2DFIA

Crystal structure of pf-map(1-292)-c
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
301
Chain Sequence
b'MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTQDMINKST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 94
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dfiA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2dfiA01
4B28A 1T98A 2H09A 1QQIA 4MTEA 1I27A 5ED4A 1XMAA 3WTSC 3MQ0A 2V79A 2FNPA 3ZN1A 1I1GA 1N51A 4OIOF 1I5ZA 3KCCA 2ZKZA 1K7AA 3MX6A 1MDMB 4MTDA 3D5LA 2A68F 3K1NA 3SXYA 2RDPA 4U6WA 4KFCA 5FFXA 2HZTA 4A12A 5D4SA 4IKUA 2ZCWA 1BI1A 2EB7A 2L01A 4U76A 1FSEA 4RGRA 2K02A 4IECA 2KRFA 3VOEA 5BMZA 1OMIA 1AWCA 3BOQA 3F23A 1XD7A 3JSOA 3O3KA 3G73A 2F5CA 1JAWA 2GG7A 1FP1D 2F5EA 1DUXC 3VEPA 2OBPA 1W7VA 1MATA 5DYMA 3ZMTA 2DI3A 3ISPA 4R8HA 2Y48A 4EVIA 3NRVA 2G7UA 5HLHA 2HEOA 2GA1A 2K86A 2MH2A 2BWXA 1ONVA 1SD5A 2Z9OA 2O03A 4GO1A 3IHUA 1R7JA 1L0OC 2QBYB 2LF7A 3I54A 3ZMVA 3FXQA 5JHUA 4ENKA 1HBXG 4U6CA 3T0YA 3SHFA 1IXRC 4XSZF 1XCVA 1B9NA 3TOBA 2QLZA 1TW2A 3RIRA 5HS9A 3F8FA 5FO5A 2QENA 5CVVA 4HV5A 3VFZA 3I5UA 1P4XA 4U71A 1DP7P 4PGHA 3KLNA 2Q94A 2ZFWA 2W84A 1ZN2A 3C18A 2DPDA 3PQJA 5K5QA 5D8LB 4RS8A 3HSFA 3IU8A 1KP0A 3DP7A 2IPQX 5CNXA 3TO7A 3HRSA 1U5TC 3RYPA 3V7RA 3MFKA 4CO8A 4KN4X 3T5XA 2LDUA 4A0XA 3ECOA 4ENMA 1ZRDA 2DPUA 3HSEA 1ZH5A 4FLKA 2XIGA 2B0LA 3KZZA 1C21A 1R1VA 1PP7U 3GUDA 2BV6A 4UHTA 1G3WA 3C3WA 4U1BA 3Q5FA 4RB2C 2HQRA 5HLGA 5ICEA 2XHKA 3Q9SA 4B09A 4U73A 3ZP5A 1QZYA 2FE3A 2STTA 4EM1A 2P5LC 2M45A 1XCBA 3L00A 2KIMA 2XAQA 5DCFA 4QLCU 3SQNA 4UV8A 2VODA 3BJOA 3RYRA 1G3TA 3WGHA 4CICA 4ASNA 4WK8F 3GEZA 4GYGA 1V3FA 2J5PA 1X3UA 4L9NA 3KP6A 2GA2A 3N4MA 1OYWA 3TQNA 1F5TA 2DK5A 1K78B 3ROUA 4R1HA 4XSXF 4YIIA 2P6TA 1FWZA 1J75A 2F5FA 1IW7F 1XDSA 4DNCA 2B3HA 3ELKA 4HX4A 1XMKA 3LSTA 3B02A 5L3DA 2EA2A 2ISYA 1LDJA 3REOA 2GU5A 5ERIA 1HXDA 2C6YA 2FBIA 1FNNA 3W6JB 4EV0A 4ZNGA 2MC3A 1J9IA 2VBZA 1S29A 5KK1A 1IN4A 3LAPA 4NHJA 2YU3A 2V3YA 3S6BA 2H6CA 3D27A 1XN7A 3DPTA 5DDGA 2GQQA 1WKMA 3PKDA 2NAZA 2IA1A 4MQVA 1ZG1A 2YX7A 4IDYA 4LB5A 4K2EA 2CWEA 2JZYA 1BC7C 3FZVA 2GGCA 2FNAA 1PDNC 1SD6A 3GFJA 3IKTA 2QQBA 4LB6B 1BI0A 5DUIA 1U8RA 3M8EA 4Y13A 5HVQC 2Y75A 3QP5A 1HW5A 5E1XA 1O3SA 3M9AA 2GG5A 3E6DA 3HRTA 1FT9A 3V8KA 1KGSA 4UNOA 4NB5A 5J8FA 3GO5A 1YS6A 4M6XA 2GZ5A 1YQAA 4PV4A 1REPC 2PMUA 1YW8A 3GLXA 2WTEA 1HSJA 4LFUA 4IXAA 2FEZA 1YYVA 5H6RA 4UUVA 1BJAA 4YFNF 4IF7A 5FB2A 2HWVA 3FMQA 1HQCA 4LG0A 5K5RA 3PKAA 4IU6A 2D2WA 2V6CA 3BIPA 3HSRA 2MLGA 4QR8A 2RN7A 1GVJA 3KP2A 3HOSA 2UWMA 4O5VA 4A2UA 5CJ9A 3E6MA 1ZREA 4LMYA 5TRDA 1T2KA 5FLXK 4CGZA 3BDDA 3CUQA 1USSA 5LRRA 3SZTA 1JHFA 1S8NA 1HW2A 1ZRFA 2STWA 3MR1A 3ZQ7A 1OKRA 5AIQA 2DU9A 3F3XA 3CB6A 1O3QA 2GGBA 3GFLA 1B9MA 1R23A 2VC0A 2K7LA 1IUYA 4FO8A 4JK1X 3KE2A 5EEHA 2CW0F 1JGSA 2ZSGA 2NRAC 1ZLJA 4HLYA 2DT5A 4P9UA 4Q5SF 1RUNA 1KYZA 5FCHA 4EGYA 4RB1A 2HTSA 5CDEA 1QO0D 3RKXA 4ENNA 3LA3A 2QZ8A 3JAMZ 2EV5A 4BHBA 3M8FA 3RKWA 1HKQA 1HSTA 4U6EA 4EMSA 4OU0A 2A69F 1TNSA 4M9XA 3FHZA 4ZZLA 2Q95A 1U6GA 1R5HA 1ZAOA 1Y1NA 5E1ZB 2GZWA 1E17A 4HAMA 4LK0F 2PEXA 1J7KA 2UXNA 4HDUA 3WTZA 1QPMA 2GXBA 2K4JA 2CFXA 2M30A 3KLOA 2R7DA 4EGEA 2BB7A 2PQ8A 4IRIA 1O57A 2IJLA 1WY2A 2OA4A 