FE3A 4R60A 4FKCA 3RDIA 2HKOA 2VBYA 2PFBA 2QUFA 3T8RA 5BOXA 4RGXA 4UNOA 4XBFA 2F5FA 1HQCA 3IKTA 1IN5A 5JVTA 1ZHFA 2V1UA 5BPIA 3ZPLA 3PKEA 1ZYRF 4B8XA 2EVCA 1CF7B 4S01A 3BOQA 2K4JA 1KU2A 1R7JA 4I0AA 1V4RA 5FD6A 3K0LA 1I6XA 1C22A 2K4BA 4IVNA 1J75A 3D27A 1J5YA 5DCMB 4G7ZF 3J81K 4IRIA 5HLGA 3QP6A 1UHWA 2MC3A 2GGCA 1JAWA 5D8KB 4U69A 3F23A 2LF7A 2BWYA 1FX7A 2GG7A 3BROA 2EA2A 1SMTA 2GU7A 4PNCA 1R5HA 2DQLA 3HSEA 3HSFA 1WKMA 4BAYA 2CYYA 4P5OA 2BHDA 4CHUA 2V3XA 3U2RA 5ED4A 4KFCA 4S04A 2ZO4A 1T38A 3CO6C 1YJ3A 1KQ0A 5LGNA 2UXXA 3HOSA 4L9JA 2DPUA 1X3UA 1P6RA 2G9WA 3I0TA 5L3DA 1IXCA 3ECHA 2CG4A 3DP7A 1FBQA 4EM0B 4S00A 1GHCA 2P9AA 2ZNYA 2M1BA 2IP2A 4IKRA 2A61A 2XIGA 1TTYA 2FQ3A 3JAMK 3ISPA 1J59A 5JR3A 1JXSA 1A16A 1DP7P 1YTYA 2RVCA 1TW3A 2FBHA 4ENKA 3RPUA 2UXNA 4QLCU 4PDKA 4S2TP 1IN7A 3JW4A 1Q1HA 3DPTA 4H0EA 2WC2A 3CTAA 5HOOA 4U6CA 2HS5A 4ZWPA 2YSRA 3COAC 4IF4A 3ML6A 1P4AA 1T39A 2QYOA 1ZGJA 2VE9A 1C0WA 1W7PD 3IWFA 2ZXJA 1FT9A 3GZ6A 4Z2YA 1CHMA 1H0MA 2M5WA 5DDGA 2GGBA 3Q6DA 4M9SA 3AAFA 4HDUA 5IT9K 3CLOA 2GU4A 2NAZA 1RUOA 5CDEA 5ICGA 3MEXA 3HRMA 3LQRA 2FMYA 1XGOA 5DCMA 1B9NA 3HTSB 3E6DA 3BJOA 2P8TA 2BWXA 4KIBA 3KE2A 1R1VA 3OOPA 4LGWA 1PP7U 5E1WA 4YFXF 4NHJA 3TDUC 1J9IA 3WTTC 4MEYF 5LRSA 1PP8F 2Z33A 3GYHX 4YIFA 3DPLC 2VBWA 5HLIA 3FXRA 3RPQA 1QZZA 3FMSA 4HX7A 4L9NA 1U2WA 4ESFA 3E5QA 1MATA 2V1XA 3I54A 4ZYEA 4R79A 4Q4ZF 3JTGA 4LK1F 4UVCA 4NQWA 5DV5A 1MJAA 3K2ZA 3RORA 3LSTA 3KEQA 1Z91A 5LLQA 1YS6A 1WI9A 5ILUA 1HKSA 5D8LB 2RQPA 4XSXF 4HOBA 2GZ5A 2BB7A 2D1VA 3PQJA 1DDNA 2FNAA 1B6AA 4AIHA 1KQ9A 3CUQC 4F7ZA 4A12A 3E5XA 1S7AA 2GTXA 1TLHB 1S8NA 4LJZF 1IW7F 5CE6A 2PEXA 3O6BB 3E6MA 5F6FA 1I27A 3GVAA 5CVIA 3P9KA 4FHTA 5LEKA 1G3YA 3RTRA 4ZZDA 2K27A 4UVAA 5IT9Z 3EUHA 3CUQA 3TB5A 1WWXA 5HVQC 1IXRC 1XSVA 1XCBA 4HA8A 3SFZA 3IG4A 1LQ1A 2KJCA 1L3LA 1EH6A 3V8JA 3K69A 4LB5A 5LGUA 2B3KA 4U71A 1A04A 4I09A 1IZ1A 1S7OA 1B59A 5E20A 2JPCA 2L02A 4WX9A 3LAJA 6PAXA 3SXYA 3LA7A 1AOYA 1ZLKA 2GAUA 3D5LA 1JHFA 3BIQA 3HHHA 4Y13A 1FYMA 4ENMA 4IXAA 5ICEA 5CVVA 4ETSA 4PCQA 3RKWA 3E6CC 1R58A 2DI3A 1U5TC 5ERIA 1WL9A 4U75A 1HSJA 4UV9A 3V7RA 3ZMDA 3QOPA 3EQLF 2O3FA 2Q8KA 4QWQA 4PZJA 3U1DA 2XVCA 3RIRA 2FU4A 1QXWA 4EJWA 5L3CA 3TQNA 4G94A 4KYWA 4U73A 2EJRA 5E1XA 2PLYA 3EYYA 1E17A 4BQAA 5CLSA 4HLXA 1FPQA 2OZUA 1MDMB 3RKYA 2MH9A 4A6DA 2DBBA 5CVJA 2PJPA 5LRRA 4I01A 3F22A 5AIPA 3L00A 2GXBA 5E17F 4L9TA 5JI6A 5LEJA 3TO7A 2H6BA 1YW9A 5LHIA 3W6JB 1E2XA 4WWCA 1D8JA 4G7HF 4IHTA 1OYWA 2FOKA 2V9VA 1BC8C 3F21A 4MQVA 4U6EA 1FBUA 4KUMA 4PV4A 2A07F 1D8KA 3FM5A 4N9IA 3E5UA 2XHKA 1AWCA 4WK8F 2YX4A 3V8KA 2EFWA 5H6RA 4GO1A 3FZVA 1XGSA 4A6WA 3IU7A 2JSCA 3ZN0A 5F1RA 3F8BA 1ZARA 4EJOA 3WODF 4LD5A 3HYIA 3JSOA 2UWMA 2XKPA 3T8TA 2DW4A
chains in the Genus database with same CATH superfamily
1LB2A 2DQRA 2DFEA 2BH3A 1ORKA 2VKEA 2YR2A 1W4MA 2ZMEB 2L4AA 2IA0A 3BITA 2RKHA 2MABA 4AVPA 1BA5A 2R7SA 4ZYHA 1G3TA 1MW7A 3RI4A 4CCKA 3QU6A 4RB2C 2XGXA 3KP6A 2MG4A 3JRFA 2DOEA 3OS0A 3IRQA 1W36D 5ILSA 3K7AJ 5EGOA 2BN7A 2QQAA 4I7HA 3QODA 3IU8A 1T0FC 1N75A 4I98B 3GFIA 3CTZA 5HS9A 1ITYA 2FSWA 3CC4I 3FXKA 1A5JA 2HOSA 2R5ZB 3LSHA 2CSOA 3K9TA 5CQGA 1WJ5A 4GGGA 3BTJA 5LGTA 2PJRA 2Z99A 3K1NA 2LP0A 5FKMA 2CWEA 2KKOA 2RNJA 3G6EI 4KA4A 4BDYA 1LJ9A 3ZQIA 1FSHA 1S3JA 2KIUA 3CCEI 2H09A 1MH3A 2Q0OA 4IZZA 1UFMA 1VQ9I 3IC7A 2QKLB 4BHBA 3CO7C 4AIKA 1IF1A 2P7CB 4M72A 2BWUA 1H89C 4CA0A 1IG7A 3ZP5A 5F64A 4Q5SF 1XMXA 3HOXJ 4XSZF 2E71A 5IPAA 2L9NA 4IECA 3CQZJ 4JP0A 3CCSI 5EDNA 4RGRA 1LDDA 1Y39A 5BNGA 2VODA 1YJWI 2VOOA 2KIMA 3MZ8A 5EG0A 3OYJA 1LEBA 5B1AH 4BJ5C 2JMWA 4ZYDA 3CCYA 2IVMA 4X1EA 4BEHB 1ETXA 2WAQN 2VBZA 4JX6A 3DFGA 4A6EA 3G73A 1VQ8I 4BKXA 3AG4H 3R0AA 4P96A 4C3IJ 3ZMUA 2Q2EA 3KPHA 2X6OA 2HOEA 4Y33A 1ZRDA 2HDDA 2CUJA 3SJMA 3K4LA 3ZRGA 3CLQA 4E4HA 5EF6A 3MMYB 5BMZA 1DUXC 2L54A 1BC7C 4EATA 1VQ4I 5IOYA 2OKNA 2IA2A 2A69F 3U21A 3HRTA 2FEZA 1T56A 3VYRB 1R9TJ 2OJED 4E6KG 4RAZA 3MFKA 2HVRA 3QOEA 1OYYA 3BT9A 1GXQA 3KP4A 1LDJA 5ICFA 4DW6A 1TWCJ 3JRCA 4XLEA 2EIKH 2XF6A 1UAAA 2PX9A 3PO2J 4BXXJ 2Y2ZA 4UB6C 3CP8A 4CSWA 4E7LA 2ZSGA 2EBIA 4CCNA 4MLOA 1MBGA 4A3BJ 