2DFIA

Crystal structure of pf-map(1-292)-c
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
301
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 94
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dfiA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2dfiA01
4FX4A 4CHUA 5DV5A 1SFUA 2Q96A 2FBIA 5HS8A 2VE9A 4FT8A 1LDKB 1NHAA 4MATA 4HYEA 4B09A 2FBHA 1QPMA 4KN4X 1V4RA 2M5WA 1JGSA 4EM0B 4ESBA 2GU5A 1KU7A 2QENA 5IT9K 2EA2A 3VODA 2UWMA 1LEAA 5HS7A 1JAWA 1TTYA 4IKTA 4OIRF 2MA3A 1S6LA 3LA2A 2IJLA 3D27A 1SD4A 3S6BA 3ECHA 1Z9CA 3H3UA 4ESFA 2STWA 4U6JA 3ZMVA 2DLLA 3WODF 2WC2A 1CF7A 2CYYA 2FMYA 2GG0A 5LBQA 3QU3A 1J59A 3F21A 5BOXA 3EQLF 2VONA 1V3FA 3DXJF 5CDEA 1EH6A 4I01A 2L54A 3H92A 2EK5A 1EH7A 2FXAA 4G6QA 3FMQA 2GAUA 4CYDA 5FO5A 2GG3A 2D2WA 5K5RA 2BWWA 4MEXF 3DPLC 4HA8A 1AOYA 1W7PA 2EWNA 4BYYA 1IRFA 1T6SA 3I59A 5AONA 2B3KA 3RVAA 1BC7C 2K02A 5ICFA 2FOKA 3RPUA 5HVQC 1N51A 2YX7A 1WN1A 3CB5A 4U6ZA 3HRMA 2IPQX 1YYVA 4LLLA 4ZH4F 4MTEA 3WGGA 1O7FA 4E70A 3E5QA 2KJCA 1T2KA 4MGRA 1WSUA 2GIVA 4MQ9F 3D5LA 4O6JA 3DP7A 4UVBA 4PDKA 2BHAA 1BI1A 2LF7A 2DT5A 1S7OA 5KVRA 2XAQA 4ENJA 2K7LA 1QXWA 3HOTA 2X4HA 4CO8A 4JQFA 3HSFA 3SFZA 2W84A 5CVUA 2NNYA 2Q8KA 1BM9A 4S2TP 2RV8A 3C3WA 2ELHA 4I02A 3F8BA 2XAGA 4BHCA 2DI3A 3ZMZA 3GFMA 1HSTA 3FZVA 1MJAA 2A5YB 3U2RA 2EV6A 2VXZA 4BAYA 3IU9A 3JSPA 1Z91A 3Q9VA 2IRFG 4M9SA 5JI6A 2RDPA 5HLIA 4LB5A 4HQMA 3HHGA 4WWCA 3PKCA 3IWZA 3TOAA 1TQPA 5H20A 4CGZA 4U71A 4HF2A 4G6DA 2DO7A 1I5ZA 1PP7U 4RZYA 2EJRA 5L3DA 3F3XA 1QBJA 2W24A 1BBYA 3RPQA 1XSVA 4WXHA 1U5TB 1Y0UA 1G3TA 3K1MA 2OZUA 2D1HA 1O3TA 2W57A 1TBXA 4HDUA 1YFHA 1KYZA 2H6BA 2OQGA 1H9TA 4YFNF 3TDZC 4UHTA 4U75A 3WTTC 4N9IA 3MATA 3IWFA 5DD4A 4TV7A 1BOAA 1WL6A 4PGHA 1FYKA 4KA4A 3Q9SA 1MZBA 2OU2A 2RN7A 5BS6A 1FC3A 5HLHA 4I0AA 5JFRA 5FCFA 5DDGA 5D4RA 1KU9A 3CB6A 2VBXA 1ONVA 2O0YA 5JR3A 2BH3A 4MQVA 1IXCA 2V3XA 3WTUC 1OYWA 2V1DA 2PEXA 3ECOA 3WU0A 1YW7A 2PMUA 1UCRA 2O61A 2BWXA 2HQNA 5FLXZ 4FLIA 4EMSA 3WTVC 5DD8A 4OIQF 4EM1A 3T5XA 4AVPA 3I0TA 4AIKA 4RGSA 2Z3YA 2GQQA 5K5OA 2O03A 2R7FA 2BWTA 4GYIA 4EGEA 1FBUA 3FXRA 3R61A 2ADUA 1Z6RA 2A3SA 3GXOA 4BXUA 1HKQA 2PN6A 1CGPA 1C24A 1AWCA 2BN7A 1J2XA 1XSDA 3DV8A 3DQVC 2LDUA 2R7DA 2F5FA 5JVTA 1SFXA 2ISZA 3GFIA 4KIFA 2B0LA 3PKEA 2A07F 2V9VA 1KYWA 4UV8A 1T38A 3GZ6A 4L18B 2GA1A 2BWVA 4EJUA 3CUOA 4Y15A 2ZKZA 4F7ZA 4LLNA 1FLIA 1KQ8A 4HW0A 2NNNA 1FOKA 4UVAA 2VN2A 3KP2A 2EFQA 4KYWA 5D4SA 2A6EF 3HRSA 3M9AA 1Z05A 3QAHA 1DPUA 2LF8A 3BZ6A 3RYRA 1RNLA 1W7PB 2CFXA 1STZA 3BJ6A 1FY7A 2COMA 4Y13A 3I59B 1ZRFA 2OA4A 2QQBA 2G9WA 4LJZF 5FFZA 1RUOA 5DCMA 3K9TA 3HYIA 1CHMA 2HOWA 3BITA 3GYHX 3J81K 3QOPA 5F1RA 1YO5C 2VBZA 2VE8A 2MLGA 3L2CA 2H94A 3WGHA 4G9YA 2Z9OA 1IRGA 2KRFA 1ZRCA 3TO6A 5FB2A 5FD6A 2CQKA 4P9UA 3QPTA 3ZP5A 5LGUA 1WBQA 1TQIA 3T8TA 4HQEA 3RDIA 4NQWA 4ZZDA 4LK0F 3ERED 1YVMA 1EH8A 2CGPA 4ON0A 4LG0B 1WY2A 1USTA 5HOOA 1R00A 4I98B 2K27A 3G3ZA 2E1NA 1GHCA 4OIPF 1J7KA 2HS5A 5HLGA 3F8CA 4ZYHA 4HF0A 5E8IA 4FO7A 4ENKA 4FHTA 6PAXA 1HW2A 4KM3A 2VC1A 2P5KA 2M1BA 2AXLA 2GGBA 2MATA 3ELKA 5DUKA 3RI4A 2F2EA 5LGTA 1O3RA 3R60A 3E3VA 4PZJA 3MR1A 4FLKA 1EV7A 1XDUA 4K2EA 2OKNA 1ZYRF 1QNTA 2B3HA 3CDHA 1D5VA 4A0XA 5ILVA 1HQCA 1FP2A 4U6WA 2HKOA 1C0WA 1TNSA 3EDPA 1FT9A 1JXSA 1YG2A 1P6RA 1SMYF 1YW9A 1WLRA 4M74A 2VOOA 2MH2A 3E6MA 3HRUA 3WE2A 4S01A 2ZFWA 1BJAA 4U6EA 1YJ3A 1L3LA 3CTZA 1ZGAA 2Z33A 3F23A 3CUQB 2MD5A 4HAMA 1BC8C 1VTNC 1UHMA 2DQLA 4IF7A 3L7WA 2KIMA 1OR7A 1BIAA 3E6CC 2IVMA 2A68F 2PI0A 4IU6A 3N4MA 2NAZA 1Z1DA 1ZG1A 2OD5A 3FM5A 2GU6A 2LNBA 1B6AA 3KETA 1KU3A 4HLXA 3KP6A 3ZMUA 4O3MA 1TW3A 2JRTA 2H6CA 1H9GA 3V7SA 1MKMA 1XGNA 4NHJA 4A0ZA 3J7AO 2XKPA 3TOBA 2FNPA 4M9ZA 4WF2A 2P7VB 1SFEA 3MWMA 3VFZA 2Q2EA 1W7PD 1H0MA 3GW2A 3KZYA 3KCCA 3F8MA 1YS7A 5D8LB 1F9NA 4IHSA 4N9HA 3JW4A 5IT3A 1XGSA 4IDYA 3IHUA 2IW2A 3PQJA 4L9VA 4ZZLA 2P7CB 2GG9A 3TKYA 3KP3A 3FF5A 4FLLA 4RB3C 5A2QZ 1RUNA 1ZN2A 4L9TA 2UZKA 4RGXA 4LMYA 3E5XA 1ON2A 3JTHA 2L01A 3LSTA 3DFGA 2P8TA 1DPRA 1R7JA 1HXDA 2A69F 1R22A 2BHBA 4KMUX 2CO5A 1XCBA 3R4KA 2NQ6A 5D5UB 5CJ9A 3I64A 3RKXA 2JTVA 3DEUA 3T0YA 1FP1D 5BPDA 1IAWA 2EVMA 2Q0OA 4PCQA 3F6VA 5E18F 2HOEA 1ZRDA 1XD7A 4WX9A 3Q6DA 3W6JB 2ACJA 3V8LA 1K78A 2HTSA 3MX6A 2BB7A 3QP5A 3VEPA 2D45A 1IN8A 3KE2A 3ROUA 1B9MA 4A5MA 5DCMB 2EVCA 3MQ0A 1IN7A 2HQRA 5L3EA 3NQOA 4AWXB 5E1ZB 3LA7A 2JT1A 1LNWA 3L7GA 1ODDA 1QQIA 3QP6A 2E7XA 2CW0F 2Y48A 2VODA 3TAVA 4U0WA 4JUQA 1T98A 1YIOA 3KZZA 3M8FA 3R0JA 4I0BA 2GA2A 2F5DA 5LHGA 4P96A 4P5OA 4S00A 2GU4A 1X3UA 2L4MA 1ULYA 1UB9A 4HZFA 4XLPF 2ETHA 3LFKA 4LGWA 2GGCA 2OBPA 1Z6TA 1USSA 2Q93A 1MDMA 2G6PA 4XSZF 1DP7P 2L02A 3P9KA 4HX7A 5L3GA 4ZWOA 1KP0A 1C27A 3T8RA 4R79A 3CJNA 4BH9A 3ZN1A 2CWEA 1FSEA 3RORA 3EYYA 1LB2A 1B59A 1R23A 4S2RP 4UV9A 3S2WA 4G94A 3K0LA 4L5JA 1G4DA 3R6SA 4QLCU 3QU6A 4ZWPA 2GG8A 1B9NA 2HFHA 3SZPA 4Q5SF 1WWXA 5FCHA 2EV0A 3F22A 5H6QA 3EETA 5CLSA 1LEBA 1U5TC 1C22A 4YIFA 3OV8A 4L9NA 2OAZA 4XBFA 1XCVA 4UUVA 3ZPLA 3SZTA 1ZARA 3IRQA 2FF4A 2BBYA 5E20A 2JZYA 3PFIA 4ZNGA 4XRFA 2CSOA 4QR8A 2EA4A 2AS5F 3QPHA 