1XSVA 1YJ3A 5F1RA 4RB3C 3DKWA 3BJ6A 2VOOA 2V9VA 1PP8F 2BWYA 3H3ZA 1ZGAA 1ZG5A 5LHGA 5H20A 2EVOA 2GU4A 2BN7A 4ESFA 3E5XA 5BS6A 1Z05A 2W24A 1IN6A 1STZA 2EV6A 3HYIA 4Y15A 2H94A 3L09A 3ZMZA 3QPHA 4LLNA 2VBWA 5LHIA 1B1BA 2HKXA 3WTXC 2D1HA 2MATA 1D8JA 3FM5A 2GIVA 1ODDA 2HQNA 1WSUA 4RAYA 3HRMA 5E5BA 4HQMA 1Z6TA 2HTJA 1IN5A 1P4WA 1I6XA 2PJPA 4JQFA 3BPVA 3BWGA 4U0VA 3LWFA 2BHDA 1D8KA 1S7OA 1VTNC 1CHMA 1ZHFA 3IL2A 2NYXA 2IRFG 2CGPA 4WCGA 1R1UA 2HR3A 2FOKA 1F9NA 3HHHA 1B59A 4YFXF 1YTYA 1LB2A 2W25A 5E18F 1FLIA 4I09A 3OOPA 3IWFA 3N97A 2O8XA 4G8XA 2GU6A 4KIFA 1H9GA 4FUKA 1MJ9A 2W57A 1C22A 1XB4A 4A6EA 3I64A 3DEUA 4HDVA 2B3KA 3J81K 2A61A 4Q47A 3CB5A 2XROA 2XAFA 3WU1B 4AIJA 2DAOA 4OIPF 5D5WB 1G4DA 4IRGA 3V8JA 1CF7A 4ESBA 2BWSA 5D6FA 4RGXA 3PKBA 2VE9A 1O7LA 3TOAA 5DEQA 4ZZDA 2E1NA 2IW2A 2BWWA 3E5UA 1BI3A 4A6WA 4AWXB 2FMYA 1DPRA 2KJCA 2GTXA 2KJBA 2AS5F 1SMTA 1J2XA 4RGUA 4M9SA 1DDNA 3TDUC 4ESJA 5DCMA 5BQTA 4ZYDA 1QXZA 1P6RA 3QU3A 1JXSA 1GHCA 4UV9A 1LVAA 2DQLA 3NQOA 2A5YB 5FD6A 2QVOA 2F2EA 4AD9A 1K6OA 3QPTA 3T8TA 1RZ4A 2OQGA 4FX4A 1BM9A 1ON2A 2RV8A 3K69A 4WXDA 3WE3A 2FRHA 1AOYA 1BBYA 2H27A 1WL9A 2BBYA 1IXSB 2M87A 2BWUA 1G3SA 4KIGA 2RVCA 4AVPA 4RZZA 2LKPA 1KQ9A 1FP2A 4L9VA 3GFIA 4U88A 4I7HA 2OU2A 4M74A 3FMSA 3GF2A 3ZN0A 5CVRA 1FYLA 1BOAA 1ULYA 4EJOA 3F8CA 1IRFA 2ZNZA 2XAJA 1H0MA 3J81Z 5HS7A 3BPXA 5LBQA 2D45A 3ABUA 4Q48A 1XGOA 5FD5A 1CGPA 1U2WA 1XSXA 3J7AO 2FBKA 5L3EA 3KZYA 1PUEE 4L5IA 5LGUA 2Q8KA 2WV0A 3HTUA 2DBBA 3TKYA 2M8EA 1IRGA 4L0ZB 2K27A 1TQPA 5A2QK 5F64A 2Q96A 3IKVA 3L9FA 4E70A 3J80K 5HDGA 5CVUA 2XRNA 4RGZ1 3Q9VA 1GXPA 1ZRCA 3P7NA 4BNCA 2PLYA 3WGIA 1R00A 3GZ6A 2VN2A 3T1BA 2WC2A 5LLQA 3LFKA 1KU3A 3B73A 3TO6A 3QU6A 1YVMA 2HKOA 3IC7A 4U69A 1Z9CA 4IHTA 2HS5A 3RTRA 4HLXA 2FA5A 1HKTA 3EQLF 3ML6A 2ADUA 2VT2A 2JTVA 3U1DA 3WTYC 1KQ0A 5ILUA 3WGGA 2IW5A 3G3ZA 4A6VA 2IVMA 2FXAA 2A6HF 2MH9A 3TO9A 4ZYGA 3CO6C 4Y17A 2MLKA 4G94A 2VXZA 3F22A 4LJZF 5CVJA 4HF2A 1O3RA 3L24A 1YLFA 5DV5A 4ENJA 2CQKA 3O2PE 4HX8A 4I0AA 4LG0B 2ZNYA 4EJWA 4TV7A 3PFIA 2E7XA 3IRRA 3HHGA 4N9HA 4EJTA 1W2MA 5CVIA 2EA4A 5HDNA 3BIQA 4M72A 3QP6A 4IVNA 2TDXA 4S04A 2NQ7A 4EGZA 3R0AA 2JSCA 3ERED 2XASA 4L0YB 2Z33A 5A2QZ 4UVBA 3CUQB 1KQ8A 1WWXA 4I02A 1R22A 4P55A 3K0LA 2P7CB 3J80Z 2P5KA 3BP8A 2GG2A 2QYOA 4HF1A 3CO7C 2Z3YA 2JT1A 3WODF 3JAMK 3JTHA 1UFMA 3M1EA 4JBAA 2RQPA 1G6NA 2BWVA 5LEKA 4RGSA 1BI2A 2JPBA 2E7WA 4HZFA 1BC8C 1SFEA 2P99A 4FLIA 1KU9A 2WWYA 1L3LA 2RNJA 4OIQF 4ZH4F 4ZYEA 1Y0UA 4HA8A 3H92A 5KVRA 1ZG3A 1Z1DA 5J8CA 4S2TP 3I0TA 2BGCA 1F1ZA 1W5TA 4EQQA 5D6EA 4DQ2A 1OPCA 5D5XB 4KMUX 4I98B 4G7HF 2PG4A 3I4PA 1XGNA 3ECHA 2QQAA 4RZYA 1LDDA 4U70A 1J5YA 3LA7A 2NNNA 3I59A 3ZMUA 5JR3A 2GAUA 1LQ1A 2VC1A 3WG9A 2ZO4A 3PKCA 2EFNA 2B3LA 1IF1A 4GCVA 4IKRA 5IT9Z 3WE2A 3WTTC 4N9IA 4LD5A 4MQ9F 2W85A 4A5MA 2MBFA 3GX4X 2E1CA 4S00A 1ZYRF 2IA2A 1R58A 4WXCA 2O6GE 4CXFA 1TQMA 4HXXA 4S2RP 3Q6DA 1ZGJA 2PFBA 2P8TA 2XAGA 4ZWOA 2ZXJA 4D0PA 3MATA 3RI4A 2IT0A 2HDCA 3M7GA 3JSPA 1D3YA 2G7HA 1RI7A 4PGGA 3EYIA 1FOKA 4G7ZF 3I71A 4R79A 5ILVA 1OYIA 3AAFA 4QWQA 2V1DA 4BXUA 4RB0A 1WN1A 4IJAA 2DO7A 2O0YA 1KU2A 3ULQB 1E2XA 1Q1HA 4HF0A 2FQ3A 3DF8A 1JHHA 4OIRF 3E97A 3L2CA 3I53A 2XV4S 5L3FA 4YIFA 3KFWX 