4S05A 3VFZA 3EPZA 2HTJA 1DPUA 3PFIA 4Y7NJ 4HV5A 4OIQF 3RVAA 2K3FA 1OCRH 3HKZN 2Z16A 4OINF 2V6EA 2PG4A 3LSIA 5LHGA 2P99A 5JHUA 2LBFB 2ZSHB 2R7XA 4RGUA 2A5WA 2JSPA 4IKSA 1WQ2A 3LL7A 1WVRA 2V7FA 1QHHD 2WTEA 4RAFA 3S17J 3KETA 1MBJA 1W5SA 4Y15A 2MC4A 3LAPA 2GA2A 4B3AA 2UZKA 1V55H 1OJLA 2E36A 3P9IA 1MH4A 1Z1DA 4M3GA 4HF1A 4L5IA 3H5AA 4RGSA 2R7DA 1VQ7I 5L3FA 3CCUI 4U1BA 1F1ZA 2DLLA 4HNTA 3ABTA 3SZPA 2VUMJ 3REOA 2XAHA 3MKYB 4ZDPA 1X1AA 1WCMJ 2EH3A 3TKYA 2F6CA 2M9HA 3W3CA 1X2MA 4YG2F 4X0GA 2GG3A 1OFCX 1ZG1A 4AWXB 5E8GA 3DF8A 2HYFA 3OYAA 3GZNB 3E0JB 5L3EA 3K4MA 4DNCA 2VJIA 2NRAC 3N05A 2M8EA 5M5YJ 4NB5A 2LMDA 3DCFA 4GXOA 3LMMA 2X4HA 3CDHA 2BWTA 2ETHA 3CF5F 2JT1A 1K78B 1Q1VA 3GLXA 2EV0A 2DA5A 1QQIA 1O3QA 2MA3A 4PUSA 2DJIA 1HF0A 1GVDA 4CZZA 3J80Z 3OS1A 2QQBA 3JCUC 1BI2A 2H1KA 5DS9A 3S2HJ 3Q9VA 1O57A 4OOIA 1SVLA 1DGWY 2WY8Q 2R7UA 2F4OB 1Z7UA 3IHUA 1PUEE 2R5ZA 1O7FA 5FKKA 5AIQA 1SD7A 1QPMA 2NNNA 2XAGA 3PQKA 1YVMA 3SEQA 2CV2A 4ITVA 3DBHB 3KEYA 2LG4A 2X51A 4GFBA 1KYZA 3G2BA 1TP4A 5FLMJ 3FXUA 2GG9A 5FLXK 3LSKA 2HDWA 3HC7A 1QZEA 2QQ9A 4DJAA 5FFXA 1W0UA 2E1NA 3G1MA 2HTSA 2EVMA 4IRHA 4ZH4F 4GCVA 2LKXA 2YPRA 1D0YA 2X9DA 3ERMA 4AIJA 2LTPA 2DFIA 3IWZA 2ELKA 1WGXA 2L5QA 2KQRA 1WL6A 3FIWA 2CS3A 3PKAA 5FKOA 2QA4I 2C6YA 2DYRH 4WXCA 2O6GE 4KDPA 4A3JJ 4EGEA 4BEHA 4FX0A 1V54H 3CP2A 1OCTC 3EYIA 1R5ID 3OYCA 1WJAA 4N0BA 4E7ZA 2CQKA 2IA1A 1OQYA 1U6GA 2P6SA 3HUGA 2L3DA 4RB1A 1A6IA 3S16J 2COMA 4RS8A 4F92B 3L09A 4XLAA 1P2FA 3VOEA 4U0YA 4ZWOA 4EQQA 3ZMVA 2WB1A 4NC6A 1BN5A 4A3EJ 2NQ7A 5DTDA 4MATA 4U0WA 3K10A 1X1PA 3I5UA 3I4PA 3PKDA 3ABLH 1JUPA 1OCPA 1BIBA 3KLOA 4A6VA 1USSA 4MTDA 4MNUA 4CCLA 2P7VB 4A5NA 1NG7A 2ZKZA 1UELB 2XAQA 3NARA 2BE5F 3MD2A 1C24A 3KZYA 4U87A 2FF4A 3TBIA 1VQMI 4A3DJ 1YLFA 1IJWC 1YW7A 3LSRA 2IGNA 3BJAA 4RAGA 2FMLA 3AL0B 2DOFA 3O2PE 5FGMA 1IUFA 3L7WA 3SDBA 3DU6A 1XG1A 3PIPF 2L7ZA 2K85A 1MMNA 2E2JJ 2FBIA 1FBSA 3HPHA 4JX4A 5F0HA 2BHYA 3S2WA 2VT3A 4JYKA 1RPWA 1FWZA 3PSIA 2R7FA 3BR0A 3GW2A 3MCZA 1MBEA 2CMPA 4IOAF 3N4MA 4YFNF 1IGNA 1HSTA 2NVXJ 3J81Z 1OPCA 3LFKA 1HLVA 1RNLA 2NXNB 2O0YA 2KRHA 4N4OB 1JT0A 4IPAA 1J2XA 4KMUX 4FE4A 1CF7A 3MKLA 2EWNA 1VNDA 3RJPA 3K4CA 1A36A 2V3ZA 2GA1A 4MIMA 4HW0A 3F8MA 2CO5A 3MR1A 3W2WA 3PFYA 3HZJA 3G1LA 3IUOA 4KT6A 3BY6A 3W2AA 2VI6A 2E1OA 2DA4A 3RSNA 2W48A 1SAUA 5DM7F 3ZMTA 4EGZA 4BL0B 1K78A 2KRCA 3CC2I 5L3BA 1UG2A 1W2MA 2GG2A 5FLXZ 5HODA 4MEXF 2CUZA 4XLFA 2NVYJ 1WH7A 2W00A 3H3ZA 3VB2A 4M9XA 1X19A 4MTEA 4WCGA 3C1DA 4X6AJ 1U78A 2MBFA 1Z3XA 1IO2A 4CYCB 4ZWUA 2GG5A 2NQ6A 3VDXA 5J8CA 4FISA 5CVUA 3HB9A 3E3VA 2K7LA 4IEJA 5GPCA 2RNGA 1HW2A 2E7XA 1FYKA 3CDIA 2NOJB 1FOXA 2P4WA 2XASA 2FNPA 2ZBKA 4F55A 2LY2A 4LK0F 1E3HA 1MJ9A 2XC7A 3VYTB 3TOBA 4J19A 2ADUA 2Y31A 3OYMA 1TWAJ 5D6EA 1PJRA 1F5TA 1I1SA 4OIOF 2HWVA 4Y3OA 4LLLA 1E3PA 5BS6A 2KHMA 3ZR8X 4PGGA 4E7SA 2DDAA 4UVBA 3BPXA 2KPMA 4PJ0C 5HNHA 2GBYA 3BR2A 3L2QA 1NHAA 3M8JA 2L2OA 3H9QA 1VZ0A 3B73A 3KP3A 4WXHA 4BJ6C 1O3SA 2GLOA 1BM9A 4HX8A 3K70C 1RZ4A 4HF0A 2VQLA 4DOZA 3AG2H 4O3MA 2R4GA 2BWVA 3JAMZ 2G7HA 5K5QA 4RB0A 3HOTA 4OIPF 1D1AA 1C23A 2V79A 1KP0A 2XPWA 4IX7A 5K7FA 5FROA 2LY9A 4FUKA 2HI3A 4HPQA 3TP3A 4XLNF 3CJTB 2H27A 1ACIA 1S29A 4DQ2A 4ZYAA 2G0EA 1W0TA 2JA2A 3MKZA 1MKMA 1LPQA 3A2KA 4RAYA 4A5MA 3G4SI 3GTMJ 3DKWA 3BPVA 1ETYA 2IXSA 3EUHC 4KNYA 1XB4A 2EQRA 4PJNA 3BP8A 2M45A 4TV7A 4AYBN 3GF2A 1WZ2A 2O8KA 3CJQB 1P92A 5DEQA 3S6BA 3NRVA 3A02A 4UY8I 5GAHJ 1EKEA 1LVAA 2A6HF 2OZ6A 2QQ8A 4A0XA 1Y0NA 1TQMA 4LFUA 4YELA 3VODA 4C2MJ 5HS8A 3OIOA 4J00A 3RZOJ 1D3YA 3HSRA 3MAJA 2BWSA 3CF2A 2RGVA 4LIUA 4HNUA 2EFPA 1JUSA 2XKOA 4IHSA 2CW7A 3W6KB 1VQKI 3PO3J 2L0KA 2IGKA 5J1YA 4LOCA 2CJJA 2EV6A 4F91B 2B3LA 4Y4RA 3OL4A 2ISZA 1ZLJA 5DUIA 3BR3A 2LF8A 1YIOA 3D0SA 2O61A 3ULQB 5K5OA 1XX5A 3LSPA 3K1MA 2QEXI 5CKTA 3MZYA 3R60A 2L9SA 4C9YA 1R1TA 2JRTA 3OYKA 2MLKA 2VIXA 2CUEA 2E2IJ 1KU9A 2E7WA 3F6VA 4ESBA 1ETKA 2Y9ZA 4HV6A 2P6TA 4G8XA 3TO6A 3KZIC 3A01B 5D5UB 2DMQA 4FX4A 1W7PB 3RZDJ 1U8BA 1XC5A 5LBQA 1MBFA 2L7FP 3I59B 5GAGJ 1MD0A 4XKWA 2E60A 4ENJA 2IS2A 2X48A 1Z3YA 1BI0A 3TP0A 1ONVA 1ODDA 4D5FA 4C2TA 1O7LA 3KP7A 3P5JA 1YS7A 