4IVNA 1R1UA 2ZNZA 1MJBA 1RZ4A 2BGCA 4IRGA 2QWWA 1P4WA 2XAFA 1O0XA 3IKTA 1M35A 4AIHA 2DW4A 3HTSB 4HV6A 1MJ9A 1DUXC 2DAOA 5LEKA 4U76A 2NQ7A 3BDDA 1ZG5A 2BYVE 4S05A 3HSRA 4I7HA 2D1VA 3O6BB 1XB4A 3ZQ7A 4Q47A 5CE6A 1I1GA 3HSEA 4U70A 4A2UA 3U9GA 5DUIA 5CNXA 1HKTA 3MZHA 3HTUA 4ETSA 4CZZA 5FLXK 4PNCA 2QZ8A 1G3WA 2ZJ2A 4MNUA 4BHPA 1DDNA 2RVCA 3HIFA 4YG2F 4FX0A 2HR3A 3FXUA 4EV0A 2GWRA 4OMYA 1YW8A 3B73A 3JAMZ 4M9XA 5D5VB 1FWZA 3ABTA 3WTWC 4BHBA 1SMTA 1W5SA 1PP8F 2FE3A 4U0VA 3CLOA 5HDGA 3C18A 3MZYA 3GEZA 2DK5A 4LFUA 1IXSB 3VOEA 1MGTA 2VBYA 4JK1X 1R58A 1CF7B 1W2MA 5HDKA 3C7JA 1WI9A 3BIQA 5LGNA 1ZH5A 4A12A 1LDJA 1OYIA 3WTYC 1C21A 1SAXA 2GG2A 2H27A 4M6XA 1XSXA 2DQRA 2F5EA 5CDVA 4PV4A 2LSOA 2PQ8A 5CVVA 2L3DA 3GUDA 4U1BA 4U73A 4KICA 2W25A 2V1UA 2UXXA 3V4GA 4MTDA 1W5TA 3K69A 3I4PA 3VB2A 4IKRA 4IF4A 1IUYA 2STTA 2HGCA 4R60A 3REOA 2VT3A 2O8XA 2XGXA 1PUEE 1XDSA 1P2FA 5BQTA 1FYLA 4UNOA 2PLYA 2KIUA 2M45A 2OQRA 3WG9A 2W85A 3WGIA 2ZBKA 1G3SA 2E1CA 1LDDA 4G7HF 3RJPA 4N0BA 3LA3A 4UXNA 1KGSA 2HDCA 5F64A 4ZWUA 2V79A 4RAZA 2MLKA 3J80Z 2P99A 3J81Z 1S3JA 4EJWA 1HBXG 1S7AA 3IRRA 5DCFA 3PQKA 1MDMB 4YFXF 3ZN0A 3ULQB 1J5YA 2DPUA 4EJTA 2FMLA 3PKDA 3MFKA 3L00A 4RS8A 5L3FA 3JSOA 2FU4A 3MAJA 2JPCA 5CDLA 1QXZA 4M73A 5LRRA 4EM2A 1SD7A 3BJOA 3H3ZA 2VOPA 2GG7A 2P5LC 1K79A 3GFJA 2QBYA 2XRNA 1B4AA 4U6CA 2CG4A 1ZLKA 1XGOA 1JHHA 4L9JA 4O5VA 1XNZA 4H0EA 4U7DA 3FM3A 1WQ2A 3E6BA 4XLNF 3CUQC 5HDNA 4L5IA 4HLYA 3LAPA 1O3SA 2RNJA 1F4KA 3TB5A 2XAHA 4M71A 1FZPB 4FKCA 1TNTA 2IA0A 1L0OC 1XN7A 2HYGD 2WWYA 1BI3A 5DYMA 1ZLJA 1U6GA 4HF1A 5D6FA 2Q95A 4IKSA 2XKOA 3V7RA 1P4XA 1D3YA 2OZ6A 4IJAA 5AIQA 3SXYA 4ENNA 2BWUA 1B1BA 5J8FA 4MEYF 3GO5A 5E8GA 2R3SA 4EJVA 1OMIA 1LVAA 1IN6A 2FSWA 3K2ZA 1TQMA 1ZGJA 3CO6C 1GXQA 4S04A 2GZ5A 5BPIA 1XMAA 2BEOA 1FSHA 3BROA 2QM3A 3E5UA 1R5HA 4WCGA 3JTGA 1F1ZA 2GU7A 3V7CA 5LEJA 2BE5F 2Q94A 2WV0A 3GZ5A 1J0RA 4LK1F 2VT2A 3E6DA 2IA2A 2PMHA 4B28A 1A04A 2IA1A 3Q5FA 2FEZA 2ISYA 3EUHA 2RQPA 5BMZA 4IPAA 4RGRA 3L09A 3N97A 2YSRA 5DEQA 3DKWA 4PGGA 4WXDA 1D8KA 1FPQA 4U0YA 2QLZA 4OOKA 1BIBA 3IL2A 3W6KB 4KNYA 3EYIA 5A2QK 2FQ3A 3WU1B 3AAFA 2P9AA 2KKOA 3NEUA 1LQ1A 3GWZA 2B3LA 3ISPA 2HEOA 3ML6A 3WE3A 3TQNA 2DTRA 4RB2C 3LQRA 2MH9A 2QYOA 2DU9A 2L4AA 1P4AA 4KIGA 2XROA 3I71A 3ABUA 2YR2A 3RYPA 4UVCA 3BIPA 3WTZA 1WKMA 1JE8A 5D5XB 4NB5A 5IT9Z 3DF8A 5CVJA 3P7NA 4LLGF 4M72A 1IF1A 2MC3A 3BP8A 3G73A 2YPRA 2P6SA 1XGMA 2ZO4A 3V8KA 1FX7A 1PDNC 1FYMA 2NYXA 3F8FA 2P4WA 2RC4A 4RZZA 2XUBA 4HX4A 3RIRA 4R1HA 4D0PA 5CIKA 2PFBA 3BJAA 2TDXA 2DFIA 5FFXA 5E1XA 3M1EA 2IW5A 1I27A 1JHFA 4U7BA 2DBBA 2IP2A 3I5UA 4EQQA 3KLOA 3R0AA 4OIOF 1RI7A 4FUKA 1J9IA 1SD5A 1IN5A 4A6DA 1U3EM 1BN5A 2QVOA 4JBAA 1YS6A 1T39A 2PG4A 2GXBA 4A5NA 2DK8A 2EB7A 3GX4X 2NS0A 3WTSC 1HSJA 4ZYEA 3BPVA 3HHHA 2FNAA 1REPC 5TRDA 5L3BA 1IXRC 2QQ9A 3IKVA 2JSCA 2J5PA 3PKBA 4IRHA 4OOIA 2PBIA 4Q48A 4IKUA 1XMKA 3TGNA 3U1DA 4HOBA 1UFMA 2XIGA 2KJBA 4CXFA 1QZYA 4GCVA 3O3KA 2K4JA 4LG0A 3FHZA 4EGYA 1G3YA 1G6NA 3IU7A 3C1DA 4OU0A 1IW7F 1YQAA 5LRSA 1UHWA 4QWQA 1IN4A 2P98A 1ZAOA 2QBYB 1TLHB 1I1SA 4ESJA 1J75A 1HW5A 4WK8F 4KIBA 4IECA 4HV5A 4RAYA 4Q4ZF 3RTRA 4LB6B 2H09A 5J6XA 5ICEA 2BWYA 3L24A 2E7WA 5K1YA 2GG5A 4IRIA 5H6RA 2A61A 3FMSA 3HOSA 5CVIA 1Q1HA 4A0YA 2G7HA 1R1VA 2O3FA 1O7LA 5K5QA 5ED4A 2RKHA 3I58A 4EJOA 4CDGA 1ZG3A 3KFWX 4M6YA 4KN7X 2A6HF 2C6YA 3GLXA 4HDVA 2EVOA 5FGMA 1W4MA 4KFCA 3CUQA 4U69A 4Z7MA 1SD6A 2ZMEA 1I6XA 4AD9A 2Z99A 1FBSA 1R5GA 1P92A 4KMFA 5E5BA 4OMZA 1K7AA 1QZZA 4GO1A 2EV5A 3KEOA 2HZTA 5CYVA 1O3QA 5EEGA 3P9CA 1YTYA 4L0ZB 3SHFA 2M8EA 3L9FA 3M7GA 4GGGA 2BHDA 3F6OA 5FD5A 1Y1NA 4KT5C 1D8JA 3LAJA 2EFPA 1C23A 2KIFA 2O6GE 2HKXA 5D6EA 2ESHA 4EVIA 1WRJA 2K4BA 4GYGA 3JAMK 4B8XA 2P6TA 3O2PE 1FNNA 5KK1A 2V6CA 4YIIA 5ICGA 4RGUA 3BWGA 4BQAA 2NRAC 2ESNA 2HYFA 3PKAA 4AIJA 3NRVA 3SQNA 2K86A 4A6EA 3TO9A 2QUFA 5E17F 1MD0A 2HWVA 2GTXA 4A6VA 1HW1A 2F5CA 1LJ9A 2G7UA 1KQ0A 2FRHA 5LHHA 2V3YA 2XVCA 4WXCA 2X0LA 3GFLA 4A6WA 3GF2A 1FBQA 5EEHA 2BHCA 4OINF 3F8NA 4G7OF 3MCZA 1OYYA 1ON1A 1GXPA 1KU2A 2FA5A 1E17A 3IG4A 2RGVA 4IXAA 3KP4A 4Z2YA 3BPXA 3KP7A 2Y0MA 3KLNA 4CICA 2YU3A 1KQ9A 2VC0A 4FLJA 2M87A 1S29A 3CTAA 3LWFA 4DQ2A 3BY6A 3BOQA 1U8RA 2M30A 4Y17A 1QXYA 2Z5UA 2EFOA 2V3ZA 4I09A 3KP5A 4P9FA 1K78B 4YFKF 1ZHFA 3B02A 5LHIA 4HBLA 2J5OA 2QQAA 2XASA 3GVAA 5D5WB 3I54A 1O57A 2EFWA 1K6OA 2PJPA 3M8EA 2ZNYA 3KEQA 1OPCA 3E97A 3P9IA 4XSXF 4G8XA 3IU8A 5J8CA 3J80K 2ZXJA 1QO0D 1T0FA 3IC7A 1A16A 1F5TA 4RGZ1 1U2WA 3OOPA 2UXNA 4KUMA 4DNCA 1ZREA 2HTJA 2XHKA 1PV9A 5ILSA 2JPBA 3DPTA 4L0YB 5ERIA 2YX4A 1GVJA 1HKSA 1WL9A 3FMRA 3LQQA 1R36A 2XV4S 1QGPA 1BI2A 4G7ZF 2Y75A 1KA8A 4I2OA 3D0SA 1BI0A 3FXQA 2GZWA 2ZCWA 4BNCA 3TO7A 5D8KB 3WTXC 3ZMSA 4EGZA 5ICCA 1RIOH 3V8JA 5LLQA 2FBKA 3TDUC 2V1XA 1OKRA 5L3CA 1E2XA 4HX8A 1Z7UA 1YLFA 2VBWA 5JHUA 4HXXA 3FWEA 2ZSGA 5CVRA 5HS9A 4IHTA 2BV6A 2Q92A 3T1BA 2GXGA 4GXOA 3K1PA 2EFNA 3FX3A 3HUGA 2DPDA 1W7VA 4ENMA 5ILUA 4R8HA 3I53A 3ZMTA 4U88A 1S8NA 4ZYGA 4P55A 3QRFF 3MEXA 2ZMEB 5AIPA 3K1NA 2XAJA 1TW2A 1IZ1A 1U5TA 5TJJA 2LKPA 4FO8A 3CO7C 5E1WA 4MHGA 2MBFA 3COAC 3RKYA 1MATA 4RB1A 4KDPA 4LD5A 5F6FA 2WTEA 2P5VA 3HRTA 4ASNA 3ZMDA 2IT0A 4RB0A 1R1TA 4ZYDA 3F72A 1U78A 2BWSA 3RKWA