3IG4A 2K4BA 1OR7A 2NS0A 2PMHA 3FWEA 5CDVA 4IF4A 4BAYA 5L3GA 1UCRA 1WQ2A 1TBXA 1W4MA 2XKPA 3CLOA 4JUQA 1Z91A 2HYFA 3E3VA 3KP7A 4KMFA 1XGMA 1QNTA 3GYHX 2GU7A 4FX0A 4FLLA 1PV9A 4OINF 4OMZA 1CF7B 4HX7A 4PZJA 2VT3A 2XGXA 2P5VA 2P4WA 4YG2F 3WTUC 2DQRA 1A04A 2CYYA 2LNBA 3MCZA 1G3YA 1TNTA 2J5OA 2ZMEA 3C7JA 2L02A 2KIFA 1B6AA 1K79A 5LRSA 4O3MA 3FMRA 5J6XA 2ESHA 2Y0MA 5DCMB 2GG0A 4A0YA 1FBSA 1YIOA 3DQVC 3P9KA 4OMYA 2YPRA 5D8KB 4U7DA 1WL6A 4KN7X 4A6DA 3KETA 1MJBA 4LLLA 5EEGA 4CYDA 3F21A 2ACJA 1FBQA 5CLSA 3EUHA 5AONA 1EH7A 1A16A 4S05A 2CSOA 1YO5C 3LQQA 1W5SA 5E8GA 2EK5A 2EFWA 4MEYF 5L3BA 1FY7A 3KEOA 1GXQA 3ZMSA 2BH3A 2MA3A 2QWWA 5CDLA 3EETA 1T0FA 2ZBKA 2F5DA 1P92A 5K1YA 2Z5UA 4XRFA 1H9TA 2ISZA 4PCQA 2A6EF 4CZZA 1NHAA 4LLGF 2BHCA 1OYYA 1TLHB 2P6SA 2PBIA 3CTZA 1FBUA 4ZWUA 3MZYA 2Q92A 1IN7A 2R3SA 3SFZA 1UHMA 1F4KA 1R1TA 3DFGA 1BN5A 3V7CA 1MZBA 1SFXA 4EJVA 4HBLA 4HQEA 4YFKF 2RKHA 3I58A 1HKSA 3JW4A 1USTA 1SD7A 3IU9A 1C24A 3MWMA 2XAHA 3TAVA 4KUMA 1TW3A 1FSHA 4MNUA 4MEXF 1D5VA 2QQ9A 4AIKA 3FXUA 4G9YA 5DD4A 3IRQA 2X0LA 4WWCA 2HOWA 4MGRA 4P5OA 1XSDA 5E8IA 2HYGD 2OAZA 4ETSA 1O7FA 2P7VB 3LQRA 1QBJA 1J59A 3R61A 4EM0B 1LJ9A 2FU4A 1U3EM 3L7GA 2EVCA 4BHCA 1FYKA 4O6JA 4IPAA 2O3FA 4GGGA 3DPLC 1UHWA 1YG2A 3CJNA 3T8RA 4ZYHA 2G9WA 4KNYA 1MJAA 4KIBA 2GG9A 1IXCA 2Q93A 4BH9A 2L4MA 3R4KA 1MDMA 1JE8A 1QXWA 3W6KB 5L3CA 3TGNA 4ON0A 2YX4A 1DPUA 2CG4A 5HOOA 2PI0A 2MD5A 3P9CA 1SD4A 2EFOA 4MHGA 3GXOA 4L18B 2NQ6A 1QXYA 5BPIA 2OD5A 5LHHA 3ZMDA 4KYWA 2EJRA 6PAXA 3IU7A 3LAJA 2DW4A 1Z7UA 4FKCA 4IHSA 5CYVA 5ICGA 4FHTA 1BIAA 2OKNA 3BJAA 1Z6RA 1V4RA 5JVTA 1KYWA 3HUGA 2GWRA 5D4RA 2D1VA 2RC4A 3K2ZA 5BPDA 1IAWA 4HW0A 3F72A 2HOEA 1XDUA 3CDHA 3FF5A 2XUBA 4S01A 1SAXA 3R0JA 2YSRA 4GXOA 5ILSA 4HV6A 3COAC 2COMA 3LA2A 4KDPA 2QBYA 1QGPA 3P9IA 1YW9A 4FO7A 3ZPLA 3C1DA 4BHPA 3CUQC 3WTWC 1IZ1A 3F8MA 4A5NA 4Q4ZF 2HGCA 4FT8A 1C27A 2KIUA 2JRTA 2YR2A 4I0BA 4EJUA 5E20A 2M1BA 5H6QA 2OZ6A 3V4GA 4Z7MA 2VBXA 1ZLKA 3FXRA 4R60A 1U5TB 4L9JA 2ETHA 2P98A 2UXXA 3R6SA 1EV7A 2L54A 1R5GA 2ESNA 4PNCA 1RUOA 1C23A 4PDKA 4P9FA 3WU0A 3VODA 1KU7A 4P96A 2X4HA 5ICFA 3KP4A 2Z99A 1FZPB 3CTAA 4G6DA 5IT9K 5LEJA 2IP2A 3I59B 2O61A 2XKOA 1XGSA 2V1XA 4AIHA 2LF8A 1BIBA 1LEBA 4L9TA 2IA0A 1LDKB 2A3SA 5FFZA 3HTSB 3RVAA 5ICCA 4NQWA 2OQRA 3TB5A 5AIPA 1KA8A 5HLIA 4XBFA 3PQKA 4XLNF 2L4AA 4U7BA 3BY6A 1P2FA 1TQIA 2BE5F 4KICA 5E1WA 3F6VA 3F6OA 4KA4A 1LNWA 2DLLA 2G6PA 2Q0OA 2VBYA 4H0EA 3EDPA 1LEAA 1FYMA 1S3JA 4KM3A 2KKOA 2HFHA 3GWZA 3F8BA 3S2WA 3WTVC 1U5TA 5BOXA 1W7PB 1O3TA 2ZJ2A 5HDKA 4M9ZA 2BWTA 5IT3A 1FPQA 1K78A 1UB9A 3FM3A 3CUOA 4RAZA 4I01A 1TTYA 4OOIA 3DV8A 4IRHA 5FCFA 2Q2EA 1EH8A 2FMLA 1QZZA 1S6LA 3K1PA 4U75A 1WLRA 4EM2A 4M73A 2H6BA 4IKTA 3BROA 1FC3A 2GXGA 3GFMA 3KP5A 5HS8A 3E6CC 1RNLA 3BITA 3GZ5A 4MATA 1MKMA 5JI6A 4BQAA 3RPUA 1ZARA 2ELHA 4F7ZA 2DK8A 3U9GA 3QOPA 1T38A 1O0XA 2P9AA 3RKYA 3RJPA 4HOBA 2LSOA 3O6BB 2BEOA 4WX9A 3HRUA 4WXHA 1MGTA 2VONA 1ON1A 2BYVE 2CO5A 1C0WA 1J0RA 3K9TA 3JTGA 2ZMEB 3R60A 1IN8A 1RIOH 1B4AA 1W7PA 2QM3A 3PKEA 3ABTA 3L7WA 4A0ZA 5TJJA 4G7OF 1P4AA 5LGTA 2L3DA 1T6SA 3HIFA 4G6QA 1M35A 4U6ZA 2EFQA 3F8NA 1YW7A 2FF4A 5DUKA 1HW1A 5K5OA 4IKSA 3RORA 1WRJA 1SMYF 3NEUA 1MD0A 4WF2A 