2QGUA 3ZCOA 2DCEA 3PKBA 3SZTA 3ZN1A 3OYFA 2Y0MA 2BY0A 1U9NA 1KU7A 1ENHA 1X2NA 4XRSG 2VONA 2DMNA 4CYCA 3DEWA 5E79C 2M2EA 3KZZA 3BTIA 4HSTA 1RKTA 4M6YA 3VPRA 1RUNA 2ZFUA 2XAJA 2COBA 1JI8A 1XMKA 4ESJA 4ZYGA 2A3SA 2L01A 3RYRA 2BHBA 1X1CA 3DQVC 1YRNB 2J5PA 2CFXA 2IS4A 1LFUP 1KONA 2DT6A 5HS7A 1LVKA 2H6CA 4GYGA 1D0XA 1T6SA 2DDBA 1ZGAA 3C2BA 1A31A 3VYSB 1Y6IA 3E97A 3OV8A 4XN0A 2VL8A 1R22A 2MSYA 2PN6A 4CICA 3KIOA 3L2RA 1Y1NA 2HOAA 4LB6B 3WTYC 1BI1A 1XDUA 2DA2A 2YU3A 2ID6A 2OTJI 3GTOJ 2EFQA 4EV0A 3R6SA 1WRJA 2JA8J 3BJ6A 2BW3B 4G12A 3HHGA 2P5KA 1R4NB 3J7AY 3IRRA 2W25A 2CQQA 1SD4A 4MGRA 2BY2A 1D1CA 2VKVA 4O6JA 3OYHA 1W7VA 4BJTA 3PUBA 3CCRI 1J7KA 5FKNA 1OISA 4XRMA 3KP5A 2V3YA 1TQIA 2FQ4A 1MMDA 5DD8A 4XK4A 1YX3A 4XR6A 2BV6A 4NUBA 4HSRA 5H20A 1SEUA 5FO5A 1XN7A 3BR5A 2FRHA 1JTYA 5BQTA 1VQ5I 1NK2P 4LG0B 3IU9A 4KISA 2JZYA 1MBHA 2HNHA 3RPUD 5GAEJ 1ZRCA 2PMUA 1XGMA 5DUKA 1QU3A 1WBQA 2W57A 2R0QC 1QPIA 5B3SH 3S1NJ 5CQEA 4M3EA 4RBOA 4FLJA 3HGGA 1CQTA 3A1YA 4GYIA 4IQ4A 1MBKA 3FBIB 2MD5A 1D5YA 2NS0A 1L0OC 5DCFA 2EZKA 1A35A 1WHUA 2HR3A 4U7DA 1QZYA 5HNFA 4OAZA 1TWGJ 1ZG3A 2DT5A 3NAUA 2F2EA 2EZIA 4RMNA 3DKXA 1PVEA 3K2AA 3CCVI 3HTUA 4WXDA 5J1RA 4S2RP 3Q0UA 3OIPA 3JR9A 3G71I 4U88A 1F4KA 3WTZA 3FXQA 5GPAA 4HBLA 2EINH 5KVRA 3H9JA 2XV4S 2ZSIB 2BY3A 1BI3A 2XRNA 4IU6A 2DT7B 2VT2A 2WA0A 2WWYA 3JSPA 5FCFA 2ZJPF 3OYLA 3K4JA 4M73A 4PFOA 1IN8A 5TRDA 2DN0A 3A01A 3PIOF 4E7JA 4PGHA 1W7PA 1KYWA 1JGSA 1EH8A 1UZCA 2V6CA 1R23A 3I59A 3K6GA 2AXTC 1P7JA 1NH3A 2ECCA 2JJ7A 4HDVA 3E1SA 2GU6A 2KP6A 3GCMA 2JA7J 5FB2A 3F8CA 3QU3A 2NNYA 5K1YA 1QHGA 2RQQA 2QWWA 2Q1ZB 2O03A 4FT8A 4OIRF 3N97A 1TC3C 2V1NA 2BYVE 3LWFA 1I5ZA 1BBYA 1QGPA 4KM3A 2PMHA 4ZTFA 1ULYA 1D5VA 1WN1A 4A3KJ 3F3XA 3P7NA 2BHZA 3HGYA 1ZR2A 2W84A 2HYJA 2DAOA 2XGDA 4NDLA 2FD5A 3K1PA 1IAWA 2ZJRF 4DZPA 1BR1A 2X1DA 1YE9A 5A2QK 1S9HA 4G9YA 2Z5UA 3SHFA 1B72A 2GG8A 2CW8A 2MATA 2KZVA 4B4CA 2M0CA 2HFHA 2EIJH 3C3WA 3FXLA 2NVQJ 1IUYA 1O3RA 1FOYA 4DYCA 3SQNA 4BQNA 2QCOA 4OOKA 4UXNA 2V1DA 3KYDB 3CD6I 3DEEA 2JA6J 3QRFF 4FO7A 2KFDA 3KLNA 5CDVA 2K9SA 4CH7A 2UUZA 5IT3A 2GM4A 1HKQA 4IQJA 2AXLA 3ESWB 1Z9CA 1OMIA 1EH7A 1I3AA 4DYQA 4KN7X 4I2OA 1XGNA 5GTHC 3O3KA 4ZNGA 1MDMA 2PMZA 2P98A 3V4GA 3CZ6A 3DV8A 1FEXA 1FMWA 1T98A 1FLIA 1WSUA 4YRVA 1YYVA 4UHTA 1MSFC 1FTTA 2LDUA 4HQEA 2LOOA 4UUTA 5F08A 3LQQA 4PFPA 3L24A 4IDYA 1WJEA 1W5CC 2HVQA 1EJ9A 4IKUA 4KMFA 1FJLA 3PNVA 1FIAA 2GQQA 3F72A 5AONA 1BOAA 1Z77A 1D0ZA 3K70D 1FP2A 4YEJA 4I6ZA 4ZDOA 2LD5A 4BQQA 4Y17A 2BXYA 2EA4A 2K40A 1WJFA 2VKHA 3HEFA 4U6JA 2XAFA 4BBSJ 4LG0A 2IW5A 2O5RA 3TL4X 4EM1A 2DK8A 5FD5A 4KJZA 4MHGA 3WU2C 3BCBA 4LG3A 2ACJA 4JBAA 1M35A 1FOWA 3BZCA 3V7CA 1AU7A 1IN4A 2DU9A 2M30A 5KNLA 2D5VA 3LSMA 4XOTA 1K7AA 3L2UA 1KU3A 4XKBA 5J8FA 2HEOA 4UB8C 2HOWA 2OQGA 2STWA 4HXXA 2QM3A 1IDYA 3G1OA 3GTJJ 1YHQI 1M1EB 3IL2A 1HW5A 1FMVA 4BE1A 2OV7A 5D4RA 4F3QA 5GTIC 5EZGA 1OCCH 2ESNA 3VEPA 2HQ5A 3DU5A 2OF7A 2Y0SA 3SFIA 1IRFA 2KLOA 2XRLA 4A2UA 2GWRA 2Y69H 4ZZLA 4XNFA 2ZNZA 2OA4A 2VOPA 4A3MJ 1AKHB 3ZMZA 3O8HA 4CUGA 4GDFA 4I99C 4W97A 3B02A 2VASA 2ZMEA 1I6HJ 3ZOBA 3Q5FA 3FK7A 2CQNA 2HDCA 2CH0A 3WTWC 2W7NA 2O9LA 3H5NA 1R5GA 4CDGA 2IT0A 3NEUA 4PJLA 2OAZA 3ROUA 1KGSA 1JUMA 2NS8A 4P9UA 5A2QZ 3BR6A 1KQ8A 2KDZA 2VN2A 4BBRJ 2V26A 4M3FA 2P81A 4ZC3A 1WJDA 4P1WA 1ZH5A 1SD5A 1X1DA 4BY1J 4G6TB 5CYVA 5K5RA 2X1EA 1TQPA 1BOBA 3H0GJ 3LA3A 5TGTA 1N51A 2HPMA 4E7HA 1WH5A 1UG0A 2XUBA 2D2WA 2RAEA 4YFKF 2O8XA 1G6NA 4EJVA 2EPFA 1QNTA 5J6XA 1K4TA 1T2KA 2IRFG 4N9HA 5GADJ 1OYIA 4ASNA 2XDVA 3TOAA 3ABKH 4E7KA 5M3FJ 2KDOA 3WTSC 5FJ8J 1QVTA 1BL0A 3HG9A 5EEHA 4EMSA 5EJCA 2VC0A 4RZYA 3PNYA 3QP5A 5LHHA 2KRFA 4HYEA 2JTVA 3WG9A 1B9MA 1UHMA 2ME0A 4FO8A 2EZLA 2VJ5A 4MO7A 3H9GA 4EM2A 1GVJA 3BIPA 3BG9A 5TJJA 1O0XA 1P4XA 3V7SA 1Z67A 2IPQX 3E6BA 3IH4A 2A6EF 2L7KA 4FQGA 2MGQA 2Y75A 2ICWG 4NNJA 5F27A 1WY2A 3QYFA 2F5EA 4M3BA 4RGZ1 3QPTA 5HLHA 2WAQA 3FM3A 2F4IA 2WAEA 2TRTA 4N4NB 1JKQC 4M9ZA 3QPLA 3PJRA 1UMQA 4RM2A 2CW0F 2K86A 3Q9SA 4NQWB 3TDZC 3KYLA 3BZ6A 2CQXA 3CMMA 3R4KA 5B1BH 3WE2A 3J7YJ 2XAUA 3NWTA 3L9FA 3ABUA 3UR3C 4XM3A 4HEA2 1QO0D 3G3ZA 2E1CA 