chains in the Genus database with same CATH superfamily
4FX4A 3ASNH 2XAUA 4NC8A 4CHUA 5DV5A 1SFUA 2Q96A 2FBIA 3S3NA 1EJ9A 1X1BA 5HS8A 1VNDA 3VDXA 2VE9A 3MKWB 2EILH 3AG2H 2VQHA 3LSKA 2IS2A 4FT8A 3S32A 1LDKB 2JJ7A 1MNDA 1NHAA 4MATA 4HYEA 4B09A 4FCYA 5C44J 2FBHA 1QPMA 1ETYA 4F3QA 4KN4X 4BQOA 1PUFA 1V4RA 2M5WA 2E2JJ 1JGSA 2AQFA 4IEJA 4EM0B 4ESBA 3D5SC 2GU5A 4F92B 1OCRH 3B6AA 1AU7A 3K4BA 3LSGA 1KU7A 2QENA 4XLHA 3WHBA 1XTAA 2N8GA 5DM6F 5IT9K 2EA2A 3VODA 2UWMA 2WAQA 1LEAA 5HS7A 1JAWA 1TTYA 3M3YJ 4IKTA 4OIRF 2MA3A 1BR4A 2KL4A 3HB9A 9ANTA 2DMUA 4UB8C 3CCQI 3VWBA 1S6LA 3LA2A 1VQ9I 3S1MJ 2IJLA 3D27A 2TRTA 2R7SA 1SD4A 4IL6C 4DZJA 3S6BA 2PMZA 2IGKA 3ECHA 3LSJA 2EPFA 3BCBA 3H3UA 1Z9CA 1TWAJ 4ESFA 2STWA 3A1YA 4Y4RA 5JHFA 4U6JA 4BS9A 3ZMVA 2DLLA 4HSTA 2WC2A 3BTJA 3WODF 1CF7A 3SEQA 2CYYA 1QZEA 2FMYA 4A3DJ 2GG0A 5LBQA 3QU3A 1J59A 3F21A 5BOXA 3EQLF 2VONA 3AFHA 1V3FA 3DXJF 5CDEA 4AVZA 2R7VA 3FHNA 1EH6A 2HOAA 1FMWA 4I01A 3TMOA 2L54A 3H92A 2DYRH 2OCEA 4PJNA 2EK5A 1EH7A 1MMGA 4NNJA 2EIMH 2FXAA 3OYKA 4G6QA 3LOCA 3FMQA 3CC4I 1UMQA 1LFUP 2GAUA 1AHDP 2WY7Q 1YRNB 1BW6A 2PJRB 4CYDA 5FO5A 2GG3A 2D2WA 4M6VA 5K5RA 1R4NB 4B48A 1RRJA 2BWWA 5FROA 4MEXF 3DPLC 5M3MJ 4MFEA 1WI3A 4HA8A 3SYTA 2R5ZA 1AOYA 1W7PA 2EWNA 4BYYA 5EG0B 1IRFA 5C3EJ 2KMUA 2ZJPF 1T6SA 5EJCA 3I59A 4HSRA 5AONA 2B3KA 3RVAA 1QHGA 1BC7C 1BR2A 2K02A 5ICFA 2FOKA 2F48A 4CYCA 4M3DA 3RPUA 5HVQC 3DU6A 2YX7A 1N51A 4Z6YA 3BG3A 2FJ1A 2KQRA 1D0XA 1WN1A 2HI3A 3FXMA 3NAUA 3CB5A 4CCNA 4U6ZA 4HNTA 4D7MA 3HRMA 2IPQX 1YYVA 4LLLA 3K4LA 4ZH4F 3H0DA 4ZTFA 2Y31A 1X3WB 2CW7A 3LSMA 3TP0A 4MTEA 3DCFA 4CZCA 2LR8A 3WGGA 1O7FA 4E70A 3E5QA 2KJCA 1T2KA 3BTIA 2R0QC 2DT7B 2LC2A 3OYIA 4MGRA 3CP2A 1WSUA 2GIVA 4MQ9F 3BR0A 4XKWA 1R4MB 3D5LA 1V54H 3RZOJ 4O6JA 3HOZJ 3S17J 3CMEI 3MKZA 1V5FA 2DODA 2IAIA 3DP7A 4IQ4A 2DA3A 4UVBA 3GTMJ 4PDKA 2BHAA 1BI1A 2LF7A 2DT5A 1S7OA 4XN0A 5KVRA 5J3LA 4IX7A 2XAQA 3DBHB 3DTIA 4ENJA 2K7LA 1QXWA 3FIWA 3HOTA 1OQYA 3C2GA 2X4HA 2CU7A 2E2IJ 4CO8A 1VQNI 1R71A 3L2WA 2EZHA 4JQFA 2RAEA 3HSFA 4F93B 3SFZA 1N75A 1OLTA 3DBRB 2W84A 5CVUA 1SEUA 5K7HA 2NNYA 2Q8KA 1X1AA 2LG4A 3K70D 2JN6A 2K85A 4II2A 4OAYA 1BM9A 3SDGA 2WAQN 1VF9A 3DKXA 3S1QJ 3ABMH 5J1RA 4S2TP 4BBSJ 2RV8A 3RCOA 5EZHA 3C3WA 2ELHA 4W1UA 4I02A 1W0UA 3F8BA 2DDBA 2XAGA 3HEFA 3ONQA 3QYEA 4BHCA 2DXIA 1E0EA 2E36A 3J7YJ 1A6QA 2DI3A 1S72I 2PMZN 3ZMZA 1OR7C 1WCMJ 3GFMA 1HSTA 3FZVA 1MJAA 2A5YB 1Y1VJ 2LBFB 3U2RA 2EV6A 5IPAA 2K3FA 2VXZA 4BAYA 3IU9A 2F6CA 3LFUA 3JSPA 1Z91A 3Q9VA 2IRFG 4M9SA 5JI6A 2JSPA 2RDPA 5HLIA 4LB5A 3IH3A 1DQUA 4HQMA 3OIOA 1MNMC 3HHGA 4WWCA 3QODA 2ELJA 1B72A 2V26A 3PKCA 3GZNB 3IWZA 3TOAA 1TQPA 3A01B 2IS1A 1QA6A 1RKTA 5H20A 2R93J 4CGZA 1NTCA 1NK3P 1FEXA 4HF2A 4U71A 4XMYA 3UKGA 3HUGB 2BXYA 3MN2A 4G6DA 5B3SH 3DEWA 2DO7A 3EUHC 1I5ZA 1PP7U 4D9JA 2M7AA 5EYRA 4RZYA 1P9QC 2EJRA 3G1OA 4AM3A 2M0CA 2K5CA 3F3XA 5L3DA 1LVKA 1QBJA 2W24A 1BBYA 3RPQA 1XSVA 2ZJQF 3L2UA 4WXHA 1A6IA 2KPMA 5K7ZA 1K4SA 2MC4A 1U5TB 1Y0UA 1G3TA 4IZZA 3K1MA 2KZVA 4D5FA 1JKPC 2OZUA 2D1HA 3I9V2 1O3TA 2DJNA 2W57A 1TBXA 4HDUA 3OYLA 1YFHA 1KYZA 1T95A 2H6BA 2OQGA 1H9TA 4YFNF 3TDZC 3I4MJ 4Y52J 4UHTA 5FKNA 3OL3A 4U75A 2CQ7A 3WTTC 1EF4A 4N9IA 3MATA 3IWFA 1VZ0A 5DD4A 4TV7A 3X2QH 4RLQA 1BOAA 1WL6A 3OIQA 4PGHA 2ZSHB 1FYKA 1YITI 4M3FA 4KA4A 3Q9SA 1HDDC 2ZC2A 1MZBA 1X2NA 2OU2A 1Y1WJ 2RN7A 4N4OB 1IRXA 5F08A 5BS6A 2EQRA 1FC3A 2KFDA 2YS9A 5HLHA 3OYDA 1G59A 4I0AA 5JFRA 5FCFA 5DDGA 5D4RA 1KU9A 4E7JA 3CB6A 2L7MP 4XM3A 2HPMA 2VBXA 1MBFA 1ONVA 2O0YA 4XK4A 5JR3A 2BH3A 4MQVA 3MD2A 1IXCA 2V3XA 1F36A 1XG1A 3WTUC 1OYWA 2V1DA 3K2AA 2LFBA 4E7HA 2PEXA 3ECOA 3WU0A 1YW7A 2BY0A 1TWFJ 2PMUA 1UCRA 4D7NA 4DOZA 4GFBA 2O61A 1IDZA 2MD0A 2VJ5A 2VB6A 3SJMA 2BWXA 2HQNA 5LFAA 1POGA 5FLXZ 4FLIA 4EMSA 1PUFB 3WTVC 4RDUA 5DD8A 3MKYB 3CF5F 4OIQF 4EM1A 3FXJA 3T5XA 4AVPA 3M07A 4KT6A 3I0TA 3OYFA 4AIKA 4RGSA 3Q0UA 2Z3YA 2GQQA 5K5OA 2O03A 2R7FA 3D5RC 5JLXA 1FTZA 2BWTA 4JX6A 4GYIA 4EGEA 1FBUA 3FXRA 3R61A 1X4PA 2ADUA 3GTQJ 2RNGA 4NBQA 3ZQIA 4OWRB 4XRSA 1Z6RA 2A3SA 3GXOA 1YX3A 3GTKJ 4BXUA 1HKQA 2PN6A 3TBIA 1CGPA 1AWCA 1C24A 2BN7A 1J2XA 4QSHA 1XSDA 3DV8A 3DQVC 2JA8J 1SFKA 4PSXA 2HVRA 2LDUA 2M3AA 2R7DA 1BR1A 2F5FA 4BDZA 2A05A 3ERMA 1SFXA 5HLTA 5JVTA 2ISZA 1MSEC 1TWCJ 3GFIA 4KIFA 2B0LA 2KLOA 3PKEA 2A07F 2L7FP 2V9VA 4U87A 1KYWA 3KIOA 4UV8A 4XKCA 4XLFA 2L2OA 3OSFA 1K4TA 1T38A 3GZ6A 5GAEJ 4L18B 2GA1A 2BWVA 4EJUA 2XF5A 3CUOA 2HPIA 4Y15A 2ZKZA 4F7ZA 4LLNA 1FLIA 1KQ8A 2KT0A 2NNNA 4HW0A 1FOKA 4XONA 1P7IA 4XOPA 4I76A 4UVAA 1X1PA 4IQJA 4XRMA 2VN2A 3KP2A 1QU3A 2QGUA 3K4JA 5KNLA 2HOSA 2EFQA 3HZJA 4KYWA 5D4SA 3AL0C 2MABA 2K9LA 2A6EF 3HRSA 3M9AA 3C2BA 1Z05A 5M3FJ 3QAHA 1DPUA 2BVLA 3W2VA 2LF8A 3BZ6A 3KZIC 4E7KA 3RYRA 1RNLA 1W7PB 2CFXA 1STZA 3FKJA 3BJ6A 1FY7A 1NK2P 2COMA 4Y13A 3HJEA 3I59B 1ZRFA 2OA4A 5KCMA 3HKZA 2QQBA 2G9WA 4LJZF 5FFZA 4CYCB 1RUOA 5DCMA 2L9RA 3OYEA 1Z67A 2P81A 3HYIA 3K9TA 1CHMA 2HOWA 