5CIKA 2RGVA 1W7PD 3OV8A 2A07F 1S7AA 4M6YA 3V7SA 4U0YA 4N0BA 2DFIA 2BHAA 2XVCA 2UZKA 4LK1F 3BZ6A 3E5QA 4CHUA 2NNYA 2GG3A 4B8XA 2AXLA 5JFRA 3KP3A 4CDGA 4KT5C 5F6FA 2M5WA 5DD8A 3DXJF 3SZPA 2OZUA 3MZHA 4GYIA 3MAJA 2VE8A 1R36A 1EH6A 2QUFA 3MEXA 4LGWA 3V8LA 1YFHA 4XLPF 2GG8A 1YS7A 4ZWPA 4Z2YA 3TDZC 4FLJA 2JPCA 2V3XA 3H3UA 4UVAA 4L5JA 2EV0A 2DTRA 1SFUA 5FGMA 3U2RA 3FX3A 4I2OA 2FBHA 4BYYA 2VOPA 1U78A 5LGNA 3QRFF 5E17F 5FLXZ 2PN6A 4U6JA 3IWZA 3RPQA 2R7FA 2EFPA 2EVMA 3D0SA 2V1UA 5D5UB 1WI9A 4HYEA 3GW2A 4M71A 2FSWA 1WBQA 5D5VB 4UXNA 4OOKA 5CE6A 1XNZA 3QAHA 1T39A 1FX7A 3GVAA 2EWNA 3E6BA 3EYYA 4U0WA 2BHBA 3KEQA 3RDIA 3VB2A 2V3ZA 3K1MA 4UVCA 1I1SA 3HOTA
chains in the Genus database with same CATH superfamily
4B28A 1UG0A 1T98A 4V2FA 2YU9J 2H09A 1QQIA 4MTEA 2VKDA 1I27A 4HPQA 5ED4A 3OS2A 2HYJA 1XMAA 3PO2J 4RLFA 3WTSC 3MQ0A 3PM1A 2V79A 2VQGA 4PFPA 2FNPA 2R0QC 3ZN1A 1I1GA 2W7NA 2JRMA 1N51A 3FXKA 4OIOF 1I5ZA 3KCCA 4F3QA 2ZKZA 2EZHA 4AUXA 1K7AA 1GV2A 4FE7A 2H8RA 3MX6A 1MDMB 2O5RA 4MTDA 1J09A 2JWTA 3D5LA 3EUAA 2CQQA 2HDDA 2A68F 3K1NA 4IQJA 3K4NA 1VQPI 3SXYA 1VFCA 3K70D 2RDPA 4U6WA 4EATA 4DBQA 4KFCA 5FFXA 1HA8A 3J7AY 1MNEA 3S1NJ 2HZTA 4A12A 2ZSHB 5D4SA 4XORA 4IKUA 2ZCWA 1BI1A 2EB7A 2L01A 4U76A 2E1MB 1FSEA 4RGRA 2K02A 4IECA 2KRFA 1XG1A 2EQRA 3QPLA 3D5SC 3VOEA 3PUFA 5BMZA 1OMIA 3MKYB 3NAUA 1YI2I 1AWCA 1ZR2A 3TP0A 3OYKA 3BOQA 3F23A 1EKEA 4BQNA 1XD7A 3U1KA 3JSOA 1ZR4A 3O3KA 3G73A 2F5CA 1JAWA 2X9DA 2GG7A 1FP1D 2F5EA 1DUXC 3VEPA 2OBPA 1W7VA 1MATA 1Y39A 3Q0WA 2HNHA 4XOTA 1K61A 3RZOJ 3N05A 5DYMA 4E7ZA 1Z7LA 3HUGB 4RA2A 3ZMTA 2DI3A 2R4GA 2JMWA 3ISPA 2JUGA 4R8HA 1MBJA 2Y48A 4EVIA 2NVUB 3NRVA 4CCNA 1RPWA 2G7UA 5HLHA 2ZJQF 2HEOA 2GA1A 2K86A 3HBLA 2ECCA 3AG4H 1ETYA 2IGNA 1ONVA 2MH2A 2BWXA 3PO3J 2UV1A 1SD5A 2Z9OA 1BW5A 2O03A 2VASA 4GO1A 4XKVA 3IHUA 1R7JA 5J4VA 1L0OC 2VPRA 2QBYB 2LF7A 3I54A 3ZMVA 3FXQA 5JHUA 3AG3H 1K6YA 4ENKA 2M3AA 3CCRI 1IV8A 1HBXG 1WFXA 2HXIA 3JR9A 1PVEA 4U6CA 1QRYA 3T0YA 3SHFA 1IXRC 4XSZF 1XCVA 4PJ0C 1B9NA 3KYCB 3FKJA 3TOBA 2QLZA 1TW2A 3RIRA 5HS9A 3F8FA 1N75A 3GLLA 5FO5A 2QENA 5CVVA 2IGOA 1F43A 4HV5A 2PX9A 2GOXB 3VFZA 2VQHA 3BZCA 3I5UA 1P4XA 4U71A 1DP7P 4DYQA 4PGHA 2CW7A 3KLNA 2Q94A 2ZFWA 2YUSA 2W84A 3EUKL 3C18A 1ZN2A 2W4SA 1T8IA 4E7HA 2K40A 2XGCA 2GM4A 1QVTA 3NWSA 2DPDA 3PQJA 5K5QA 5F08A 1UG2A 3HM5A 5D8LB 4RS8A 3BG3A 5J40A 3HSFA 3IU8A 1KP0A 3DP7A 2IPQX 5J47A 3TO7A 5CNXA 3HRSA 1U5TC 3RYPA 2LY9A 3V7RA 3I9V2 3MFKA 2VB6A 3RQ4A 4CO8A 4KN4X 3ZQQA 3T5XA 4DGWB 2LR8A 2ME0A 2LDUA 4A0XA 3ECOA 3DCFA 1FIPA 1D0XA 2DMUA 4XQFA 4J19A 4ENMA 1ZRDA 2DPUA 3PNVA 3FXLA 4PJNA 1MBGA 1D1BA 2HQAA 3A4CA 3HSEA 3DBLB 1ZH5A 2M7AA 4FLKA 3BTIA 2OJED 2Z1DA 2CFOA 3E7LA 4Y4RA 2XIGA 3CC2I 5EG0A 2B0LA 3ZGKA 3KZZA 4DZPA 1Z77A 1CQTA 1C21A 1RETA 1R4NB 2KT0A 1R1VA 1PP7U 3GUDA 2BV6A 4XLHA 5E3MA 1SAUA 3K4LA 4UHTA 2DOFA 2QKMB 5JVGF 2E2JJ 3S1MJ 1G3WA 3BTJA 2VIXA 1R4MB 4DJAA 3C3WA 1A5JA 2DMTA 4U1BA 5LFAA 5HODA 3Q5FA 3S2DJ 4RB2C 1DGRM 2HQRA 3LSHA 1Y1WJ 1HLVA 2Z16A 4XRSG 3A03A 5HLGA 5ICEA 2XHKA 3Q9SA 1G8XA 1VI0A 1VQLI 1SVLA 4B09A 3ZP5A 4U73A 1Y1VJ 2EIJH 1FIAA 1QZYA 3QPSA 2QSFX 2FE3A 5CQGA 2STTA 4EM1A 2JA7J 2P5LC 1MMNA 2M45A 1XCBA 4I76A 3L00A 4V19K 4BL0B 