3CMEI 1ON2A 2AO9A 3I71A 1YIJI 1N25A 1QRYA 2N8GA 1K79A 2LVSA 2GZWA 2STTA 2QZ8A 3I64A 4KIGA 2XSDC 1IRGA 4HX4A 2Q95A 4Q47A 2LBFA 1ETOA 3DEUA 3GZ5A 5E8IA 5J4YA 2HQRA 2VKDA 4BE2A 2L4MA 2HPIA 3BLYA 3H3UA 4BQOA 4DIQA 3DTIA 1RRJA 2JWTA 3A4CA 5KAIC 3IAS2 2HGCA 1YITI 3WGGA 1LUJB 2OU2A 2JUGA 5HDNA 1ERDA 5IP7J 4ON0A 1IN6A 2R93J 1O4XA 3HKZA 2DTRA 1K6OA 1Z6RA 4LLNA 3KYCB 3Q3SA 3L7GA 2EV5A 2B3HA 3F8NA 5L3GA 3DWLE 1QBJA 3CUQB 3OS2A 2KT0A 2B0LA 2TCTA 1AKHA 4DZJA 1F9NA 5DD4A 2G7UA 4I02A 1XSDA 5IP6A 1LFBA 3GWZA 3GLLA 1H9GA 2L9VA 1XDSA 2DMUA 2WY7Q 3FISA 4ANJA 4YIIA 1DP3A 1U8RA 1ZN2A 5J40A 1OR7A 1PUFB 5KHDA 4ENNA 2ESHA 5CNXA 4EJUA 2ELHA 3M07A 5EEAA 4R1HA 2GG0A 2Q94A 3NWSA 2QENA 4UUSB 4L5JA 2MH2A 2VQGA 3BDDA 1JJ6C 2H8RA 3FF5A 3DBRB 4G6QA 4OWRB 2BHCA 3MATA 1P4WA 4V2GA 4D0PA 3OYGA 3GX4X 4BGDA 3FX3A 1R4MB 1TNTA 2KJBA 3DKYA 5ICCA 4DBQA 2OPTA 4OU0A 3VSKA 4M71A 4L0YB 1Y8RB 2OQRA 3I4MJ 4HQMA 1HXDA 5CPRB 2O7OA 4P55A 3K4BA 2D45A 4OAYA 4FE7A 4MQ9F 3S14J 2VXZA 4A0YA 1IXSB 1LKXA 2QF7A 3MQ0A 1P7IA 1U3EM 2QBYB 3B6AA 4XRSA 4M74A 2ZJQF 1TBXA 2YX7A 1ZAOA 2RREA 3M1EA 3L2VA 3U9GA 1WLRA 2LREA 3GMEA 4KIFA 4IKTA 2H8WA 1X3WB 5E18F 1SFXA 1HW1A 4BNCA 3WHBA 5DM6F 1FSEA 2XF7A 3JTHA 2Z3YA 3MX6A 4AIDA 3P9CA 1G8XA 3FXMA 3F9KA 3HRUA 1G3WA 4QPQA 4Z6YA 4FLIA 4U76A 2FOWA 2X0LA 3CESA 3BCAA 4AC0A 2DO7A 4B3XA 3MWMA 3ECOA 4HAMA 1HDPA 3ASNH 1YI2I 4FLLA 4FTHA 2EILH 1NTCA 2CV1A 2X1CA 4L18B 2NVTJ 1ZTRA 1S6LA 2WBMA 4HF2A 3MN2A 2R7TA 3M9AA 1S5LC 1U5TB 3AL0C 1DQUA 1EV7A 1U0JA 2AHQA 1AHDP 3TEDA 2E2HJ 1RC9A 1USTA 2ISYA 1APLC 2VPLA 3QWLA 1W5TA 5KK1A 1U9OA 4NC7A 1B4AA 2ZXHA 5CDLA 2DXIA 5E3OA 1E0EA 2HOTA 2GU5A 3KFWX 4NBQA 3GFJA 2J5OA 2P0WA 3A03A 3KX2A 1H9TA 1FP1D 3TO9A 2PQ8A 3JREA 3KCCA 3I53A 3IH3A 3TGNA 3T5XA 3DXJF 4EEFG 4Y52J 1ON1A 4L5EA 3HL2A 1J0RA 2CQ7A 2WV0A 1LFPA 2XGEA 1C27A 3H92A 3GTKJ 1EA3A 4EJTA 3HBLA 1QXZA 2VJ4A 4OMZA 3C18A 1MNMC 4A3GJ 3C7JA 1ZREA 2ZFWA 1LEAA 1YW8A 1XNZA 3FWEA 3FMRA 1GXPA 2ELJA 3ZMSA 2W85A 3M7GA 3H35A 5D5XB 1FNNA 2RV8A 4NC8A 2DA3A 2ZJ2A 4IJAA 5D6FA 3ZQ7A 2P5LC 1B8IB 5D4SA 5FRMA 3HOVJ 2VQCA 3KP2A 3M8FA 2YU9J 2JPBA 3ZQQA 1Z05A 4YIRX 2VBXA 3FXOA 1BJAA 2MFZA 4QR8A 3DPUA 2EB7A 5DYMA 4BUPA 2RN7A 4BXUA 1KA8A 2M87A 1BW6A 5HDKA 3GXOA 1X58A 4KICA 1LNWA 2E19A 3CB6A 1Y0UA 2E1MB 4ABZA 2FJ1A 5E5BA 5FKLA 2JVHA 3H0DA 2V9KA 3M8EA 4BH9A 2HXIA 1R1UA 5J3LA 4DGWB 4O5VA 3DTEA 1VTNC 2QLZA 3BG3A 1V5EA 3ELKA 1PUFA 2Q96A 2NYXA 3D5RC 2B9SA 2WADA 4JUQA 2E35A 1TW2A 4XRFA 3S32A 4BHCA 1FY7A 4JK1X 2EVOA 4K2EA 4XIDA 3EDPA 3OYIA 1SFUA 2BEOA 1TT0A 1DU0A 2CUFA 3LA2A 3T1BA 4A0ZA 5E1ZB 2R7OA 4RLQA 2DMPA 5H6QA 1SD6A 1T33A 2TDXA 4B09A 4IHXA 4I0BA 4KT5C 5FCHA 2VE8A 4EVIA 2DK5A 2W82A 1V3FA 3BG7A 3M4OJ 2EIMH 1JHHA 3ZQFA 3WTVC 2AS5F 5CVRA 2RDPA 2QBYA 2MLGA 1RR7A 1SANA 3MZHA 5J47A 4KN4X 5E3MA 3UNGC 4E70A 4Q48A 5FRNA 1TZLA 3D5SC 5FLVA 2GXGA 4U6WA 3T0YA 5IYBJ 1PV9A 1YQAA 3F8FA 5HLTA 1AA7A 3RKXA 1WPKA 2K9LA 1POGA 4U7BA 4CXFA 1WJBA 3IKVA 3K4NA 3WGHA 1XS9A 1TNSA 2I8DA 3I55I 2V9PA 3NQOA 2DYSH 1B1BA 2FA5A 2EFOA 1XSXA 3TW6A 4IHVA 1ZK8A 4C3HJ 2JK3A 4B44A 3K4KA 1LDKB 2KIFA 3BZKA 4BHPA 3V8LA 4RB3C 2PI0A 2BHAA 2P5VA 5EG0B 1MGTA 1RIOH 3ASOH 3B6CA 4B28A 4CCJA 2RC4A 4ZJZA 1U5TA 1REPC 3C2GA 2BZTA 3HJEA 1P9QC 3U1KA 1X1BA 3S8PA 4M6VA 3CMAI 2OUMA 2CGPA 2EK5A 1RI7A 3WGIA 2Q2EB 1JKRC 3H3VK 2Y30A 1J09A 1MJBA 2L9RA 2GIVA 3HRSA 3F6OA 1R49A 3JRIA 2VC1A 2LSOA 2BGCA 3BWGA 3AG1H 3BG5A 3QAHA 1YG2A 1ZRFA 1GDTA 3WTUC 2A5YB 4D7NA 1FYLA 2HQNA 2W24A 3L2WA 2F5CA 4QPOA 4HNVA 4R8HA 1W1WE 1TT5B 2EFNA 3TAVA 1SAXA 3PKCA 3GUDA 3CCMI 3ERED 4XKCA 2QVOA 3A0HC 3QQAA 1UCRA 2IJLA 3HIFA 4IOCF 2K02A 2ZCWA 1R36A 1Y56A 1XCVA 1ZELA 2M3AA 2VB6A 1HBXG 1Z7LA 1MZBA 3EETA 4G6DA 2G6PA 2ZXWH 3FMQA 2ZXIA 1CGPA 2BOLA 3QYBA 2D1HA 1G3SA 1QXYA 1I1GA 3QPHA 1ETVA 4BE0A 4V19K 4AM3A 3EUKL 3KEOA 5CIKA 2R3SA 2HZTA 4IKFA 1HC8A 3CJNA 5D5WB 1STZA 2XGCA 3GO5A 1C21A 4LMYA 4A93J 1VQ6I 3GEZA 2ID3A 4JQFA 2X6XA 4U70A 2HKXA 2YS9A 5BPDA 3CB5A 3R61A 3X2QH 1R71A 4U6ZA 1ZG5A 3OOUA 3FDYA 1XD7A 3L2CA 2KISA 1SMYF 2FBKA 4FASD 4LLGF 2GIZA 1GUUA 2Y48A 3PNTA 2DFFA 3ZQGA 2BXZA 2UV1A 4FLKA 3OWTA 4AD9A 