1SFOJ 3BITA 3GYHX 1TC3C 1I6HJ 3J81K 3QOPA 3A0HC 5F1RA 1Z77A 1YO5C 2VBZA 2VE8A 2MLGA 3L2CA 2H94A 3WGHA 1V5EA 4G9YA 3QYBA 2Z9OA 1IRGA 1X2MA 1ORKA 2DMPA 2KRFA 1ZRCA 3TO6A 5FB2A 5FD6A 1WFXA 2CQKA 4JOMA 4P9UA 2AXTC 3QPTA 2LLKA 3ZP5A 1OCPA 2KHMA 4DYQA 5LGUA 1GDTA 3CC7I 1WBQA 1T56A 2QCOA 1TQIA 3VYUB 3T8TA 4HQEA 3QQAA 3RDIA 4NQWA 4ZZDA 4LK0F 3ERED 5J1UA 2DA4A 1YVMA 1EH8A 1TT0A 3UNGC 2EIKH 2CGPA 2XF6A 4ON0A 4LG0B 1WY2A 3GCMA 1USTA 2XGEA 3IAM2 5HOOA 1R00A 4I98B 2K27A 1VQ8I 2GBYA 3G3ZA 2E1NA 1GHCA 1D1CA 4OIPF 1JKQC 2X9DA 4AU7A 3K4NA 1J7KA 2HS5A 2OJED 5HLGA 3F8CA 4ZYHA 4A3MJ 4HF0A 5E8IA 3PUFA 4FO7A 4ENKA 4FHTA 6PAXA 2A6TA 2BY2A 1IC8A 1HW2A 4KM3A 3QYFA 2F5VA 2VC1A 2HOTA 2P5KA 2M1BA 4B1RA 1CQTA 2AXLA 2HXIA 2GGBA 2DA2A 2JA6J 2MATA 1DP3A 3ELKA 5DUKA 5GADJ 3RI4A 3S8PA 2F2EA 1BA5A 5LGTA 1O3RA 2R7ZJ 3R60A 1TWGJ 3G6EI 2I5UA 3S3MA 3E3VA 4PZJA 3IH2A 3HOWJ 4DYRA 4A3LJ 5BNGA 3MR1A 4FLKA 4BY7J 1EV7A 1XDUA 3HPHA 3PIOF 4K2EA 3OS1A 2OKNA 1ZYRF 4ZDLA 2ELKA 1IDYA 4MIMA 1QNTA 2B3HA 2OUMA 3CDHA 1D5VA 3OR1C 4A0XA 3VYRB 1AKHA 4A3EJ 5ILVA 1HQCA 1FP2A 2XPWA 3H3VK 4U6WA 2HKOA 2V4JC 1C0WA 1TNSA 3EDPA 1FT9A 1JXSA 1YG2A 2JMWA 4LG3A 1P6RA 4DZPA 3BR3A 1SMYF 4BBRJ 4YIRX 1YW9A 2B7EA 2VQGA 3CCEI 4M74A 2VOOA 1WLRA 5KHDA 2MH2A 1U9NA 3E6MA 2XGDA 2ICWG 3HRUA 3WE2A 2BW3A 4A3FJ 4S01A 4FE4A 1QRYA 2F4MB 2ZFWA 1BJAA 2VKEA 3K70C 2R7WA 4U6EA 1YJ3A 1L3LA 3CTZA 1ZGAA 2Z33A 4XKVA 3F23A 4M3EA 3CUQB 3ZCOA 2MD5A 1VQLI 4HAMA 1BOBA 1ETWA 1VQ5I 1BC8C 2CH0A 1VTNC 1ZR2A 4NC7A 5FJ8J 1UHMA 2DQLA 2IGMA 4AC0A 2R92J 4IF7A 3L7WA 3S3OA 1SVMA 1OFCX 1OR7A 2KIMA 1BIAA 3E6CC 2AQEA 2IVMA 3W2WA 3OYCA 2A68F 2PI0A 4IU6A 3N4MA 4LITA 1OJLA 2NAZA 1Z1DA 3BTLA 4BQQA 3A0BC 1HDPA 3JRCA 2KDZA 1ZG1A 2OD5A 3FM5A 1T8IA 2GU6A 2EZLA 5GTHC 2LNBA 1B6AA 3KETA 1KU3A 3GTLJ 4HLXA 4A3IJ 2HVQA 3KP6A 3ZMUA 5E3MA 4O3MA 3J7ZI 1TW3A 2K9MA 2JRTA 2H6CA 4IOCF 1U8BA 3A02A 1H9GA 3V7SA 1MKMA 1XGNA 5FKOA 4NHJA 4ZYAA 4DJAA 2O7OA 3FXOA 4A0ZA 2QSGX 3J7AO 2XKPA 3TOBA 1T33A 2FNPA 4M9ZA 4WF2A 3MVPA 2P7VB 1LPQA 1SFEA 3MWMA 1NG7A 2X1EA 1KONA 3VFZA 3OYNA 1A36A 2Q2EA 2H1KA 2CS3A 1W7PD 1Y8QB 3G71I 1H0MA 3M4OJ 3GW2A 3KZYA 2LOOA 3KCCA 2BVMA 2EH3A 4CCKA 3F8MA 1YS7A 5D8LB 1F9NA 4A3BJ 2ID3A 4IHSA 3RPUD 5HODA 4N9HA 3JW4A 4ZC3A 5IT3A 3I56I 1XGSA 4IDYA 3BLYA 3IHUA 2IW2A 3PQJA 3MZ8A 4L9VA 3BG5A 3FXKA 4ZZLA 1IGNA 2P7CB 2GG9A 3TKYA 3KP3A 3FF5A 2W4SA 2X1CA 3SEZA 4FLLA 1ZGWA 3OOUA 4RB3C 5A2QZ 1RUNA 3EUKL 1ZN2A 4L9TA 2UZKA 4RGXA 4LMYA 2JA2A 3E5XA 1ON2A 3JTHA 1X1DA 2DOEA 2L01A 2MSYA 3LSTA 3PNTA 2VKDA 3DFGA 3ABLH 2P8TA 1DPRA 3QPLA 2X6WA 3ZGKA 2JUCA 3RKQA 1R7JA 2ZXHA 3CC2I 1HXDA 2A69F 1R22A 1X1CA 1MSFC 2BHBA 2OTLI 3LSPA 2D5VA 3OR2C 4KMUX 3DU5A 2CO5A 1XCBA 3ZQFA 3R4KA 2NQ6A 4PJ0C 5D5UB 5CJ9A 4UUSA 2MW8A 1EA3A 3I64A 2E2HJ 5B1BH 3W2AA 1UJ8A 1RR8C 3RKXA 2JTVA 3DEUA 2NVUB 3T0YA 1WHUA 2R7UA 1FP1D 1E3PA 4FETA 3PL8A 3ZQCA 1UG0A 3PNYA 5BPDA 1IAWA 2EVMA 4XORA 2Q0OA 4PCQA 3F6VA 5E18F 2M8GX 2H1LA 1SAUA 3NWSA 2HOEA 1ZRDA 1JKRC 1XD7A 3OMYA 1OCOH 2NXNB 4WX9A 2DJIA 3Q6DA 3W6JB 2ACJA 3V8LA 3HM5A 2O9LA 1HOMA 1K78A 2HTSA 3MX6A 2BB7A 3AG3H 3QP5A 3SFIA 1X4OA 3VEPA 2D45A 1IN8A 3KE2A 3LSIA 3ROUA 1B9MA 4A5MA 4C9YA 5DCMB 2EVCA 3MQ0A 1IN7A 2HQRA 5L3EA 3NQOA 4CUGA 4AWXB 4BGDA 3CP8A 5E1ZB 3LA7A 2ME6A 1VI0A 2BOLA 4A93J 2JT1A 1LNWA 3L7GA 2QKMB 5EF6A 1ODDA 1QQIA 4EEFG 3QP6A 2E7XA 2CW0F 2Y48A 3BZKA 1GUUA 3DKYA 2VODA 3TAVA 4U0WA 4JUQA 1T98A 1YIOA 3KZZA 3M8FA 3R0JA 2VASA 4I0BA 3H9GA 4JYKA 2GA2A 3JRHA 1WJ5A 2F5DA 5LHGA 1ZQ3P 4NQWB 4ABZA 2XC7A 1GVDA 3G1LA 4P96A 4P5OA 4S00A 2B63J 2GU4A 1R9TJ 1X3UA 2L4MA 1ULYA 1QPIA 1UB9A 4HZFA 4XLPF 1RC9A 1ACIA 1ZKGA 2ETHA 3LFKA 4LGWA 5IYDJ 2GGCA 2OBPA 1Y8RB 1Z6TA 1USSA 3LL7A 2Q93A 1MDMA 2HDDA 4AUXA 2CV0A 2G6PA 4ZTJA 4XSZF 1DP7P 2L02A 3P9KA 4HX7A 5L3GA 2W1OA 4ZWOA 1KP0A 2RREA 1C27A 3T8RA 4R79A 4FTHA 3L1PA 3S14J 4BQNA 3CJNA 4BH9A 3ZN1A 2CWEA 2NVXJ 1FSEA 5M5WJ 3RORA 1OCZH 3EYYA 2IGNA 1LB2A 1RPWA 1B59A 1JKOC 4G12A 1R23A 4S2RP 4UV9A 1JT0A 4NC6A 5B66C 1TP4A 3S2WA 4G94A 1E3HA 3K0LA 2A5WA 4L5JA 1G4DA 5H2FC 3R6SA 4QLCU 1JI8A 3QU6A 2H8RA 3FDYA 4ZWPA 1FTTA 2GG8A 1B9NA 4XICA 3D1NI 1FJLA 4V2FA 4X0GA 1Z0XA 3CMYA 2HFHA 3SZPA 2DMQA 4Q5SF 2V9PA 2OC6A 3CCYA 1D0YA 1WWXA 5FCHA 2EV0A 2DDAA 3F22A 5H6QA 2HDWA 1AKHB 2WB1A 2OPTA 3EETA 2FD5A 1R49A 5IYCJ 5CLSA 1LEBA 1FIAA 1MBEA 1WPKA 2NVYJ 1U5TC 1C22A 2M2EA 4YIFA 3OV8A 4L9NA 2OAZA 4XBFA 4A3JJ 1XCVA 4UUVA 1JGGA 3ZPLA 5J4YA 1BW5A 1HF0A 1JUPA 3SZTA 1ZARA 2XPUA 3IV5A 5JLWA 4CCLA 2BW3B 2NS7A 1A31A 3IRQA 1WH5A 3IP4B 3PJRA 3VSLA 2FF4A 2BBYA 1DGWY 5E20A 2JZYA 3PFIA 2Y0SA 4ZNGA 3FISA 5EGOB 2XGCA 4XRFA 2NVQJ 2TCTA 2CSOA 4QR8A 2EA4A 2AS5F 1UHSA 2VL8A 3QPHA 4IVNA 1R1UA 1RKWA 2ZNZA 1MJBA 1RZ4A 2BGCA 3J7AY 2KIQA 4IRGA 2QWWA 1P4WA 2W00A 2XAFA 3DLAA 1SVLA 4BACA 1O0XA 3IKTA 1M35A 2IBDA 4AIHA 3Q0VA 2DW4A 3HTSB 4HV6A 1MJ9A 1DUXC 2DAOA 1WJEA 1R6RA 5LEKA 1Z3YA 4U76A 3DLLF 3BZCA 2R5YB 2F4OB 2NQ7A 3BDDA 2R4GA 3H5RA 3U21A 1ZG5A 2BYVE 3O8GA 3HSRA 4S05A 4FISA 4I7HA 2D1VA 4A3CJ 2JVHA 5EEAA 4XQFA 5GAHJ 3O6BB 4CH7A 3OSGA 4KISA 2M34A 1PVEA 1XB4A 