3PIOF 1MIJA 2KIMA 2XAQA 5DCFA 4QLCU 3SQNA 4XM3A 4UV8A 1Z21A 2VODA 3FK7A 3BJOA 4C3IJ 4II3A 3RYRA 1G3TA 1MNDA 3WGHA 2F48A 1N78A 2R92J 3ZQLA 4CICA 4ASNA 4WK8F 4F93B 4A3LJ 3GEZA 9ANTA 1V54H 4GYGA 2FJ1A 1V3FA 2X6YA 2J5PA 1X3UA 3VWBA 1JUMA 4L9NA 3KP6A 2GA2A 1JUPA 3N4MA 1X2MA 1OYWA 3G1LA 3TQNA 2NVYJ 1F5TA 2DK5A 1K78B 2E5ZA 3ROUA 4R1HA 5CKTA 4XSXF 2IS1A 4YIIA 1OQYA 2P6TA 1D1CA 1FWZA 3J7ZI 1J75A 2F5FA 1VQKI 1IW7F 1XDSA 4DNCA 1JT6A 2B3HA 3ELKA 4HX4A 3CCSI 1XMKA 4OAZA 3QYEA 2XB0X 3QYFA 3FDYA 1VQ8I 3LSTA 3SJMA 3B02A 5L3DA 1IRXA 2EA2A 2ISYA 3A0BC 1LDJA 2X1DA 1NG7A 3REOA 1ZGWA 2E60A 2GU5A 5ERIA 3OYLA 1HXDA 2VQCA 3HKZA 4HSTA 2C6YA 2WAQA 1WHUA 1OLTA 2FBIA 3UKGA 2XGDA 1HF0A 1FNNA 4F52A 1WPKA 3KIOA 3W6JB 4EV0A 4ZNGA 3GTQJ 2MC3A 2XRLA 3S1QJ 1J9IA 4XKWA 4M3BA 2VBZA 1S29A 2KDOA 5KK1A 1IN4A 3LAPA 2MFZA 2R5YA 1FOYA 4NHJA 2YU3A 2V3YA 3S6BA 2H6CA 5FLMJ 1XN7A 3DPTA 5DDGA 3D27A 2GQQA 2ZC2A 1WKMA 2EILH 3PKDA 4NC8A 3LSPA 4BU2A 2NAZA 1ETWA 2KRCA 2IA1A 2V1NA 3FK6A 4MQVA 1ZG1A 2YX7A 1NH3A 4IDYA 2L7MP 4LB5A 5FKLA 4K2EA 4A69C 2CWEA 2JZYA 3OL3A 1BC7C 3FZVA 2GGCA 2FNAA 4DYRA 5IYBJ 2O8KA 2AQEA 1PDNC 1SD6A 3GFJA 3IKTA 1W1WE 2QQBA 1W5CC 4LB6B 1BI0A 3MZ8A 4EEFG 5DUIA 2CQNA 2K3PA 1U8RA 3M8EA 2Y31A 2K5CA 1MBKA 4DOZA 4Y13A 5M3FJ 5HVQC 2BW3A 2L9RA 1LKXA 2Y75A 3QP5A 1HW5A 1T08B 5E1XA 1O3SA 3M9AA 2L9VA 2BY2A 4CCOA 1QZEA 4Y52J 5TGTA 2GG5A 1GDTA 3E6DA 3HRTA 1FT9A 1BW6A 1MBFA 3V8KA 1KGSA 5GAHJ 1XX5A 4UNOA 4NB5A 2BY3A 5J8FA 3GO5A 1YS6A 2BHZA 2CU7A 2JQ7A 4M6XA 1TWCJ 2GZ5A 1IC8A 2CH0A 1YQAA 4YRVA 4PV4A 1REPC 2PMUA 1YW8A 3GLXA 3HKZN 2WTEA 2WAQN 1HSJA 1YRNB 4LFUA 4IXAA 3VYSB 3AFHA 3BR1A 1VQ4I 2FEZA 2GBYA 5CPRB 3OS0A 5HNFA 1EJ9A 1YYVA 2EZKA 2JVGA 1I39A 5F0CA 4L5EA 5H6RA 4B43A 4DW6A 4UUVA 3H5AA 3K4BA 4NUBA 1BJAA 1TWFJ 4YFNF 4IF7A 2HWVA 5FB2A 3FMQA 1HQCA 4LG0A 3CCEI 4LOCA 1BR4A 1YX5A 4JX5A 4QTRA 2B9SA 5K5RA 3ZQCA 3PKAA 4IU6A 2D2WA 2V6CA 3BIPA 3HSRA 2MLGA 4DYCA 4QR8A 1F36A 4FISA 2RN7A 3A01A 1GVJA 3KP2A 3HOSA 2UWMA 4O5VA 4A2UA 5CJ9A 2GIZA 3E6MA 3FISA 4QIWN 1ZREA 5KCMA 3K70C 4UUSB 1VQ9I 4LMYA 3H36A 1WH5A 5TRDA 2DXIA 4IHXA 1IJWC 3ZQFA 1BR1A 2OV7A 3CLQA 3DEWA 1T2KA 5FLXK 4RM2A 4CGZA 3BDDA 2RREA 3CUQA 1USSA 5KAFC 5LRRA 4A3MJ 2K9NA 1R71A 2HOTA 3SZTA 2DA5A 1JHFA 1S8NA 1HW2A 1ZRFA 2STWA 3GTGJ 3MR1A 3VPRA 3ZQ7A 1OCRH 1OKRA 1O4XA 5AIQA 2DU9A 4FCYA 1RR8C 3F3XA 3DWLE 3OYDA 3CB6A 3RPUD 1O3QA 2GGBA 3GFLA 3CESA 1B9MA 5HNHA 1R23A 2XPWA 2VC0A 2K7LA 1IUYA 3K10A 4FO8A 4JK1X 3KE2A 5FKNA 5EEHA 1UHSA 2CW0F 4BDZA 1JGSA 2ZSGA 2NRAC 1ZLJA 4HLYA 1OCOH 2DT5A 4P9UA 1B8IB 1FTZA 1WJEA 4Q5SF 1RUNA 1KYZA 2LBFB 5GAGJ 5FCHA 4BJTA 2ME6A 4EGYA 4RB1A 2HTSA 4N4NB 5CDEA 1QO0D 3RKXA 1OISA 3CC4I 4ENNA 3LA3A 2QZ8A 4XL9A 3JAMZ 2EV5A 4BHBA 3M8FA 5J1YA 3RKWA 4BBSJ 1HKQA 4JP0A 1WH7A 1HSTA 3BCAA 4RLQA 3K4KA 4U6EA 4EMSA 4OU0A 2HOAA 2A69F 1WGXA 4D7NA 2JVHA 1TNSA 4M9XA 3FHZA 4ZZLA 1ETOA 2Q95A 3PNYA 4E4HA 2CMPA 1U6GA 1R5HA 4IHWA 1ZAOA 2HOSA 2QSGX 1Y1NA 5E1ZB 1JI8A 4BBRJ 2GZWA 1E17A 4B3XA 4HAMA 4LK0F 2PEXA 2LY2A 4I6ZA 3CQZJ 3CP8A 2LC2A 1J7KA 4B4CA 2UXNA 4DIQA 4HDUA 4MFEA 2E34A 1QPMA 1LUJB 3WTZA 2GXBA 4RAFA 1X1DA 1D0ZA 4BXFA 4HNVA 2K4JA 2CQ7A 3CCMI 2CFXA 3DTKA 2M30A 3KLOA 2IS6A 5GADJ 3SFIA 2R93J 1B72A 