4L9VA 2DJNA 4CYDA 1R00A 2LNBA 3OR2C 1HDDC 4HLYA 5JFRA 4RZZA 4HZFA 4EGYA 2HYGD 1DGRM 1G4DA 1Z6TA 3RYPA 2F5DA 3AFHA 4UUVA 2QSHX 4XKVA 5CJ9A 1O3TA 1S72I 5F0FA 5D5VB 5JVGF 3FBNB 4I76A 1YRNA 5KCMA 1OKRA 3IAM2 4IRGA 3SZGA 4P9FA 2X6WA 2Z2SB 1GV5A 3GFLA 3I58A 5M5WJ 4L0ZB 4M6XA 1KZHA 4CGZA 2GOMA 1UB9A 5FFZA 1T08B 5E3LA 3S1QJ 5F0CA 1BIAA 4Z7MA 1Y1WJ 1FZPB 4D9JA 4IF7A 4BYYA 2BWWA 3Q0VA 2LC2A 2BBYA 3GFMA 1X4OA 4C30A 3J80K 2XROA 3DLLF 3R0JA 2R92J 5EEGA 3TW7A 1F43A 2BW3A 1T0FA 2DA6A 1NK3P 4U0VA 3FHZA 3CCLI 1FC3A 3C2HA 2LKPA 2LFBA 5GP9A 3WU0A 1JKPC 2DPDA 3CUOA 3S15J 2WB1N 1ETQA 4ZDLA 2OCEA 4HRIA 2A68F 1ZGWA 3J7AO 2Q92A 2HU9A 3WU1B 1YO5C 2IW2A 5ILVA 4WF2A 4UV8A 1JE8A 5B66C 4A3IJ 2QSGX 4A3CJ 1SFEA 4PJJA 4BS9A 1YFHA 4G7OF 2PBIA 5HDGA 2OD5A 1XMAA 3GTQJ 2H94A 1DPRA 3HUGB 3WTXC 1F36A 3OYNA 3OYBA 2FXAA 1FOKA 2XF5A 2E5ZA 2K3PA 2WAFA 4B48A 4XLPF 3I4NJ 1PYVA 2M34A 4XQFA 4CO8A 1PDNC 3WE3A 2LRDA 4OMYA 1G59A 1HKTA 2OBPA 2Q93A 3CC7I 4AUXA 1MNEA 3SDGA 2Z9OA 1QVUA 2FE3A 2ZMEC 3BQZA 1H8AC 4D1QA 2H1LA 3RDIA 2HKOA 4FKCA 4R60A 3BTLA 3IH2A 4M3DA 5F1JA 4ZTJA 3RKQA 2VBYA 2ZC2A 5JHFA 1IV8A 2PFBA 3LFUA 3O8GA 3I56I 1YX5A 2QUFA 1Y8QB 3T8RA 5IYCJ 2I10A 2LH9A 2M4GA 3HXLA 2OTLI 3JRHA 3DBLB 5BOXA 1RKWA 4RGXA 4XOPA 3HM5A 4XBFA 4UNOA 1DU6A 2F5FA 3RQ4A 1HQCA 3IKTA 1FIPA 1YOVB 1IN5A 2IS6A 5JVTA 5IP9J 3J7ZI 9ANTA 1ZHFA 1MMAA 2V1UA 2IAIA 5IY5H 5E3NA 4V2FA 2QKMB 4IL6C 5BPIA 3ZPLA 2BVLA 3ZQHA 2KZGA 1WFXA 3PKEA 1ZYRF 4B8XA 2LK2A 2EVCA 1CF7B 4S01A 2DA7A 3BOQA 4RDUA 3SEZA 3S93A 2K4JA 1KU2A 2DTZA 1R7JA 1V5FA 4I0AA 1V4RA 5FD6A 4BY7J 3F0CA 1I6XA 2YUSA 1SVMA 3K0LA 3QPSA 1FTZA 1C22A 1R6RA 2JVGA 2K4BA 4IVNA 4MFEA 5J1UA 1J75A 2AQFA 3D27A 1J5YA 4D7MA 5DCMB 1IRXA 3J81K 4G7ZF 2W4SA 1JGGA 5KAFC 5HLGA 4IRIA 2KIQA 3FKIJ 3QP6A 1UHWA 2MC3A 3ZGKA 4XORA 1JAWA 2GGCA 5D8KB 4U69A 3F23A 1G2HA 2LF7A 4XICA 1FX7A 2BWYA 2GG7A 1OLTA 3BROA 2EA2A 3FHNA 2JUCA 1K6YA 1SMTA 2GU7A 5JLXA 4PNCA 1R5HA 3H36A 2DQLA 2ECBA 2MW8A 4B47A 3HSEA 3HSFA 2DA1A 1WKMA 4BAYA 1IRZA 2R5YB 2CYYA 3ZXSA 4P5OA 3S1MJ 1ETWA 1K4SA 2JA5J 2BHDA 4CHUA 1Y1VJ 2V3XA 4DBRA 3U2RA 3BTCA 5ED4A 4KFCA 2IEKA 4B1RA 4II3A 4S04A 2ZO4A 1T38A 3CO6C 1SC7A 3PSFA 1YJ3A 1KQ0A 5LGNA 2UXXA 3HOSA 4L9JA 2DPUA 2DODA 4XL9A 1X3UA 1P6RA 2G9WA 3I0TA 2M4KA 3BG6A 1XTAA 5L3DA 2LKSA 2M8GX 5K7ZA 1IXCA 2M0MA 1SFKA 3CJRB 3ECHA 2CG4A 3DP7A 1FBQA 4EM0B 4S00A 1GHCA 4XONA 5M5XJ 1ZR4A 4XLHA 2P9AA 1SVOA 1LE8B 3LSJA 2ZNYA 3VYUB 5C4XJ 1BW5A 2M1BA 2B63J 2IP2A 2F48A 2A61A 2X85A 1N77A 4IKRA 4BXFA 3LNQA 1IC8A 1WJCA 3OL3A 2XIGA 2DOAA 1TTYA 2FQ3A 3JAMK 3ISPA 1J59A 5JR3A 4A3FJ 1JXSA 3AKZA 1A16A 1DP7P 2K9NA 1YTYA 2RVCA 3OY9A 1ZQ3P 1TW3A 2FBHA 3RPUA 4ENKA 2UXNA 2CV0A 4QLCU 4PDKA 4AU7A 3QYEA 4S2TP 1IN7A 3JW4A 1Q1HA 1OR7C 2IGMA 3DPTA 4H0EA 3WHCA 1N78A 4QSHA 2WC2A 2FX0A 3CTAA 5HOOA 4U6CA 2EZHA 2HS5A 4PJMA 4ZWPA 2YSRA 2Y9YA 3FKJA 1K61A 3COAC 1V5GA 3FXJA 3OMYA 1WI3A 4IF4A 4JOMA 1W36C 1TWHJ 3ML6A 1P4AA 1T39A 2QYOA 1OCZH 1ZGJA 1MIJA 2VE9A 3PUFA 1C0WA 3FK6A 5JLWA 1W7PD 3IWFA 2ZXJA 1FT9A 3BQYA 3PL8A 4Z2YA 3GZ6A 1CHMA 1H0MA 3PM1A 2M5WA 3OYDA 4LIVA 5DDGA 2GGBA 1X3ZB 3Q6DA 4M9SA 3H1CA 3AAFA 4HDUA 2LYCA 3E7LA 3CLOA 2JQ7A 5IT9K 2GU4A 3M3YJ 2NAZA 1RUOA 5CDEA 3DLAA 4XMYA 3MEXA 5ICGA 3IV5A 2R7ZJ 4S0HB 3HRMA 3UKGA 2JN6A 2I5UA 4CCMA 3LQRA 4E7IA 2IGOA 2FMYA 1XGOA 4PSXA 1B9NA 5DCMA 4JX5A 3HTSB 3GTLJ 2B7EA 1E3OC 3E6DA 1I3QJ 4KITB 2VXDA 4C2UA 5J4VA 4FCYA 2K9MA 4RA2A 3D1NI 2DMTA 3BJOA 2P8TA 2BWXA 4KIBA 3KE2A 2R7QA 1R1VA 2FUG2 3OOPA 4LGWA 1PP7U 1EF4A 3HDDA 3HOZJ 5E1WA 4YFXF 4NHJA 1BR2A 2R5YA 3TDUC 1VFCA 1J9IA 3WTTC 5C44J 4MEYF 5LRSA 3HOUJ 2IBDA 2XPUA 1PP8F 2Z33A 2V4JC 4D5CA 1RR8C 3HOYJ 2K5CA 5TISC 3OSGA 3GYHX 5EZHA 4YIFA 3RQIA 3DPLC 2LR8A 2HQAA 2VBWA 5HLIA 3FXRA 3AG3H 3RPQA 3DTKA 3ONQA 5B5EC 1VQOI 1QZZA 3FMSA 2OCCH 1A6QA 2R7RA 2NS7A 4HX7A 2VQHA 4L9NA 1U2WA 2ME6A 4ESFA 3E5QA 1MATA 2V1XA 1MSEC 3I54A 3CDLA 4ZYEA 3VWBA 4R79A 4Q4ZF 3JTGA 2R7VA 4LK1F 1YJ9I 4UVCA 3S3MA 4NQWA 5DV5A 1MJAA 3K2ZA 4BDZA 3RORA 3LSTA 3KEQA 5EYRA 1Z91A 1S7EA 1IV6A 1JTXA 1T8IA 5LLQA 3S3OA 1YS6A 1YJNI 1WI9A 1LE8A 1K83J 5ILUA 1HKSA 4II2A 3S2DJ 4GRIA 5D8LB 