2QF7A 3ZQ7A 4DGWB 2V6EA 4D5CA 3OYMA 2X1DA 4XRSG 2LY1A 4Q47A 1YE9A 5CE6A 1I1GA 3HSEA 4BY1J 4U70A 4XLEA 4PJMA 1M1EB 4A2UA 2GOMA 3Q0WA 3U9GA 4C3IJ 1ETQA 4RM2A 5DUIA 4CCOA 3HOUJ 5CNXA 1HKTA 2LP0A 3MZHA 4IKFA 2DA7A 3HTUA 4ETSA 4CZZA 5FLXK 4D1QA 4PNCA 2QZ8A 2Q2EB 1G3WA 3CCMI 2ZJ2A 3H1CA 4MNUA 2ECCA 2WAFA 5IOYA 4BHPA 1DDNA 5E3LA 1A35A 2VPLA 4DBRA 1JTXA 2Q1ZB 2RVCA 4G6TB 2IS6A 3HIFA 2DA5A 4YG2F 1DGRM 3LSHA 3M1CA 4FX0A 2HR3A 3FXUA 4EV0A 4HNVA 2GWRA 4OMYA 1YW8A 3B73A 1DU0A 2XRLA 3JAMZ 3KYCB 3K7AJ 4M9XA 2O8KA 5D5VB 3H5NA 1FWZA 3ABTA 3WTWC 4BHBA 1SMTA 1W5SA 1PP8F 2LKXA 2FE3A 3M8JA 1SC7A 4U0VA 3CLOA 1Y39A 5HDGA 3C18A 4H4KC 3MZYA 4A3KJ 3GEZA 2E35A 3DTKA 2DK5A 4LFUA 1RR7A 4XL9A 1VQ6I 3OS2A 1IXSB 3VOEA 2LREA 1MGTA 2VBYA 3K4CA 4JK1X 1R58A 4A69C 1CF7B 2BY3A 1W2MA 5HDKA 3C7JA 2WB1N 3PNVA 1WI9A 3BIQA 3OY9A 5LGNA 1ZH5A 4A12A 1LDJA 1OYIA 5E3OA 3WTYC 1C21A 3EUAA 1SAXA 3S16J 2GG2A 2M0MA 4PFPA 3IH4A 4BJ6C 4UUSB 2H27A 4M6XA 1XSXA 2DQRA 2OV7A 2F5EA 3HDDA 4XLAA 3QPSA 5CDVA 4PV4A 2LSOA 3CMMA 4M3GA 2PQ8A 5CVVA 2L3DA 3GUDA 4U1BA 4U73A 4GDFA 4KICA 2W25A 2V1UA 1F43A 2UXXA 2EZKA 3S93A 2Y0SN 3V4GA 3H35A 2I10A 3BT9A 4MTDA 1W5TA 2LYCA 3K69A 3RZDJ 1JUMA 2R5ZB 3I4PA 2KISA 3SZGA 2E5NA 2NS8A 3VB2A 3BR2A 4IKRA 1WH7A 4IF4A 4CSWA 3CD6I 1IUYA 1QVTA 2CMPA 2CUZA 4XN3A 4E7LA 2HGCA 2STTA 2PJRA 3MKLA 3ZOBA 2IEKA 4R60A 3REOA 4BL0B 2VT3A 2JWTA 2O8XA 2XGXA 1MMNA 1PUEE 4X6AJ 1XDSA 3BR1A 1P2FA 4N4NB 5BQTA 5GP9A 1FYLA 4UNOA 2PLYA 4ZDPA 1LKXA 3JRGA 4Y7NJ 2GOXB 2KIUA 2HQ5A 2M45A 2Z16A 4JX4A 3RQ4A 1W1WE 2OQRA 3PIPF 3OYGA 3FKIJ 2JUGA 3WG9A 3HL2A 2OCCH 1JTYA 2W85A 2ZB9A 3WGIA 2CFOA 2ZBKA 1G3SA 2E1CA 1LDDA 4E4HA 1I3QJ 1VQ4I 2GM4A 2WBMA 3DEEA 2VJJA 3RJPA 4G7HF 3KEYA 1AA7A 4N0BA 3LA3A 1Y6IA 4UXNA 1KGSA 4AYBA 2HDCA 1HLVA 2IS4A 4C3HJ 3H9JA 5F64A 4ZWUA 2V79A 4V19K 4RAZA 2MLKA 3J80Z 2P99A 3PO2J 3J81Z 2E1MB 5M5YJ 3OYHA 1S3JA 4EJWA 1HBXG 1S7AA 4XNFA 3IRRA 2WA0A 2VI6A 4C3JJ 1APLC 5DCFA 2BZTA 3PQKA 1MDMB 4YFXF 2XPVA 4B3XA 4PFOA 3GTJJ 1IJWC 3ZN0A 3ULQB 1J5YA 2VUMJ 2DPUA 4EJTA 3BR5A 2FMLA 3HC7A 2V1NA 3PKDA 3MFKA 1SVOA 4J01A 3L00A 4BDYA 4RS8A 3H0GJ 5L3FA 2WADA 1KZHA 3JSOA 2FU4A 3MAJA 4ANJA 4RBOA 2JPCA 5CDLA 1QXZA 4M73A 5LRRA 4EM2A 2XDVA 1MBJA 5KAFC 1SD7A 3BJOA 3H3ZA 2VOPA 2GG7A 2P5LC 1OISA 1K79A 1K83J 3GFJA 2QBYA 2XRNA 1B4AA 3CQZJ 1O4XA 3ZR8X 3E0JB 4U6CA 2CG4A 5GPAA 1ZLKA 1XGOA 1JHHA 2M4KA 3CESA 4L9JA 2COBA 4O5VA 4H0EA 1XNZA 4U7DA 1HC8A 2YUSA 1WQ2A 3E6BA 3FM3A 4XLNF 2E19A 3CUQC 4EATA 5HDNA 4L5IA 2EZIA 2LY2A 3LAPA 4HLYA 4FASD 1O3SA 2DA1A 2ZMEC 2RNJA 1F4KA 3TB5A 2XAHA 4M71A 1FZPB 4FKCA 1TNTA 5FLVA 3OWTA 1TWHJ 1B72B 2G0EA 2IA0A 5FRMA 1L0OC 1LFBA 1R5ID 1XN7A 2EIJH 2X6OA 4HPQA 3WU2C 2HYGD 3JRIA 2WWYA 1BI3A 2GIZA 5DYMA 1ZLJA 1U6GA 4HF1A 4E7ZA 2M4GA 3CDLA 5D6FA 3JRAA 2Q95A 4CA0A 4IKSA 2BY1A 2XKOA 3V7RA 1MMDA 3K4KA 1P4XA 1IV6A 1D3YA 2OZ6A 4IJAA 5AIQA 3SXYA 2E5ZA 3HGYA 1DU6A 4ENNA 2DFEA 2FUG2 1FOXA 2BWUA 1I3AA 1B1BA 5J8FA 4MEYF 3GO5A 1MH4A 1QHHD 3A01A 5E8GA 1PJRA 2R3SA 2E1OA 3PSIA 4E7SA 4EJVA 3GMEA 3U1KA 1OMIA 1HCRA 1LVAA 1IN6A 2FSWA 2VQLA 3K2ZA 5J47A 1TQMA 1ZGJA 3CO6C 1GXQA 5CQEA 4S04A 2GZ5A 5BPIA 2CQXA 1XMAA 2BEOA 2CQQA 1FSHA 4MLOA 2HVSA 3HOYJ 3BROA 4S0HB 2QM3A 3E5UA 4II3A 1E3OC 1R5HA 1S7EA 3ZRGA 4WCGA 4J19A 3JTGA 1F1ZA 2GU7A 5FLMJ 3CDIA 3V7CA 5LEJA 2BE5F 2Q94A 4C2UA 2JK3A 2F4IA 1TT5B 5EDNA 1QVUA 2EINH 2WV0A 5CQGA 3GZ5A 2JRMA 1J0RA 3JRBA 1MH3A 4LK1F 2VT2A 3OYBA 3E6DA 3L2RA 5LD2C 3OS0A 4RA2A 2IA2A 5DM7F 1ZELA 2PMHA 4B28A 1A04A 2IA1A 4ITVA 3Q5FA 2L9SA 4IHYA 2FEZA 2ISYA 3EUHA 2CUFA 4AYBN 2CJJA 2NOGA 3WHCA 3CCRI 3EPZA 1JJ8C 2RQPA 5BMZA 4IPAA 4RGRA 2V7FA 3IAS2 3L09A 3N97A 3BCAA 3JCUC 4ZDOA 1ERDA 2YSRA 5DEQA 3DKWA 3L2VA 2VKHA 4PGGA 1RETA 1B8IA 3GBGA 4WXDA 1D8KA 2HNHA 2LD5A 1FPQA 4U0YA 2CV1A 2L5QA 5HNHA 3RSNA 5FRNA 2QLZA 1Y0NA 3K10A 4OOKA 1BIBA 1ZTRA 4DYCA 3IL2A 3W6KB 4KNYA 3EYIA 3N05A 5A2QK 2FQ3A 3WU1B 1D5YA 3AAFA 2P9AA 2KKOA 3NEUA 4C2MJ 1LQ1A 3GWZA 2B3LA 3BR6A 3L2QA 3ISPA 2JA7J 4Y3OA 2ZSIB 1YJNI 2HEOA 3ML6A 2DN0A 2ZXIA 3WE3A 3TQNA 2DTRA 4RB2C 3LQRA 2MH9A 2QYOA 2Z1DA 2DU9A 2L4AA 1P4AA 4XLCA 4KIGA 2R7TA 2XROA 3HPGA 1WGXA 3I71A 3ABUA 3HOXJ 4Y33A 5F0HA 2YR2A 2W48A 3RYPA 3HOVJ 4UVCA 2DMTA 4FE7A 5IY5H 4I6ZA 3BIPA 3WTZA 1W36D 1WKMA 1XS9A 1JJ6C 1LE8A 1J09A 1JE8A 1LFPA 5D5XB 1IO2A 4NB5A 5IT9Z 2R7RA 3DF8A 5CVJA 3ZQHA 3P7NA 4LLGF 4M72A 2LRDA 3E7LA 1IF1A 4DW6A 4DIQA 4L5EA 2HYJA 5IP7J 3BQZA 1WJCA 2MC3A 3BP8A 3G73A 2YPRA 2P6SA 1XGMA 2JQ7A 5E3NA 3O8HA 1MMAA 2ZO4A 2DFHA 3V8KA 2L7KA 1FX7A 4UUTA 1FOYA 4IHXA 2LTPA 1PDNC 5FKLA 1FYMA 2NYXA 4B3AA 3F8FA 2P4WA 1GV2A 2RC4A 4RZZA 1T0FC 2XUBA 4HX4A 3RIRA 5JVGF 3GTOJ 4R1HA 3H5AA 2I8DA 1UG2A 2L7ZA 4D0PA 5CIKA 2CRGA 2PFBA 2PX9A 3BJAA 1GT0C 2TDXA 3ASOH 3ZXSA 2DFIA 5FFXA 2MFZA 1Q1VA 5E1XA 3M1EA 2IW5A 4B4CA 1I27A 4E7IA 1JHFA 2DBBA 2IP2A 4MO7A 4U7BA 1GV5A 3I5UA 3PSFA 2OF7A 4EQQA 2NOJB 2X51A 3KLOA 4KITB 3R0AA 4OIOF 1RI7A 1MW7A 4FUKA 3DBLB 1ENHA 1J9IA 1D1BA 1VQOI 1SD5A 3CJRB 3ESWB 4P1WA 5F04A 4RMNA 2GLOA 1IN5A 4A6DA 1U3EM 2K40A 1ETOA 2DTZA 1T08B 1BN5A 2QVOA 2OTJI 