1XS9A 2R7DA 4EGEA 3OYCA 4II2A 2BB7A 3HDDA 2PQ8A 4IRIA 2OC6A 1TZLA 3LL7A 4H4KC 5E3LA 2JA5J 1O57A 2IJLA 3M4OJ 1R9TJ 2OA4A 1WY2A 1XSVA 1YJ3A 1U0JA 1X19A 5F1RA 4CSWA 3HOYJ 3JREA 4RB3C 3DKWA 4C30A 3BJ6A 1BR2A 3OS1A 2VOOA 3OR2C 2V9VA 1SEUA 1I6HJ 1PP8F 4ZDOA 2A5WA 2FD5A 2BWYA 1FOWA 1TC3C 3H3ZA 1ZGAA 3D1NI 1ZELA 2K9MA 1ZG5A 5DS9A 1BJZA 5LHGA 4AIDA 2JA8J 3MVPA 3ZQGA 5H20A 2DYRH 1JTXA 4G12A 3HGYA 2EVOA 2GU4A 3G2BA 3K7AJ 2ZXIA 1AU7A 2BN7A 4LITA 4ESFA 2QF7A 4IO9F 3E5XA 5BS6A 1Z05A 2W24A 1YJWI 1IN6A 2MSYA 1STZA 2EV6A 3HYIA 4Y15A 1W0UA 1LE8A 2H94A 3K6GA 3L09A 2ID6A 3ZMZA 3QPHA 4LLNA 2VBWA 3TW6A 5F0HA 1JJ6C 5LHIA 1B1BA 3HB9A 2HKXA 3WTXC 3GTLJ 1YHQI 2D1HA 2MATA 1D8JA 1TWHJ 2DA3A 3FM5A 2GIVA 5M5XJ 1ODDA 2HQNA 1P7IA 4HG2A 1WSUA 4RAYA 3HRMA 5E5BA 3CCYA 4HQMA 1Z6TA 1FOXA 2HTJA 4BACA 1IN5A 1P4WA 3LMMA 1I6XA 2LVSA 1MH3A 2PJPA 4JQFA 3BPVA 3BWGA 3TW7A 4U0VA 4CYCA 3LWFA 2DYSH 4HRIA 2BHDA 1D8KA 1S7OA 1VTNC 1CHMA 1ZHFA 1LFBA 2P0WA 4BEHB 3OY9A 3IL2A 2NYXA 2EBIA 2IRFG 3DKXA 2XDVA 2CGPA 4WCGA 2V7FA 1R1UA 2HR3A 2FOKA 1F9NA 4BKXA 3HHHA 5IP6A 1B59A 4YFXF 1YTYA 1LB2A 2W25A 1XTAA 5E18F 1FLIA 4I09A 3OOPA 4A3DJ 4AYBA 2X6XA 3IWFA 3N97A 2XGEA 2O8XA 4G8XA 4UB8C 3CC7I 4KIFA 2GU6A 1H9GA 4FUKA 3G1MA 3QWLA 1MJ9A 2EZLA 2W57A 1C22A 5B1AH 5EGOB 1XB4A 4A6EA 3I64A 3BTCA 3DEUA 4F91B 3BR5A 4HDVA 3H35A 2B3KA 3CD6I 2MG4A 3J81K 2A61A 1MBHA 1ZK8A 3S8PA 4Q47A 2R5ZA 2VJ4A 1HOMA 4BDYA 4NBQA 2BXYA 3KPHA 2CRGA 3HL2A 3CB5A 2XROA 1MMDA 5K7HA 2LH9A 3K4MA 1MSEC 3BLYA 2XAFA 5IOZA 3WU1B 2Q1ZB 5K7ZA 2QQ8A 2DAOA 4AIJA 5D5WB 4OIPF 2KQRA 1G4DA 4YIRX 2LK2A 4RM3A 4IRGA 3V8JA 1CF7A 4ESBA 2BWSA 5D6FA 4RGXA 4A3BJ 3PKBA 2VE9A 1O7LA 1TT0A 3PUBA 4GRIA 5DEQA 3TOAA 4ZZDA 4XRSA 2XSDC 3KX2A 2E1NA 3CJTB 2IW2A 1S5LC 1AA7A 2BWWA 3E5UA 3V42A 2DA1A 1BI3A 4A6WA 4AWXB 2FMYA 4DBRA 1FJLA 1DPRA 2KJCA 2GTXA 4KT6A 5EG0B 2KJBA 2AS5F 1SMTA 1J2XA 4RGUA 4M9SA 2E36A 3OIOA 3TDUC 1DDNA 4ESJA 4JOMA 5DCMA 5BQTA 2PJRA 3HOZJ 4ZYDA 1U8BA 1QXZA 1P6RA 3QU3A 1JXSA 1GHCA 4UV9A 1LVAA 1Y8RB 2MGQA 3QYBA 2DQLA 3NQOA 2X6OA 2A5YB 5FD6A 2QVOA 3BG5A 3GMEA 3S14J 2F2EA 4AD9A 3QODA 5EYRA 1K6OA 2LD5A 2ZXHA 1FTTA 3QPTA 1DP3A 1YJ9I 4AYBN 4BEHA 3T8TA 1A6QA 5IPAA 1RZ4A 2OQGA 1A6IA 4FX4A 1BM9A 3DEEA 1ON2A 2RV8A 3K69A 3BR6A 4WXDA 3WG7H 3WE3A 2FRHA 1U9OA 3K2AA 1BBYA 2H27A 1AOYA 4KISA 1WL9A 2BBYA 2JSPA 1OCPA 2DMPA 1IXSB 2UUZA 2M87A 5GPCA 2BWUA 1G3SA 5EGOA 1VNDA 1P7JA 3TMOA 5C4XJ 1HC8A 4KIGA 2RVCA 1RRJA 2BZTA 4XN0A 4AVPA 2DTZA 3LSIA 5DM7F 2LKPA 1KONA 1KQ9A 4RZZA 1FP2A 4L9VA 3GFIA 5FKMA 4U88A 4I7HA 2OU2A 5H2FC 4M74A 3FMSA 2DFFA 2K9LA 3L2RA 3GF2A 3ZN0A 5CVRA 1X1AA 1BOAA 3C2HA 1ULYA 1FYLA 4EJOA 3F8CA 1IRFA 2ZNZA 2XAJA 1H0MA 3J81Z 4XONA 2MW8A 4B48A 4IHYA 3BTLA 5HS7A 4M3EA 3M3YJ 3BPXA 3MMYB 1BOBA 5LBQA 2M0CA 2D45A 3HOWJ 4MLOA 3K4JA 3ABUA 1VQNI 4HNTA 4Q48A 1XGOA 5FD5A 5E3OA 1CGPA 1U2WA 1MNMC 1XSXA 3J7AO 2FBKA 4PSWA 5L3EA 2WV1A 3FHNA 3KZYA 1PUEE 4L5IA 5LGUA 4C3JJ 5E3NA 2Q8KA 2WV0A 5GTHC 3HTUA 3I55I 2DBBA 2XF5A 3Q0VA 3ESWB 2Y9YA 3TKYA 2M8EA 1IRGA 4L0ZB 1SC7A 2OUMA 2K27A 1TQPA 4W97A 3W2WA 5A2QK 1LFUP 2DT7B 2M2EA 5F64A 2Q96A 3VSKA 3CMMA 3IKVA 3L9FA 2R5YB 1U9NA 4E70A 1W36D 3J80K 2RAEA 2COBA 3M1CA 4BE2A 2R7ZJ 5HDGA 5CVUA 2BOLA 