2RQPA 1UJ8A 3H5RA 4HOBA 4XSXF 2GZ5A 2F5VA 3OYEA 2BB7A 1MMSA 2D1VA 2M7AA 3PQJA 1DDNA 2FNAA 1H88C 1B6AA 4AIHA 1KQ9A 2JRMA 3L1PA 5C3EJ 3CUQC 4F7ZA 3W2VA 4A12A 3I3LA 3E5XA 3CMYA 1S7AA 1JT6A 3OSFA 2GTXA 4BACA 2R7WA 1TLHB 1S8NA 2XSJC 4LJZF 1IW7F 1ZKGA 5CE6A 5M3MJ 2PEXA 3O6BB 3E6MA 5F6FA 1I27A 3GVAA 5CVIA 2K9QA 3GBGA 4MFDA 2LLKA 2XPVA 3P9KA 2XB0X 5LFAA 3JRAA 4FHTA 5LEKA 2A05A 2MD0A 1G3YA 3RTRA 4ZZDA 2K27A 4UVAA 5IT9Z 3EUHA 2KL4A 3CUQA 3TB5A 4CCOA 1WWXA 4CZCA 5HVQC 5LD2C 1IXRC 1XSVA 1VF9A 1XCBA 1BR4A 1RETA 4HA8A 1I50J 1XPXA 3SFZA 3IG4A 1LQ1A 3JRGA 2KJCA 1L3LA 1EH6A 3V8JA 2CRGA 3K69A 4AVZA 4LB5A 1GLNA 5LGUA 2B3KA 4U71A 1A04A 1GV2A 4I09A 1IZ1A 1S7OA 4QIWN 4B43A 4A3LJ 1B59A 4PK4A 5E20A 3MVPA 2JPCA 1OCOH 4UUSA 1JKOC 3EUAA 2L7MP 2L02A 4WX9A 3LAJA 4XLCA 6PAXA 4J01A 2Z1DA 3I9V2 3SXYA 3LA7A 1AOYA 1ZLKA 2GAUA 3D5LA 2OC6A 3BR1A 4XN3A 1VQNI 1JHFA 4RM3A 1SFOJ 4RLFA 4QTRA 1TWFJ 2CFOA 3BIQA 3ABMH 3HHHA 4LITA 1I39A 4Y13A 5H2FC 1FYMA 4ENMA 5EGOB 4IXAA 4IHYA 2XB5A 2VJJA 3IP4B 5ICEA 1MNDA 5CVVA 3Q0WA 1VQLI 1BJZA 3SYTA 4ETSA 4PCQA 3RKWA 2E34A 2HVSA 3E6CC 2X6YA 1R58A 2DI3A 1U5TC 4FETA 5ERIA 1X4PA 1WL9A 2A6TA 1QA6A 2PJRB 3TMOA 2NVUB 3RCOA 4U75A 3S1RJ 4IHWA 2VLAA 2VPRA 2CU7A 2W1OA 1HSJA 4UV9A 3V7RA 3ZMDA 1B72B 1MMGA 3QOPA 3CCJI 2AQEA 5IYDJ 3EQLF 4PSWA 2O3FA 2Q8KA 2PMZN 4QWQA 4PZJA 3U1DA 4A69C 1HA8A 1Z0XA 5F04A 1T95A 2XVCA 3RIRA 2FU4A 1GT0C 2IS1A 1QXWA 4EJWA 2GXAA 5L3CA 3A0BC 3ZQLA 3TQNA 2MYSA 4G94A 4KYWA 4W1UA 4U73A 4BU2A 2EJRA 5E1XA 2PLYA 3EYYA 1E17A 5K7HA 4BQAA 2E5NA 5CLSA 1NG6A 4F52A 4HLXA 2LY1A 1FPQA 2OZUA 1MDMB 3GTGJ 3HOWJ 3RKYA 2MH9A 4A6DA 2DBBA 5CVJA 5C4JJ 2F4MB 2PJPA 3GTPJ 1HOMA 2KMUA 5LRRA 1HCRA 4I01A 3F22A 2HZDA 4H4KC 5AIPA 3L00A 3S3NA 2GXBA 1D1BA 5E17F 2M7BA 3HPGA 3JRDA 4L9TA 5JI6A 5LEJA 3TO7A 3ZQCA 2H6BA 1YW9A 5LHIA 3WG7H 3W6JB 4AYBA 2E1MC 1E2XA 2ZB9A 4F93B 1TL8A 4WWCA 1D8JA 4G7HF 4IHTA 1OYWA 2FOKA 2V9VA 3W6VA 1BC8C 2QSFX 3F21A 1B8IA 4MQVA 2BVMA 2NOGA 3M1CA 1VI0A 3JRBA 1UHSA 4U6EA 1IDZA 1FBUA 4KUMA 2Y0SN 4PV4A 4DYRA 3MKWB 2A07F 3BC8A 1D8KA 3FM5A 4N9IA 3E5UA 2XHKA 3OR1C 1AWCA 4WK8F 2YX4A 3V8KA 1VQPI 1JJ8C 2BY1A 2EFWA 5H6RA 4GO1A 3FZVA 1Z21A 2WV1A 1XGSA 4A6WA 3IU7A 2JSCA 4HG2A 3ZN0A 5F1RA 3F8BA 3LOCA 3CCQI 4IO9F 1ZARA 4EJOA 2HXOA 3WODF 3VSLA 3OIQA 4LD5A 2GOXB 3HYIA 3JSOA 2UWMA 5IOZA 2XKPA 3T8TA 3LSGA 2DFHA 4C3JJ 3V42A 2DW4A 1RESA
chains in the Genus database with same CATH topology
1LB2A 2DQRA 2BH3A 2YR2A 1W4MA 2ZMEB 2L4AA 2IA0A 3BITA 2RKHA 4AVPA 4ZYHA 1G3TA 3RI4A 3QU6A 4RB2C 2XGXA 3KP6A 3IRQA 5ILSA 2BN7A 2QQAA 4I7HA 3IU8A 4I98B 3GFIA 3CTZA 5HS9A 2FSWA 2CSOA 3K9TA 4GGGA 5LGTA 2Z99A 3K1NA 4KA4A 2CWEA 2KKOA 2RNJA 1FSHA 1LJ9A 1S3JA 2KIUA 2H09A 2Q0OA 1UFMA 3IC7A 4BHBA 3CO7C 4AIKA 1IF1A 2P7CB 4M72A 2BWUA 3ZP5A 5F64A 4Q5SF 4XSZF 4IECA 4RGRA 1LDDA 2VODA 2VOOA 2KIMA 1LEBA 4ZYDA 2IVMA 2VBZA 3DFGA 4A6EA 3G73A 3R0AA 4P96A 3ZMUA 2Q2EA 2HOEA 1ZRDA 5BMZA 1DUXC 2L54A 1BC7C 2OKNA 2IA2A 2A69F 3HRTA 2FEZA 4RAZA 3MFKA 1OYYA 1GXQA 3KP4A 1LDJA 5ICFA 2ZSGA 4S05A 3VFZA 2HTJA 1DPUA 3PFIA 4OIQF 4HV5A 3RVAA 4OINF 2PG4A 5LHGA 2P99A 5JHUA 4RGUA 4IKSA 1WQ2A 2WTEA 3KETA 1W5SA 4Y15A 3LAPA 2GA2A 2UZKA 3P9IA 1Z1DA 4HF1A 4L5IA 4RGSA 2R7DA 5L3FA 4U1BA 1F1ZA 2DLLA 3ABTA 3SZPA 3REOA 2XAHA 3TKYA 4YG2F 2GG3A 1ZG1A 4AWXB 5E8GA 3DF8A 2HYFA 5L3EA 4DNCA 2NRAC 2M8EA 4NB5A 4GXOA 2X4HA 3CDHA 2BWTA 2ETHA 2JT1A 1K78B 3GLXA 2EV0A 1QQIA 1O3QA 2MA3A 4CZZA 3J80Z 2QQBA 1BI2A 3Q9VA 1O57A 4OOIA 1Z7UA 3IHUA 1PUEE 1O7FA 5AIQA 1SD7A 1QPMA 2NNNA 2XAGA 3PQKA 1YVMA 1KYZA 3FXUA 2GG9A 5FLXK 2QQ9A 5FFXA 2E1NA 2HTSA 2EVMA 4IRHA 4ZH4F 4GCVA 2YPRA 4AIJA 2DFIA 3IWZA 1WL6A 3PKAA 2C6YA 2O6GE 4WXCA 4KDPA 4EGEA 4FX0A 3EYIA 4N0BA 2CQKA 2IA1A 1U6GA 2P6SA 3HUGA 2L3DA 4RB1A 2COMA 4RS8A 3L09A 1P2FA 3VOEA 4U0YA 4ZWOA 4EQQA 3ZMVA 1BN5A 2NQ7A 4MATA 4U0WA 3I5UA 3I4PA 3PKDA 1BIBA 3KLOA 4A6VA 1USSA 4MTDA 4MNUA 2P7VB 4A5NA 2ZKZA 2XAQA 2BE5F 1C24A 3KZYA 2FF4A 1YLFA 1YW7A 3BJAA 2FMLA 3O2PE 5FGMA 3L7WA 2FBIA 1FBSA 3S2WA 2VT3A 1FWZA 2R7FA 3GW2A 3MCZA 3N4MA 4YFNF 1HSTA 3J81Z 1OPCA 3LFKA 1RNLA 2O0YA 4IPAA 1J2XA 4KMUX 1CF7A 2EWNA 