4BEHA 4JBAA 2ZFUA 1YS6A 1T39A 4OAZA 2PG4A 1BJZA 2GXBA 4A5NA 2DK8A 5FKMA 4IHVA 2EB7A 2ZXWH 4B44A 4PJJA 3GX4X 2Y9YA 2NS0A 5IOZA 3WTSC 1HSJA 1XX5A 1G8XA 4ZYEA 2CUEA 3BPVA 2X6XA 5F27A 3HHHA 4BUPA 2FNAA 1REPC 5TRDA 3UR3C 3DWLE 3OYAA 5L3BA 2HU9A 1IXRC 1WJBA 1N77A 2QQ9A 3IKVA 3JRFA 1K6YA 2JSCA 2J5PA 4HRIA 3LNQA 3PKBA 4IRHA 1UAAA 3AKZA 3OYJA 1XPXA 4OOIA 2PBIA 3FBNB 4Q48A 1VFCA 1K61A 4IKUA 1XMKA 3TGNA 3U1DA 1JT6A 1X19A 3AG1H 1UFMA 4HOBA 1YI2I 2XIGA 2DCEA 4C30A 1ETVA 4QTRA 2KJBA 4CXFA 1A5JA 1QZYA 1YOVB 2X6YA 4GCVA 3O3KA 2Y30A 2K4JA 4LIUA 4KJZA 4LG0A 2E34A 2UV1A 3FHZA 4EGYA 1G3YA 1G6NA 4M3BA 3IU7A 3C1DA 1ZK8A 1IW7F 2LKSA 1YQAA 4OU0A 3BTCA 5LRSA 2QEXI 1UHWA 4QWQA 3FK6A 4B47A 5M5XJ 1IG7A 1IN4A 2P98A 1ZAOA 2ECBA 2QBYB 1TLHB 2QKLB 1I1SA 1D1AA 2XF7A 4ESJA 1J75A 1HW5A 4WK8F 4KIBA 5CKTA 4IECA 1TZLA 3AG4H 4HV5A 4RAYA 4Q4ZF 2M7BA 2R7OA 3F0CA 3RTRA 4YRVA 1YIJI 3KX2A 1X58A 1UELB 4LB6B 3TEDA 2H09A 5J6XA 5ICEA 2BWYA 3L24A 1FMVA 2E7WA 5K1YA 2GG5A 2HQAA 4IRIA 3B6CA 5H6RA 2A61A 2Y2ZA 3FK7A 2DOFA 3JRDA 1PYVA 3FMSA 2LY9A 4X1EA 3HOSA 5CVIA 1Q1HA 4A0YA 2G7HA 1R1VA 2O3FA 4IO9F 1O7LA 2L9NA 5K5QA 5IYBJ 5ED4A 4MFDA 2H8WA 2RKHA 4BXFA 3BC8A 3I58A 4EJOA 2BHZA 1SANA 4CDGA 2ZJRF 1ZG3A 5F0FA 3KFWX 2VKVA 4M6YA 5C4XJ 2KP6A 2DT6A 4I99C 4RAFA 4KN7X 5TGTA 2A6HF 2C6YA 3S2DJ 3LSRA 1I39A 1YJ9I 5J1YA 4E6KG 3GLXA 1N78A 2CUJA 4HDVA 3GLLA 2EVOA 5FGMA 1W4MA 4KFCA 1NH3A 2CW8A 3CUQA 3DTEA 4U69A 4Z7MA 1SD6A 2ZMEA 3OIPA 1I6XA 4AD9A 3CCJI 2Z99A 1FBSA 4BKXA 4XIDA 1R5GA 5KAIC 1D0ZA 1WJFA 1P92A 4HNUA 4KMFA 2QSFX 3HBLA 5E5BA 4OMZA 1K7AA 2BXZA 1QZZA 4GO1A 2O5RA 4B43A 2EV5A 3KEOA 3I55I 3OL4A 2HZTA 2L0KA 5CYVA 5IP6A 3Q3SA 2KRHA 2BHYA 1O3QA 5EEGA 3I4NJ 2Y69H 3P9CA 1YTYA 3TW7A 4L0ZB 3CF2A 5IP9J 3SHFA 3VYTB 2M8EA 2ME0A 3L9FA 3M7GA 4GGGA 3G2BA 3CCSI 2BHDA 3F6OA 5FD5A 1Y1NA 4KT5C 1D8JA 3LAJA 2EFPA 4HG2A 3HXLA 1C23A 2KIFA 2O6GE 1B8IB 2HKXA 5HNFA 5D6EA 2ESHA 3CLQA 3FBIB 4EVIA 1H88C 3VYSB 1WRJA 2K4BA 2KDOA 4GYGA 4IHWA 3JAMK 1IUFA 2P6TA 3O2PE 4B8XA 1FNNA 1H89C 3ZQLA 5KK1A 2V6CA 4YIIA 4BE0A 5ICGA 4RGUA 3BWGA 2XSDC 4CCJA 4NUBA 2NRAC 4BQAA 1ZR4A 2ESNA 2HYFA 3PKAA 4AIJA 2MG4A 3IUOA 3HG9A 3NRVA 4JX5A 3SQNA 1IRZA 3K4MA 4HEA2 2K86A 5GAGJ 2B9SA 4A6EA 3TO9A 2QUFA 1G2HA 5E17F 1MD0A 2HWVA 3NWTA 3PUBA 2GTXA 4A6VA 1HW1A 3BQYA 2F5CA 1LJ9A 3CCVI 1UZCA 2G7UA 3V42A 1KQ0A 1S5LC 2FRHA 2XB0X 4QPQA 5LHHA 4BJ5C 2V3YA 2VJ4A 2XVCA 2K3PA 3CJTB 2X0LA 3I3LA 2HZDA 4WXCA 3TP3A 2FOWA 2V9KA 2VIXA 1LE8B 3BG9A 3CMAI 2DMNA 2CV2A 3GFLA 4A6WA 3GF2A 2X48A 1FBQA 5EEHA 1MMSA 1RESA 5FKKA 2BHCA 2XB5A 4OINF 1V55H 3TW6A 4UB6C 3F8NA 4G7OF 3MCZA 2Y9ZA 4BE1A 1OYYA 3HGGA 4JP0A 3RQIA 2AHQA 1ON1A 4PJLA 3CCLI 1GXPA 1KU2A 2FA5A 2WAEA 2L9VA 3W3CA 1E17A 3IG4A 5GPCA 2RGVA 1WVRA 4ZJZA 3VPRA 4IXAA 1X3ZB 3KP4A 4Z2YA 3H9QA 4XOTA 1Z21A 3BPXA 2LMDA 2RQQA 4J00A 2XSJC 3KP7A 2ID6A 1EKEA 2Y0MA 3KLNA 2WY8Q 1OCTC 3W6VA 4A3GJ 3BG7A 4CICA 1VQMI 2YU3A 1KQ9A 2VC0A 4FLJA 2GXAA 2M87A 1S29A 4BJTA 3CTAA 3LWFA 4DQ2A 1ETKA 3BY6A 3BOQA 2P0WA 3G1MA 2EBIA 2M30A 5CPRB 3S1RJ 1U8RA 4Y17A 3P5JA 1Z3XA 2DA6A 4CCMA 1QXYA 2MYSA 2EFOA 2Z5UA 1IV8A 4I09A 1P7JA 2V3ZA 3KP5A 4P9FA 1K78B 4YFKF 3E1SA 1ZHFA 3B02A 5LHIA 1YRNA 2UUZA 4HBLA 2J5OA 2QQAA 1MNEA 1W36C 3GTGJ 3S1NJ 2XASA 3GVAA 4BE2A 1I50J 5D5WB 3I54A 4RAGA 1O57A 2E1MC 2EFWA 1YHQI 1K6OA 5EG0A 3DPUA 2PJPA 2DOAA 3M8EA 2ZNYA 3QOEA 5K7FA 3PFYA 4LOCA 3KEQA 4PSWA 1OPCA 3E97A 3H36A 3P9IA 4BEHB 1TL8A 4XSXF 5EZGA 1W0TA 2DFFA 1MBKA 5DS9A 2K9SA 4G8XA 4RM3A 4XKBA 3IU8A 1YX5A 5J8CA 3CZ6A 3J80K 2ZXJA 1YJWI 1QO0D 1T0FA 5J40A 3ABKH 3IC7A 1A16A 4PK4A 3AL0B 3KYLA 4NDLA 1F5TA 4RGZ1 1U2WA 3OOPA 2UXNA 4KUMA 4IOAF 2R7QA 4DNCA 1ZREA 2HTJA 4F52A 2XHKA 5F1JA 1PV9A 5ILSA 3JR9A 2QQ8A 3SDBA 2JPBA 3DPTA 4QPOA 3PM1A 3PO3J 4W97A 2M9HA 4LIVA 4L0YB 1WZ2A 3QWLA 5ERIA 2YX4A 1GVJA 2K9QA 1HKSA 4YEJA 1WL9A 3FMRA 1XC5A 1BL0A 1VQKI 3S2HJ 3LQQA 1VQ7I 1R36A 2XV4S 1QGPA 1BI2A 2LK2A 4G7ZF 1Y56A 4DBQA 2Y75A 2QSHX 1FOWA 2NVTJ 1KA8A 4I2OA 3CJQB 3D0SA 2W7NA 1BI0A 2KRCA 2X85A 3FXQA 2GZWA 1VQPI 2VLAA 2W82A 2ZCWA 3ZQQA 4BNCA 4QIWN 3TO7A 2LH9A 5D8KB 1V5GA 2IGOA 5B5EC 4XR6A 3K6GA 3WTXC 2KZGA 5F0CA 3NARA 3ZMSA 2QA4I 4EGZA 5ICCA 1RIOH 3A4CA 3V8JA 1MBHA 3C2HA 4F91B 5LLQA 1ITYA 3KYDB 1U0JA 5DTDA 2FBKA 4F55A 3TDUC 2IXSA 5TISC 3LMMA 3A03A 2V1XA 2YU9J 2VXDA 1OKRA 5L3CA 4V2GA 1FIPA 2LBFA 1E2XA 1WJAA 4HX8A 1Z7UA 2E71A 1MBGA 1YLFA 2VBWA 5JHUA 4HXXA 1ETXA 3FWEA 3TL4X 1S9HA 2ZSGA 5CVRA 5HS9A 1U9OA 3WG7H 4C2TA 4IHTA 2BV6A 2MGQA 2R7XA 5C4JJ 3F9KA 3G4SI 3S15J 2VPRA 3MMYB 2Q92A 4FQGA 1H8AC 3T1BA 3VSKA 2GXGA 4GXOA 1GLNA 2EFNA 3FX3A 3K1PA 2JVGA 2CQNA 3HUGA 2DPDA 1W7VA 1NG6A 1LUJB 2AO9A 4GRIA 4ENMA 4R8HA 5ILUA 2Z2SB 3I53A 5GTIC 3ZMTA 1S8NA 1OCCH 4U88A 3A2KA 4ZYGA 4PUSA 4P55A 3QRFF 3JREA 5J4VA 2LVSA 5EGOA 3MEXA 1XMXA 3CCUI 2ZMEB 2HXOA 5AIPA 4YELA 3K1NA 4AIDA 2FQ4A 1HA8A 1WJDA 2XAJA 1TW2A 2DYSH 1IZ1A 1U5TA 3ZQGA 1W5CC 4BU2A 2FX0A 2VQCA 3BG6A 3HKZN 2LKPA 5TJJA 4BXXJ 4FO8A 3CO7C 4RLFA 1MIJA 2JA5J 3FXLA 5E1WA 4MHGA 2MBFA 3COAC 2VJIA 2E60A 3RKYA 2R5YA 4RB1A 1MATA 4KDPA 4LD5A 5F6FA 2WTEA 2P5VA 3HRTA 3GTPJ 4ASNA 2K9NA 3ZMDA 2IT0A 4RB0A 2WV1A 5B1AH 3KPHA 5E79C 1R1TA 1JUSA 4ZYDA 4UY8I 1Z7LA 1N25A 3F72A 1U78A 2BWSA 3RKWA