2XRNA 3Q9VA 1GXPA 4RGZ1 3DLAA 2EIKH 3SEQA 2M4KA 3P7NA 1ZRCA 4BNCA 2PLYA 3WGIA 2F4MB 3H5RA 4CH7A 1R00A 3S2HJ 3GZ6A 1GVDA 2VN2A 3T1BA 2M8GX 1IUFA 2WC2A 5LLQA 1Y56A 3LFKA 3OWTA 1KU3A 3B73A 3BQYA 4C2UA 2KHMA 4Z6YA 3TO6A 3QU6A 1YVMA 2HKOA 3IC7A 4U69A 1Z9CA 1ETVA 1OJLA 4IHTA 3F9KA 3IAM2 1SANA 3ZQHA 2HS5A 3I56I 3OSGA 2BW3B 1R5ID 3RTRA 1IDYA 2NOJB 4HLXA 2FA5A 1JTYA 2LRDA 3CJRB 3H3VK 1HKTA 3EQLF 4PK4A 2R7QA 3ML6A 2WY7Q 3OYHA 1I3QJ 2ADUA 1QA6A 1VQ6I 2VT2A 3X2QH 2JTVA 3U1DA 3M07A 3WTYC 3VDXA 2R7OA 2OCEA 1KQ0A 2H1KA 5ILUA 2OF7A 3GTPJ 3WGGA 4X6AJ 2IW5A 3G3ZA 2BVMA 4A6VA 2IVMA 2FXAA 2A6HF 2MH9A 5LD2C 1QVUA 4J01A 3LSMA 4D9JA 3TO9A 4ZYGA 3CO6C 4Y17A 1JKPC 2A05A 2MLKA 4G94A 2KDZA 1XC5A 2VXZA 4CCMA 3CMEI 3FBIB 3F22A 4LJZF 4FTHA 5CVJA 4ANJA 4HF2A 3JCUC 1O3RA 4ZC3A 3L24A 2WAFA 1JT0A 1YLFA 3CP2A 2VQLA 5DV5A 4ENJA 2TRTA 2FQ4A 3RSNA 2ZJRF 2CJJA 2CQKA 1T33A 3FXOA 3O2PE 4HX8A 4I0AA 1H89C 3B6CA 4DZJA 2ZNYA 4LG0B 2LOOA 4EJWA 4TV7A 4UUTA 3EPZA 3PFIA 2E7XA 3IRRA 1SFOJ 3HHGA 5JLXA 4N9HA 2B7EA 4EJTA 3A01B 1W2MA 2RQQA 2K3FA 5CVIA 1POGA 3BQZA 4PFOA 3MKWB 2EA4A 5HDNA 3BIQA 3M8JA 4M72A 4A3FJ 3QP6A 4IVNA 2TDXA 4A3IJ 4S04A 2NQ7A 4CCLA 4EGZA 3R0AA 2OTJI 2F4OB 5IY5H 2JSCA 3ERED 3CCLI 2XASA 4L0YB 2Z33A 5A2QZ 1V5GA 3D5RC 3CUQB 4UVBA 1KQ8A 1WWXA 4I02A 1R22A 4P55A 1Y8QB 4XIDA 4YEJA 4CA0A 3ONQA 3K0LA 4XKBA 2P7CB 2LFBA 3J80Z 4AC0A 3FKIJ 1XMXA 3QQAA 3PFYA 2P5KA 3BP8A 2KFDA 1UMQA 2NOGA 3S17J 2GG2A 2QYOA 3BG9A 1HDDC 4HF1A 1H88C 3HXLA 4BJ5C 3CO7C 3CCJI 2Z3YA 4B47A 3J7YJ 1LFPA 1YX3A 2JT1A 3WODF 3JAMK 3JTHA 1UFMA 3M1EA 4GFBA 4JBAA 2RQPA 1G6NA 4Y3OA 2BWVA 1G2HA 2CUZA 3OR1C 3IH2A 4HEA2 5LEKA 4RGSA 1BI2A 2JPBA 1MW7A 2D5VA 2E7WA 4RBOA 3H9JA 2CW8A 4HZFA 5FJ8J 1BC8C 1SFEA 1TP4A 2N8GA 2P99A 4FLIA 2VKVA 4IOCF 1KU9A 2WWYA 3HGGA 1L3LA 2RNJA 5FKOA 4OIQF 1WJAA 4ZH4F 4ZYEA 3GZNB 3OYEA 1S7EA 2ZJPF 4NNJA 1Y0UA 4HA8A 3H92A 5KVRA 1ZG3A 1DU0A 4IOAF 2CV0A 5GTIC 1Z1DA 5J8CA 3AL0C 2ECBA 1E3PA 4S2TP 2R7RA 3I0TA 2L7KA 2BGCA 1F1ZA 1W5TA 4BXXJ 3VSLA 4EQQA 2HVQA 5D6EA 4DQ2A 3Q0UA 1OPCA 5D5XB 4KMUX 4I98B 4G7HF 2PG4A 3I4PA 2O9LA 1XGNA 3ECHA 2QQAA 4ZDLA 4RZYA 1LDDA 2BVLA 2MABA 2L0KA 1SFKA 4JYKA 2Y2ZA 1J5YA 4U70A 3WHBA 3LA7A 2NNNA 3I59A 3PL8A 3ZMUA 5JR3A 3H0DA 2GAUA 2HVSA 1LQ1A 2G0EA 2HPIA 2EINH 1YE9A 2VC1A 1WJ5A 2NXNB 1MH4A 2ELKA 4BY1J 3WG9A 2VL8A 2ZO4A 3PKCA 2EFNA 2B3LA 2BY1A 1IF1A 2DOEA 4GCVA 3ASNH 4U87A 4IKRA 4UY8I 3LSKA 3I3LA 4M3GA 1IG7A 1GUUA 1IV6A 3WE2A 3WTTC 5JHFA 5IT9Z 1B72B 5DTDA 4JX6A 3CMAI 4N9IA 2VLAA 4LD5A 4MQ9F 4F92B 2W85A 4A5MA 2MBFA 3GX4X 4C2TA 2E1CA 2JN6A 4S00A 4B44A 1ZYRF 3HOUJ 1ACIA 4X0GA 3ABMH 2DJNA 3BC8A 1X3WB 2IA2A 1R58A 4WXCA 2OPTA 4CXFA 1A36A 2O6GE 1JKOC 4D1QA 1EA3A 1TQMA 4HXXA 4S2RP 3Q6DA 5EEAA 3L2QA 1ZGJA 2CUEA 2PFBA 2P8TA 2XAGA 4ZWOA 1G59A 2ZXJA 4D0PA 3MATA 1ENHA 3RI4A 2IT0A 2HDCA 3JRGA 3SYTA 3BCBA 3CF2A 3M7GA 5KAIC 2XSJC 3JSPA 3UR3C 2EZIA 1D3YA 2AXTC 2G7HA 1RI7A 3SZGA 4PGGA 3GCMA 2NVQJ 3EYIA 3BZKA 3AL0B 1FOKA 1P9QC 3MN2A 4G7ZF 4BJ6C 3I71A 2V9KA 3RCOA 4R79A 5ILVA 3UNGC 1OYIA 2IGKA 1LE8B 1APLC 1WJDA 5M5WJ 3AAFA 4M6VA 4QWQA 1YITI 2LTPA 2WY8Q 3A02A 1NK3P 2V1DA 3BR3A 5F04A 4BXUA 5IP9J 3S3OA 4RB0A 4I99C 3JRFA 3HPHA 4C2MJ 1R49A 2BHYA 2DCEA 4FASD 2E5NA 