3RJPA 2V3ZA 2GA1A 4HW0A 3F8MA 2CO5A 3MR1A 3BY6A 3ZMTA 4EGZA 1K78A 1W2MA 5L3BA 2GG2A 5FLXZ 4MEXF 3H3ZA 3VB2A 4M9XA 4MTEA 4WCGA 3C1DA 1U78A 2MBFA 4ZWUA 2GG5A 2NQ6A 5J8CA 5CVUA 3E3VA 2K7LA 1HW2A 2E7XA 1FYKA 2P4WA 2XASA 2FNPA 2ZBKA 4LK0F 1MJ9A 3TOBA 2ADUA 5D6EA 1F5TA 1I1SA 4OIOF 2HWVA 4LLLA 5BS6A 4PGGA 4UVBA 3BPXA 1NHAA 3KP3A 3B73A 4WXHA 1O3SA 1BM9A 4HX8A 1RZ4A 4HF0A 4O3MA 2BWVA 3JAMZ 2G7HA 5K5QA 4RB0A 3HOTA 4OIPF 1C23A 2V79A 1KP0A 4FUKA 4XLNF 2H27A 1S29A 4DQ2A 1MKMA 4RAYA 4A5MA 3DKWA 3BPVA 4KNYA 1XB4A 3BP8A 2M45A 4TV7A 3GF2A 1P92A 5DEQA 3S6BA 3NRVA 1LVAA 2A6HF 2OZ6A 4A0XA 4LFUA 1TQMA 3VODA 5HS8A 1D3YA 3HSRA 3MAJA 2BWSA 2RGVA 2EFPA 2XKOA 4IHSA 3W6KB 2EV6A 2B3LA 2ISZA 1ZLJA 5DUIA 2LF8A 1YIOA 3D0SA 2O61A 3ULQB 5K5OA 3K1MA 3MZYA 3R60A 1R1TA 2JRTA 2MLKA 1KU9A 2E7WA 3F6VA 4ESBA 4HV6A 2P6TA 4G8XA 3TO6A 5D5UB 4FX4A 1W7PB 5LBQA 3I59B 1MD0A 4ENJA 1BI0A 1ONVA 1ODDA 1O7LA 3KP7A 1YS7A 3PKBA 3SZTA 3ZN1A 2Y0MA 1KU7A 2VONA 3KZZA 1RUNA 4M6YA 2XAJA 1XMKA 4ESJA 4ZYGA 2A3SA 2L01A 3RYRA 2BHBA 3DQVC 2J5PA 2CFXA 5HS7A 2H6CA 4GYGA 1T6SA 1ZGAA 3E97A 3OV8A 4CICA 4FO7A 1R22A 2PN6A 1Y1NA 4LB6B 3WTYC 1BI1A 1XDUA 2YU3A 2EFQA 4EV0A 3R6SA 1WRJA 3BJ6A 3HHGA 2P5KA 3IRRA 2W25A 1SD4A 4MGRA 4O6JA 1W7VA 1J7KA 3KP5A 2V3YA 1TQIA 5DD8A 2BV6A 5H20A 5FO5A 1XN7A 2FRHA 5BQTA 4LG0B 3IU9A 2JZYA 1ZRCA 2PMUA 1XGMA 5DUKA 1WBQA 2W57A 4FLJA 4GYIA 2MD5A 2NS0A 1L0OC 5DCFA 2HR3A 4U7DA 1QZYA 1ZG3A 2DT5A 2F2EA 3HTUA 4WXDA 4S2RP 1F4KA 4U88A 3WTZA 3FXQA 4HBLA 5KVRA 2XV4S 2XRNA 1BI3A 4IU6A 2VT2A 2WWYA 3JSPA 5FCFA 4M73A 1IN8A 5TRDA 4PGHA 1W7PA 1KYWA 1JGSA 1EH8A 2V6CA 1R23A 3I59A 4HDVA 2GU6A 5FB2A 3F8CA 3QU3A 2NNYA 5K1YA 2QWWA 4FT8A 2O03A 4OIRF 3N97A 2BYVE 3LWFA 1I5ZA 1BBYA 1QGPA 4KM3A 2PMHA 1ULYA 1D5VA 1WN1A 3F3XA 3P7NA 2W84A 2DAOA 3K1PA 1IAWA 5A2QK 4G9YA 3SHFA 2Z5UA 2GG8A 2MATA 2HFHA 3C3WA 1IUYA 1O3RA 3SQNA 4OOKA 4UXNA 2V1DA 3QRFF 3KLNA 5CDVA 5IT3A 1HKQA 2AXLA 1Z9CA 1OMIA 1EH7A 4I2OA 4KN7X 1XGNA 3O3KA 4ZNGA 1MDMA 2P98A 3V4GA 3DV8A 1T98A 1FLIA 1WSUA 1YYVA 4UHTA 2LDUA 4HQEA 3LQQA 3L24A 4IDYA 4IKUA 4KMFA 2GQQA 3F72A 5AONA 1BOAA 1FP2A 4Y17A 4U6JA 2EA4A 2XAFA 4LG0A 2IW5A 4EM1A 2DK8A 5FD5A 4MHGA 2ACJA 4JBAA 1M35A 3V7CA 1IN4A 2DU9A 2M30A 1K7AA 1KU3A 5J8FA 2HEOA 2HOWA 2OQGA 2STWA 4HXXA 2QM3A 3IL2A 1HW5A 5D4RA 2ESNA 3VEPA 1IRFA 4A2UA 2GWRA 4ZZLA 2ZNZA 2OA4A 2VOPA 3ZMZA 3B02A 2ZMEA 3Q5FA 2HDCA 3WTWC 1R5GA 4CDGA 2IT0A 3NEUA 2OAZA 3ROUA 1KGSA 4P9UA 5A2QZ 1KQ8A 2VN2A 1ZH5A 1SD5A 5CYVA 5K5RA 1TQPA 3LA3A 1N51A 2XUBA 2D2WA 4YFKF 2O8XA 1G6NA 4EJVA 1QNTA 5J6XA 1T2KA 2IRFG 4N9HA 1OYIA 4ASNA 3TOAA 3WTSC 5EEHA 4EMSA 2VC0A 4RZYA 3QP5A 5LHHA 2KRFA 4HYEA 2JTVA 3WG9A 1B9MA 1UHMA 4FO8A 4EM2A 1GVJA 3BIPA 5TJJA 1O0XA 1P4XA 3V7SA 2IPQX 3E6BA 2A6EF 2Y75A 1WY2A 2F5EA 4RGZ1 3QPTA 5HLHA 3FM3A 4M9ZA 2CW0F 2K86A 3Q9SA 3TDZC 3BZ6A 3R4KA 3WE2A 3L9FA 3ABUA 1QO0D 3G3ZA 2E1CA 1ON2A 3I71A 1K79A 2GZWA 2STTA 2QZ8A 3I64A 4KIGA 1IRGA 4HX4A 2Q95A 4Q47A 3DEUA 3GZ5A 5E8IA 2HQRA 2L4MA 3H3UA 2HGCA 3WGGA 2OU2A 5HDNA 4ON0A 1IN6A 2DTRA 1K6OA 1Z6RA 4LLNA 3L7GA 2EV5A 2B3HA 3F8NA 5L3GA 1QBJA 3CUQB 2B0LA 1F9NA 5DD4A 2G7UA 4I02A 1XSDA 3GWZA 1H9GA 1XDSA 4YIIA 1U8RA 1ZN2A 1OR7A 4ENNA 2ESHA 5CNXA 4EJUA 2ELHA 4R1HA 2GG0A 2Q94A 2QENA 4L5JA 2MH2A 3BDDA 3FF5A 4G6QA 3MATA 2BHCA 1P4WA 4D0PA 3GX4X 3FX3A 2KJBA 1TNTA 5ICCA 4OU0A 4L0YB 4M71A 2OQRA 4HQMA 1HXDA 4P55A 2D45A 4MQ9F 2VXZA 4A0YA 1IXSB 3MQ0A 1U3EM 2QBYB 4M74A 1TBXA 2YX7A 1ZAOA 3M1EA 3U9GA 1WLRA 4KIFA 4IKTA 5E18F 1SFXA 1HW1A 4BNCA 1FSEA 3JTHA 2Z3YA 3MX6A 3P9CA 3HRUA 1G3WA 4FLIA 4U76A 2X0LA 2DO7A 3MWMA 3ECOA 4HAMA 4FLLA 4L18B 1S6LA 4HF2A 3M9AA 1U5TB 1EV7A 1USTA 2ISYA 1W5TA 5KK1A 1B4AA 5CDLA 2GU5A 3KFWX 3GFJA 2J5OA 1H9TA 1FP1D 3TO9A 2PQ8A 3KCCA 3I53A 3TGNA 3T5XA 3DXJF 1ON1A 1J0RA 2WV0A 1C27A 3H92A 1QXZA 4EJTA 4OMZA 3C18A 3C7JA 1ZREA 2ZFWA 1LEAA 1YW8A 1XNZA 3FWEA 3FMRA 1GXPA 3ZMSA 2W85A 3M7GA 5D5XB 1FNNA 2RV8A 2P5LC 2ZJ2A 4IJAA 5D6FA 3ZQ7A 5D4SA 3KP2A 3M8FA 2JPBA 1Z05A 2VBXA 1BJAA 4QR8A 2EB7A 5DYMA 2RN7A 4BXUA 1KA8A 2M87A 5HDKA 3GXOA 4KICA 1LNWA 3CB6A 1Y0UA 5E5BA 3M8EA 4BH9A 1R1UA 4O5VA 1VTNC 2QLZA 3ELKA 