chains in the Genus database with same CATH topology
4FX4A 4CHUA 5DV5A 1SFUA 2Q96A 2FBIA 5HS8A 2VE9A 4FT8A 1LDKB 1NHAA 4MATA 4HYEA 4B09A 2FBHA 1QPMA 4KN4X 1V4RA 2M5WA 1JGSA 4EM0B 4ESBA 2GU5A 1KU7A 2QENA 5IT9K 2EA2A 3VODA 2UWMA 1LEAA 5HS7A 1JAWA 1TTYA 4IKTA 4OIRF 2MA3A 1S6LA 3LA2A 2IJLA 3D27A 1SD4A 3S6BA 3ECHA 1Z9CA 3H3UA 4ESFA 2STWA 4U6JA 3ZMVA 2DLLA 3WODF 2WC2A 1CF7A 2CYYA 2FMYA 2GG0A 5LBQA 3QU3A 1J59A 3F21A 5BOXA 3EQLF 2VONA 1V3FA 3DXJF 5CDEA 1EH6A 4I01A 2L54A 3H92A 2EK5A 1EH7A 2FXAA 4G6QA 3FMQA 2GAUA 4CYDA 5FO5A 2GG3A 2D2WA 5K5RA 2BWWA 4MEXF 3DPLC 4HA8A 1AOYA 1W7PA 2EWNA 4BYYA 1IRFA 1T6SA 3I59A 5AONA 2B3KA 3RVAA 1BC7C 2K02A 5ICFA 2FOKA 3RPUA 5HVQC 1N51A 2YX7A 1WN1A 3CB5A 4U6ZA 3HRMA 2IPQX 1YYVA 4LLLA 4ZH4F 4MTEA 3WGGA 1O7FA 4E70A 3E5QA 2KJCA 1T2KA 4MGRA 1WSUA 2GIVA 4MQ9F 3D5LA 4O6JA 3DP7A 4UVBA 4PDKA 2BHAA 1BI1A 2LF7A 2DT5A 1S7OA 5KVRA 2XAQA 4ENJA 2K7LA 1QXWA 3HOTA 2X4HA 4CO8A 4JQFA 3HSFA 3SFZA 2W84A 5CVUA 2NNYA 2Q8KA 1BM9A 4S2TP 2RV8A 3C3WA 2ELHA 4I02A 3F8BA 2XAGA 4BHCA 2DI3A 3ZMZA 3GFMA 1HSTA 3FZVA 1MJAA 2A5YB 3U2RA 2EV6A 2VXZA 4BAYA 3IU9A 3JSPA 1Z91A 3Q9VA 2IRFG 4M9SA 5JI6A 2RDPA 5HLIA 4LB5A 4HQMA 3HHGA 4WWCA 3PKCA 3IWZA 3TOAA 1TQPA 5H20A 4CGZA 4U71A 4HF2A 4G6DA 2DO7A 1I5ZA 1PP7U 4RZYA 2EJRA 5L3DA 3F3XA 1QBJA 2W24A 1BBYA 3RPQA 1XSVA 4WXHA 1U5TB 1Y0UA 1G3TA 3K1MA 2OZUA 2D1HA 1O3TA 2W57A 1TBXA 4HDUA 1YFHA 1KYZA 2H6BA 2OQGA 1H9TA 4YFNF 3TDZC 4UHTA 4U75A 3WTTC 4N9IA 3MATA 3IWFA 5DD4A 4TV7A 1BOAA 1WL6A 4PGHA 1FYKA 4KA4A 3Q9SA 1MZBA 2OU2A 2RN7A 5BS6A 1FC3A 5HLHA 4I0AA 5JFRA 5FCFA 5DDGA 5D4RA 1KU9A 3CB6A 2VBXA 1ONVA 2O0YA 5JR3A 2BH3A 4MQVA 1IXCA 2V3XA 3WTUC 1OYWA 2V1DA 2PEXA 3ECOA 3WU0A 1YW7A 2PMUA 1UCRA 2O61A 2BWXA 2HQNA 5FLXZ 4FLIA 4EMSA 3WTVC 5DD8A 4OIQF 4EM1A 3T5XA 4AVPA 3I0TA 4AIKA 4RGSA 2Z3YA 2GQQA 5K5OA 2O03A 2R7FA 2BWTA 4GYIA 4EGEA 1FBUA 3FXRA 3R61A 2ADUA 1Z6RA 2A3SA 3GXOA 4BXUA 1HKQA 2PN6A 1CGPA 1C24A 1AWCA 2BN7A 1J2XA 1XSDA 3DV8A 3DQVC 2LDUA 2R7DA 2F5FA 5JVTA 1SFXA 2ISZA 3GFIA 4KIFA 2B0LA 3PKEA 2A07F 2V9VA 1KYWA 4UV8A 1T38A 3GZ6A 4L18B 2GA1A 2BWVA 4EJUA 3CUOA 4Y15A 2ZKZA 4F7ZA 4LLNA 1FLIA 1KQ8A 4HW0A 2NNNA 1FOKA 4UVAA 2VN2A 3KP2A 2EFQA 4KYWA 5D4SA 2A6EF 3HRSA 3M9AA 1Z05A 3QAHA 1DPUA 2LF8A 3BZ6A 3RYRA 1RNLA 1W7PB 2CFXA 1STZA 3BJ6A 1FY7A 2COMA 4Y13A 3I59B 1ZRFA 2OA4A 2QQBA 2G9WA 4LJZF 5FFZA 1RUOA 5DCMA 3K9TA 3HYIA 1CHMA 2HOWA 3BITA 3GYHX 3J81K 3QOPA 5F1RA 1YO5C 2VBZA 2VE8A 2MLGA 3L2CA 2H94A 3WGHA 4G9YA 2Z9OA 1IRGA 2KRFA 1ZRCA 3TO6A 5FB2A 5FD6A 2CQKA 4P9UA 3QPTA 3ZP5A 5LGUA 1WBQA 1TQIA 3T8TA 4HQEA 3RDIA 4NQWA 4ZZDA 4LK0F 3ERED 1YVMA 1EH8A 2CGPA 4ON0A 4LG0B 1WY2A 1USTA 5HOOA 1R00A 4I98B 2K27A 3G3ZA 2E1NA 1GHCA 4OIPF 1J7KA 2HS5A 5HLGA 3F8CA 4ZYHA 4HF0A 5E8IA 4FO7A 4ENKA 4FHTA 6PAXA 1HW2A 4KM3A 2VC1A 2P5KA 2M1BA 2AXLA 2GGBA 2MATA 3ELKA 5DUKA 3RI4A 2F2EA 5LGTA 1O3RA 3R60A 3E3VA 4PZJA 3MR1A 4FLKA 1EV7A 1XDUA 4K2EA 2OKNA 1ZYRF 1QNTA 2B3HA 3CDHA 1D5VA 4A0XA 5ILVA 1HQCA 1FP2A 4U6WA 2HKOA 1C0WA 1TNSA 3EDPA 1FT9A 1JXSA 1YG2A 1P6RA 1SMYF 1YW9A 1WLRA 4M74A 2VOOA 2MH2A 3E6MA 3HRUA 3WE2A 4S01A 2ZFWA 1BJAA 4U6EA 1YJ3A 1L3LA 3CTZA 1ZGAA 2Z33A 3F23A 3CUQB 2MD5A 4HAMA 1BC8C 1VTNC 1UHMA 2DQLA 4IF7A 3L7WA 2KIMA 1OR7A 1BIAA 3E6CC 2IVMA 2A68F 2PI0A 4IU6A 3N4MA 2NAZA 1Z1DA 1ZG1A 2OD5A 3FM5A 2GU6A 2LNBA 1B6AA 3KETA 1KU3A 4HLXA 3KP6A 3ZMUA 4O3MA 1TW3A 2JRTA 2H6CA 1H9GA 3V7SA 1MKMA 1XGNA 4NHJA 4A0ZA 3J7AO 2XKPA 3TOBA 2FNPA 4M9ZA 4WF2A 2P7VB 1SFEA 3MWMA 3VFZA 2Q2EA 1W7PD 1H0MA 3GW2A 3KZYA 3KCCA 3F8MA 1YS7A 5D8LB 1F9NA 4IHSA 4N9HA 3JW4A 5IT3A 1XGSA 4IDYA 3IHUA 2IW2A 3PQJA 4L9VA 4ZZLA 2P7CB 2GG9A 3TKYA 3KP3A 3FF5A 4FLLA 4RB3C 5A2QZ 1RUNA 1ZN2A 4L9TA 2UZKA 4RGXA 4LMYA 3E5XA 1ON2A 3JTHA 2L01A 3LSTA 3DFGA 2P8TA 1DPRA 1R7JA 1HXDA 2A69F 1R22A 2BHBA 4KMUX 2CO5A 1XCBA 3R4KA 2NQ6A 5D5UB 5CJ9A 3I64A 3RKXA 2JTVA 3DEUA 3T0YA 1FP1D 5BPDA 1IAWA 2EVMA 2Q0OA 4PCQA 3F6VA 5E18F 2HOEA 1ZRDA 1XD7A 4WX9A 3Q6DA 3W6JB 2ACJA 3V8LA 1K78A 2HTSA 3MX6A 2BB7A 3QP5A 3VEPA 2D45A 1IN8A 3KE2A 3ROUA 1B9MA 4A5MA 5DCMB 2EVCA 3MQ0A 1IN7A 2HQRA 5L3EA 3NQOA 4AWXB 5E1ZB 3LA7A 2JT1A 1LNWA 3L7GA 1ODDA 1QQIA 3QP6A 2E7XA 2CW0F 2Y48A 2VODA 3TAVA 4U0WA 4JUQA 1T98A 1YIOA 3KZZA 3M8FA 3R0JA 4I0BA 2GA2A 2F5DA 5LHGA 4P96A 4P5OA 4S00A 2GU4A 1X3UA 2L4MA 1ULYA 1UB9A 4HZFA 4XLPF 2ETHA 3LFKA 4LGWA 2GGCA 2OBPA 1Z6TA 1USSA 2Q93A 1MDMA 2G6PA 4XSZF 1DP7P 2L02A 3P9KA 4HX7A 5L3GA 4ZWOA 1KP0A 1C27A 3T8RA 4R79A 3CJNA 4BH9A 3ZN1A 2CWEA 1FSEA 3RORA 3EYYA 1LB2A 1B59A 1R23A 4S2RP 4UV9A 3S2WA 4G94A 3K0LA 4L5JA 1G4DA 3R6SA 4QLCU 3QU6A 4ZWPA 2GG8A 1B9NA 2HFHA 3SZPA 4Q5SF 1WWXA 5FCHA 2EV0A 3F22A 5H6QA 3EETA 5CLSA 1LEBA 1U5TC 1C22A 4YIFA 3OV8A 4L9NA 2OAZA 4XBFA 1XCVA 4UUVA 3ZPLA 3SZTA 1ZARA 3IRQA 2FF4A 2BBYA 5E20A 2JZYA 3PFIA 4ZNGA 4XRFA 2CSOA 4QR8A 2EA4A 2AS5F 3QPHA 4IVNA 1R1UA 2ZNZA 1MJBA 1RZ4A 2BGCA 4IRGA 2QWWA 1P4WA 2XAFA 1O0XA 3IKTA 1M35A 4AIHA 2DW4A 