2Q96A 2NYXA 4JUQA 1TW2A 4XRFA 4BHCA 1FY7A 4JK1X 2EVOA 4K2EA 3EDPA 1SFUA 2BEOA 3LA2A 3T1BA 4A0ZA 5E1ZB 5H6QA 1SD6A 2TDXA 4B09A 4I0BA 4KT5C 5FCHA 2VE8A 4EVIA 2DK5A 1V3FA 1JHHA 3WTVC 2AS5F 5CVRA 2RDPA 2QBYA 2MLGA 3MZHA 4KN4X 4E70A 4Q48A 2GXGA 4U6WA 3T0YA 1PV9A 1YQAA 3F8FA 3RKXA 4U7BA 4CXFA 3IKVA 3WGHA 1TNSA 3NQOA 1B1BA 2FA5A 2EFOA 1XSXA 1LDKB 2KIFA 4BHPA 3V8LA 4RB3C 2PI0A 2BHAA 2P5VA 1MGTA 1RIOH 4B28A 2RC4A 1REPC 1U5TA 2CGPA 2EK5A 1RI7A 3WGIA 1MJBA 2GIVA 3HRSA 3F6OA 2VC1A 2LSOA 2BGCA 3BWGA 3QAHA 1YG2A 1ZRFA 3WTUC 2A5YB 1FYLA 2HQNA 2W24A 2F5CA 4R8HA 2EFNA 3TAVA 1SAXA 3PKCA 3GUDA 3ERED 2QVOA 1UCRA 2IJLA 3HIFA 2K02A 2ZCWA 1R36A 1XCVA 1HBXG 1MZBA 3EETA 4G6DA 2G6PA 3FMQA 1CGPA 2D1HA 1G3SA 1QXYA 1I1GA 3QPHA 3KEOA 5CIKA 2R3SA 2HZTA 3CJNA 5D5WB 1STZA 3GO5A 1C21A 4LMYA 3GEZA 4JQFA 4U70A 2HKXA 5BPDA 3CB5A 3R61A 4U6ZA 1ZG5A 1XD7A 3L2CA 1SMYF 2FBKA 4LLGF 2Y48A 4FLKA 4AD9A 4L9VA 4CYDA 1R00A 2LNBA 4HLYA 5JFRA 4RZZA 4HZFA 4EGYA 2HYGD 1G4DA 1Z6TA 3RYPA 2F5DA 4UUVA 5CJ9A 1O3TA 5D5VB 1OKRA 4IRGA 4P9FA 3GFLA 3I58A 4L0ZB 4M6XA 4CGZA 1UB9A 5FFZA 1BIAA 4Z7MA 1FZPB 4IF7A 4BYYA 2BWWA 2BBYA 3GFMA 3J80K 2XROA 3R0JA 5EEGA 1T0FA 4U0VA 3FHZA 1FC3A 2LKPA 3WU0A 2DPDA 3CUOA 2Q92A 3J7AO 2A68F 3WU1B 1YO5C 2IW2A 5ILVA 4WF2A 4UV8A 1JE8A 1SFEA 1YFHA 4G7OF 2PBIA 5HDGA 2OD5A 1XMAA 2H94A 1DPRA 3WTXC 2FXAA 1FOKA 4XLPF 4CO8A 1PDNC 3WE3A 4OMYA 1HKTA 2OBPA 2Q93A 2Z9OA 2FE3A 4R60A 4FKCA 3RDIA 2HKOA 2VBYA 2PFBA 2QUFA 3T8RA 5BOXA 4RGXA 4UNOA 4XBFA 2F5FA 1HQCA 3IKTA 1IN5A 5JVTA 1ZHFA 2V1UA 5BPIA 3ZPLA 3PKEA 1ZYRF 4B8XA 2EVCA 1CF7B 4S01A 3BOQA 2K4JA 1KU2A 1R7JA 4I0AA 1V4RA 5FD6A 3K0LA 1I6XA 1C22A 2K4BA 4IVNA 1J75A 3D27A 1J5YA 5DCMB 4G7ZF 3J81K 4IRIA 5HLGA 3QP6A 1UHWA 2MC3A 2GGCA 1JAWA 5D8KB 4U69A 3F23A 2LF7A 2BWYA 1FX7A 2GG7A 3BROA 2EA2A 1SMTA 2GU7A 4PNCA 1R5HA 2DQLA 3HSEA 3HSFA 1WKMA 4BAYA 2CYYA 4P5OA 2BHDA 4CHUA 2V3XA 3U2RA 5ED4A 4KFCA 4S04A 2ZO4A 1T38A 3CO6C 1YJ3A 1KQ0A 5LGNA 2UXXA 3HOSA 4L9JA 2DPUA 1X3UA 1P6RA 2G9WA 3I0TA 5L3DA 1IXCA 3ECHA 2CG4A 3DP7A 1FBQA 4EM0B 4S00A 1GHCA 2P9AA 2ZNYA 2M1BA 2IP2A 4IKRA 2A61A 2XIGA 1TTYA 2FQ3A 3JAMK 3ISPA 1J59A 5JR3A 1JXSA 1A16A 1DP7P 1YTYA 2RVCA 1TW3A 2FBHA 4ENKA 3RPUA 2UXNA 4QLCU 4PDKA 4S2TP 1IN7A 3JW4A 1Q1HA 3DPTA 4H0EA 2WC2A 3CTAA 5HOOA 4U6CA 2HS5A 4ZWPA 2YSRA 3COAC 4IF4A 3ML6A 1P4AA 1T39A 2QYOA 1ZGJA 2VE9A 1C0WA 1W7PD 3IWFA 2ZXJA 1FT9A 3GZ6A 4Z2YA 1CHMA 1H0MA 2M5WA 5DDGA 2GGBA 3Q6DA 4M9SA 3AAFA 4HDUA 5IT9K 3CLOA 2GU4A 2NAZA 1RUOA 5CDEA 5ICGA 3MEXA 3HRMA 3LQRA 2FMYA 1XGOA 5DCMA 1B9NA 3HTSB 3E6DA 3BJOA 2P8TA 2BWXA 4KIBA 3KE2A 1R1VA 3OOPA 4LGWA 1PP7U 5E1WA 4YFXF 4NHJA 3TDUC 1J9IA 3WTTC 4MEYF 5LRSA 1PP8F 2Z33A 3GYHX 4YIFA 3DPLC 2VBWA 5HLIA 3FXRA 3RPQA 1QZZA 3FMSA 4HX7A 4L9NA 1U2WA 4ESFA 3E5QA 1MATA 2V1XA 3I54A 4ZYEA 4R79A 4Q4ZF 3JTGA 4LK1F 4UVCA 4NQWA 5DV5A 1MJAA 3K2ZA 3RORA 3LSTA 3KEQA 1Z91A 5LLQA 1YS6A 1WI9A 5ILUA 1HKSA 5D8LB 2RQPA 4XSXF 4HOBA 2GZ5A 2BB7A 2D1VA 3PQJA 1DDNA 2FNAA 1B6AA 4AIHA 1KQ9A 3CUQC 4F7ZA 4A12A 3E5XA 1S7AA 2GTXA 1TLHB 1S8NA 4LJZF 1IW7F 5CE6A 2PEXA 3O6BB 3E6MA 5F6FA 1I27A 3GVAA 5CVIA 3P9KA 4FHTA 5LEKA 1G3YA 3RTRA 4ZZDA 2K27A 4UVAA 5IT9Z 3EUHA 3CUQA 3TB5A 1WWXA 5HVQC 1IXRC 1XSVA 1XCBA 4HA8A 3SFZA 3IG4A 1LQ1A 2KJCA 1L3LA 1EH6A 3V8JA 3K69A 4LB5A 5LGUA 2B3KA 4U71A 1A04A 4I09A 1IZ1A 1S7OA 1B59A 5E20A 2JPCA 2L02A 4WX9A 3LAJA 6PAXA 3SXYA 3LA7A 1AOYA 1ZLKA 2GAUA 3D5LA 1JHFA 3BIQA 3HHHA 4Y13A 1FYMA 4ENMA 4IXAA 5ICEA 5CVVA 4ETSA 4PCQA 3RKWA 3E6CC 1R58A 2DI3A 1U5TC 5ERIA 1WL9A 4U75A 1HSJA 4UV9A 3V7RA 3ZMDA 3QOPA 3EQLF 2O3FA 2Q8KA 4QWQA 4PZJA 3U1DA 2XVCA 3RIRA 2FU4A 1QXWA 4EJWA 5L3CA 3TQNA 4G94A 4KYWA 4U73A 2EJRA 5E1XA 2PLYA 3EYYA 1E17A 4BQAA 5CLSA 4HLXA 1FPQA 2OZUA 1MDMB 3RKYA 2MH9A 4A6DA 2DBBA 5CVJA 2PJPA 5LRRA 4I01A 3F22A 5AIPA 3L00A 2GXBA 5E17F 4L9TA 5JI6A 5LEJA 3TO7A 2H6BA 1YW9A 5LHIA 3W6JB 1E2XA 4WWCA 1D8JA 4G7HF 4IHTA 1OYWA 2FOKA 2V9VA 1BC8C 3F21A 4MQVA 4U6EA 1FBUA 4KUMA 4PV4A 2A07F 1D8KA 3FM5A 4N9IA 3E5UA 2XHKA 1AWCA 4WK8F 2YX4A 3V8KA 2EFWA 5H6RA 4GO1A 3FZVA 1XGSA 4A6WA 3IU7A 2JSCA 3ZN0A 5F1RA 3F8BA 1ZARA 4EJOA 3WODF 4