3HTSB 4HV6A 1MJ9A 1DUXC 2DAOA 5LEKA 4U76A 2NQ7A 3BDDA 1ZG5A 2BYVE 4S05A 3HSRA 4I7HA 2D1VA 3O6BB 1XB4A 3ZQ7A 4Q47A 5CE6A 1I1GA 3HSEA 4U70A 4A2UA 3U9GA 5DUIA 5CNXA 1HKTA 3MZHA 3HTUA 4ETSA 4CZZA 5FLXK 4PNCA 2QZ8A 1G3WA 2ZJ2A 4MNUA 4BHPA 1DDNA 2RVCA 3HIFA 4YG2F 4FX0A 2HR3A 3FXUA 4EV0A 2GWRA 4OMYA 1YW8A 3B73A 3JAMZ 4M9XA 5D5VB 1FWZA 3ABTA 3WTWC 4BHBA 1SMTA 1W5SA 1PP8F 2FE3A 4U0VA 3CLOA 5HDGA 3C18A 3MZYA 3GEZA 2DK5A 4LFUA 1IXSB 3VOEA 1MGTA 2VBYA 4JK1X 1R58A 1CF7B 1W2MA 5HDKA 3C7JA 1WI9A 3BIQA 5LGNA 1ZH5A 4A12A 1LDJA 1OYIA 3WTYC 1C21A 1SAXA 2GG2A 2H27A 4M6XA 1XSXA 2DQRA 2F5EA 5CDVA 4PV4A 2LSOA 2PQ8A 5CVVA 2L3DA 3GUDA 4U1BA 4U73A 4KICA 2W25A 2V1UA 2UXXA 3V4GA 4MTDA 1W5TA 3K69A 3I4PA 3VB2A 4IKRA 4IF4A 1IUYA 2STTA 2HGCA 4R60A 3REOA 2VT3A 2O8XA 2XGXA 1PUEE 1XDSA 1P2FA 5BQTA 1FYLA 4UNOA 2PLYA 2KIUA 2M45A 2OQRA 3WG9A 2W85A 3WGIA 2ZBKA 1G3SA 2E1CA 1LDDA 4G7HF 3RJPA 4N0BA 3LA3A 4UXNA 1KGSA 2HDCA 5F64A 4ZWUA 2V79A 4RAZA 2MLKA 3J80Z 2P99A 3J81Z 1S3JA 4EJWA 1HBXG 1S7AA 3IRRA 5DCFA 3PQKA 1MDMB 4YFXF 3ZN0A 3ULQB 1J5YA 2DPUA 4EJTA 2FMLA 3PKDA 3MFKA 3L00A 4RS8A 5L3FA 3JSOA 2FU4A 3MAJA 2JPCA 5CDLA 1QXZA 4M73A 5LRRA 4EM2A 1SD7A 3BJOA 3H3ZA 2VOPA 2GG7A 2P5LC 1K79A 3GFJA 2QBYA 2XRNA 1B4AA 4U6CA 2CG4A 1ZLKA 1XGOA 1JHHA 4L9JA 4O5VA 1XNZA 4H0EA 4U7DA 3FM3A 1WQ2A 3E6BA 4XLNF 3CUQC 5HDNA 4L5IA 4HLYA 3LAPA 1O3SA 2RNJA 1F4KA 3TB5A 2XAHA 4M71A 1FZPB 4FKCA 1TNTA 2IA0A 1L0OC 1XN7A 2HYGD 2WWYA 1BI3A 5DYMA 1ZLJA 1U6GA 4HF1A 5D6FA 2Q95A 4IKSA 2XKOA 3V7RA 1P4XA 1D3YA 2OZ6A 4IJAA 5AIQA 3SXYA 4ENNA 2BWUA 1B1BA 5J8FA 4MEYF 3GO5A 5E8GA 2R3SA 4EJVA 1OMIA 1LVAA 1IN6A 2FSWA 3K2ZA 1TQMA 1ZGJA 3CO6C 1GXQA 4S04A 2GZ5A 5BPIA 1XMAA 2BEOA 1FSHA 3BROA 2QM3A 3E5UA 1R5HA 4WCGA 3JTGA 1F1ZA 2GU7A 3V7CA 5LEJA 2BE5F 2Q94A 2WV0A 3GZ5A 1J0RA 4LK1F 2VT2A 3E6DA 2IA2A 2PMHA 4B28A 1A04A 2IA1A 3Q5FA 2FEZA 2ISYA 3EUHA 2RQPA 5BMZA 4IPAA 4RGRA 3L09A 3N97A 2YSRA 5DEQA 3DKWA 4PGGA 4WXDA 1D8KA 1FPQA 4U0YA 2QLZA 4OOKA 1BIBA 3IL2A 3W6KB 4KNYA 3EYIA 5A2QK 2FQ3A 3WU1B 3AAFA 2P9AA 2KKOA 3NEUA 1LQ1A 3GWZA 2B3LA 3ISPA 2HEOA 3ML6A 3WE3A 3TQNA 2DTRA 4RB2C 3LQRA 2MH9A 2QYOA 2DU9A 2L4AA 1P4AA 4KIGA 2XROA 3I71A 3ABUA 2YR2A 3RYPA 4UVCA 3BIPA 3WTZA 1WKMA 1JE8A 5D5XB 4NB5A 5IT9Z 3DF8A 5CVJA 3P7NA 4LLGF 4M72A 1IF1A 2MC3A 3BP8A 3G73A 2YPRA 2P6SA 1XGMA 2ZO4A 3V8KA 1FX7A 1PDNC 1FYMA 2NYXA 3F8FA 2P4WA 2RC4A 4RZZA 2XUBA 4HX4A 3RIRA 4R1HA 4D0PA 5CIKA 2PFBA 3BJAA 2TDXA 2DFIA 5FFXA 5E1XA 3M1EA 2IW5A 1I27A 1JHFA 4U7BA 2DBBA 2IP2A 3I5UA 4EQQA 3KLOA 3R0AA 4OIOF 1RI7A 4FUKA 1J9IA 1SD5A 1IN5A 4A6DA 1U3EM 1BN5A 2QVOA 4JBAA 1YS6A 1T39A 2PG4A 2GXBA 4A5NA 2DK8A 2EB7A 3GX4X 2NS0A 3WTSC 1HSJA 4ZYEA 3BPVA 3HHHA 2FNAA 1REPC 5TRDA 5L3BA 1IXRC 2QQ9A 3IKVA 2JSCA 2J5PA 3PKBA 4IRHA 4OOIA 2PBIA 4Q48A 4IKUA 1XMKA 3TGNA 3U1DA 4HOBA 1UFMA 2XIGA 2KJBA 4CXFA 1QZYA 4GCVA 3O3KA 2K4JA 4LG0A 3FHZA 4EGYA 1G3YA 1G6NA 3IU7A 3C1DA 4OU0A 1IW7F 1YQAA 5LRSA 1UHWA 4QWQA 1IN4A 2P98A 1ZAOA 2QBYB 1TLHB 1I1SA 4ESJA 1J75A 1HW5A 4WK8F 4KIBA 4IECA 4HV5A 4RAYA 4Q4ZF 3RTRA 4LB6B 2H09A 5J6XA 5ICEA 2BWYA 3L24A 2E7WA 5K1YA 2GG5A 4IRIA 5H6RA 2A61A 3FMSA 3HOSA 5CVIA 1Q1HA 4A0YA 2G7HA 1R1VA 2O3FA 1O7LA 5K5QA 5ED4A 2RKHA 3I58A 4EJOA 4CDGA 1ZG3A 3KFWX 4M6YA 4KN7X 2A6HF 2C6YA 3GLXA 4HDVA 2EVOA 5FGMA 1W4MA 4KFCA 3CUQA 4U69A 4Z7MA 1SD6A 2ZMEA 1I6XA 4AD9A 2Z99A 1FBSA 1R5GA 1P92A 4KMFA 5E5BA 4OMZA 1K7AA 1QZZA 4GO1A 2EV5A 3KEOA 2HZTA 5CYVA 1O3QA 5EEGA 3P9CA 1YTYA 4L0ZB 3SHFA 2M8EA 3L9FA 3M7GA 4GGGA 2BHDA 3F6OA 5FD5A 1Y1NA 4KT5C 1D8JA 3LAJA 2EFPA 1C23A 2KIFA 2O6GE 2HKXA 5D6EA 2ESHA 4EVIA 1WRJA 2K4BA 4GYGA 3JAMK 4B8XA 2P6TA 3O2PE 1FNNA 5KK1A 2V6CA 4YIIA 5ICGA 4RGUA 3BWGA 4BQAA 2NRAC 2ESNA 2HYFA 3PKAA 4AIJA 3NRVA 3SQNA 2K86A 4A6EA 3TO9A 2QUFA 5E17F 1MD0A 2HWVA 2GTXA 4A6VA 1HW1A 2F5CA 1LJ9A 2G7UA 1KQ0A 2FRHA 5LHHA 2V3YA 2XVCA 4WXCA 2X0LA 3GFLA 4A6WA 3GF2A 1FBQA 5EEHA 2BHCA 4OINF 3F8NA 4G7OF 3MCZA 1OYYA 1ON1A 1GXPA 1KU2A 2FA5A 1E17A 3IG4A 2RGVA 4IXAA 3KP4A 4Z2YA 3BPXA 3KP7A 2Y0MA 3KLNA 4CICA 2YU3A 1KQ9A 2VC0A 4FLJA 2M87A 1S29A 3CTAA 3LWFA 4DQ2A 3BY6A 3BOQA 1U8RA 2M30A 4Y17A 1QXYA 2Z5UA 2EFOA 2V3ZA 4I09A 3KP5A 4P9FA 1K78B 4YFKF 1ZHFA 3B02A 5LHIA 4HBLA 2J5OA 2QQAA 2XASA 3GVAA 5D5WB 3I54A 1O57A 2EFWA 1K6OA 2PJPA 3M8EA 2ZNYA 3KEQA 1OPCA 3E97A 3P9IA 4XSXF 4G8XA 3IU8A 5J8CA 3J80K 2ZXJA 1QO0D 1T0FA 3IC7A 1A16A 1F5TA 4RGZ1 1U2WA 3OOPA 2UXNA 4KUMA 4DNCA 1ZREA 2HTJA 2XHKA 1PV9A 5ILSA 2JPBA 3DPTA 4L0YB 5ERIA 2YX4A 1GVJA 1HKSA 1WL9A 3FMRA 3LQQA 1R36A 2XV4S 1QGPA 1BI2A 4G7ZF 2Y75A 1KA8A 4I2OA 3D0SA 1BI0A 3FXQA 2GZWA 2ZCWA 4BNCA 3TO7A 5D8KB 3WTXC 3ZMSA 4EGZA 5ICCA 1RIOH 3V8JA 5LLQA 2FBKA 3TDUC 2V1XA 1OKRA 5L3CA 1E2XA 4HX8A 1Z7UA 1YLFA 2VBWA 5JHUA 4HXXA 3FWEA 2ZSGA 5CVRA 5HS9A 4IHTA 2BV6A 2Q92A 3T1BA 2GXGA 4GXOA 3K1PA 2EFNA 3FX3A 3HUGA 2DPDA 1W7VA 4ENMA 5ILUA 4R8HA 3I53A 3ZMTA 4U88A 1S8NA 4ZYGA 4P55A 3QRFF 3MEXA 2ZMEB 5AIPA 3K1NA 2XAJA 1TW2A 1IZ1A 1U5TA 5TJJA 2LKPA 4FO8A 3CO7C 5E1WA 4MHGA 2MBFA 3COAC 3RKYA 1MATA 4RB1A 4KDPA 4LD5A 5F6FA 2WTEA 2P5VA 3HRTA 4ASNA 3ZMDA 2IT0A