1X1BA 3OYNA 1WN1A 4IJAA 2DO7A 1S72I 2X1EA 4BGDA 2O0YA 2ID3A 1GV5A 1KU2A 4XRMA 2MD0A 2BY0A 4A3EJ 3ULQB 1E2XA 1Q1HA 1BL0A 2Y69H 4CYCB 1DU6A 2I10A 1QHGA 4HF0A 2JJ7A 4XMYA 2FQ3A 3DF8A 1JHHA 4OIRF 3E97A 1V55H 3ZOBA 1WCMJ 3L2CA 3I53A 2XV4S 4UB6C 5L3FA 4YIFA 3KFWX 3JRIA 3IG4A 1TT5B 2K4BA 1QU3A 1OR7A 1Y6IA 2NS0A 2PMHA 3FWEA 2X51A 2VKEA 3IH3A 5IYCJ 4PJJA 3ZR8X 1QHHD 3NARA 5CDVA 4IF4A 4BAYA 5L3GA 4C3HJ 1ETQA 3MD2A 1UCRA 1WQ2A 5B5EC 2R7VA 1TBXA 1W4MA 2XKPA 3ABLH 1VQOI 1KZHA 3CLOA 4JUQA 1Z91A 2HYFA 1NG6A 3E3VA 3KP7A 2KISA 2R5ZB 4ZTJA 4KMFA 3DTEA 4AU7A 3JRDA 5K7FA 1XGMA 1QNTA 3GYHX 3P5JA 3QOEA 2GU7A 4FX0A 1RR7A 3TL4X 2QEXI 4FLLA 1PV9A 4OAYA 2GLOA 4OINF 4OMZA 1CF7B 4HX7A 2KIQA 4PZJA 3KYLA 2VT3A 2QKLB 1AKHA 2XGXA 3I4MJ 2P5VA 2P4WA 4YG2F 3WTUC 2DQRA 4KJZA 1ITYA 2V6EA 1A04A 2CYYA 2W1OA 2LNBA 2WB1A 3MCZA 5EZHA 2ZMEA 1G3YA 1TNTA 2J5OA 3C7JA 2L02A 2KIFA 1UJ8A 1B6AA 2JK3A 1K79A 5LRSA 4O3MA 1S9HA 1WVRA 1T95A 3FMRA 5J6XA 2ESHA 2Y0MA 3PSFA 2X85A 5DCMB 1W36C 2PJRB 2M0MA 2GG0A 1VZ0A 4A0YA 4IQ4A 2LLKA 1FBSA 1YIOA 1PUFA 2XPVA 5C44J 2XAUA 4AVZA 2Y9ZA 3C2BA 3DQVC 3P9KA 4OMYA 2YPRA 3OYAA 3OL4A 4F55A 5D8KB 2QCOA 2OCCH 4U7DA 2LREA 3G4SI 1WL6A 4XNFA 2W48A 2AO9A 4IL6C 4KN7X 4A6DA 2HPMA 3DPUA 3KETA 1JKRC 1SVOA 1MJBA 2IS2A 4LLLA 4D5FA 5EEGA 4CYDA 2YS9A 3BT9A 3F21A 4E7JA 5M5YJ 2ACJA 1FBQA 5CLSA 1FMWA 2VKHA 3EUHA 4HSRA 5AONA 1K4TA 1EH7A 1A16A 4S05A 1ORKA 2CSOA 5B1BH 1YO5C 3LQQA 1W5SA 1WJCA 5E8GA 1DQUA 2EK5A 2EFWA 4MEYF 5L3BA 2ZSIB 1FY7A 2A6TA 3KEOA 1GXQA 3ZMSA 3OSFA 2KPMA 2MA3A 2BH3A 2QWWA 2V9PA 3O8GA 1IGNA 2JA6J 5CDLA 2I8DA 3EETA 3ZCOA 1T0FA 3C2GA 2ZBKA 2F5DA 4NC6A 1P92A 5K1YA 3CDIA 3LNQA 4KITB 5EDNA 2Z5UA 4XRFA 5F1JA 1H9TA 2ISZA 1IRZA 4PCQA 2JUCA 3IH4A 4PSXA 2A6EF 2VJ5A 3JRAA 2W00A 4CZZA 4FE4A 1NHAA 3S16J 4LLGF 3B6AA 2LMDA 2IXSA 2BHCA 2HZDA 1OYYA 1TLHB 2PBIA 2P6SA 3CTZA 3OYGA 1FBUA 4ZWUA 3PSIA 3BR0A 2IS4A 3CMYA 3CJQB 3MZYA 3LFUA 2QA4I 2Q92A 1IN7A 2VPLA 1Z3XA 2Y0SA 2R3SA 4XLEA 2WB1N 3SFZA 3FXJA 5EJCA 3SDGA 1UHMA 1F4KA 1R1TA 5B66C 4ZDPA 3DFGA 1BN5A 3V7CA 1MZBA 2GXAA 3ZQIA 1SFXA 2DDAA 4RDUA 2DDBA 3Q3SA 1PYVA 3U21A 4EJVA 4HBLA 4HQEA 2WA0A 4YFKF 1BA5A 3AKZA 2LYCA 2RKHA 5GAEJ 3I58A 1HKSA 3JW4A 5IYDJ 1USTA 1SD7A 2IBDA 1RESA 3IU9A 1C24A 3MWMA 2XAHA 3TAVA 4KUMA 1UAAA 1TW3A 4IZZA 1V5EA 1FSHA 4MNUA 4MEXF 1D5VA 2QQ9A 1DGWY 4AIKA 2R7XA 3FXUA 4G9YA 4BE0A 5DD4A 1Y0NA 3IRQA 4XK4A 2R7WA 2X0LA 3HEFA 2L5QA 4WWCA 2HOWA 3HPGA 4ABZA 2XB5A 2L9NA 3S15J 3ZRGA 2JA2A 1K83J 4MGRA 5IP7J 2FOWA 4P5OA 1E0EA 5EZGA 1IDZA 1XSDA 3PIPF 3E0JB 5E8IA 2EH3A 4A3CJ 2E19A 4MFDA 2K9QA 3OMYA 2HYGD 2DODA 2HU9A 2XPUA 2OAZA 4ETSA 1O7FA 3JRHA 1OCCH 2P7VB 2X6WA 3LQRA 1QBJA 2H8WA 2HDWA 3IAS2 3ZXSA 1MMGA 1J59A 4E7LA 3R61A 2I5UA 3MKZA 1WJFA 4EM0B 1LJ9A 2FU4A 2MYSA 1U3EM 3L7GA 2EVCA 4BHCA 2RNGA 5FLVA 1FYKA 4O6JA 4IPAA 1I3AA 2O3FA 2CUJA 4GGGA 1ETKA 3DPLC 5KHDA 1UHWA 1YG2A 3CJNA 3T8RA 2CUFA 3IP4B 1HDPA 4ZYHA 4PJLA 2G9WA 1V5FA 2Y0SN 4KNYA 1MJAA 5HLTA 1JJ8C 3JRBA 1X4PA 4KIBA 2GG9A 4CCKA 1IXCA 2Q93A 2K9SA 4BH9A 3TEDA 1NTCA 2L4MA 3R4KA 3I4NJ 3BG6A 1MDMA 1JE8A 1QXWA 3W6KB 5L3CA 3TGNA 1Q1VA 3FIWA 2L7FP 3S3MA 4ON0A 1N77A 2YX4A 1DPUA 2CG4A 5HOOA 1YJNI 2MD5A 2PI0A 3P9CA 1SD4A 3CDLA 2DA6A 2EFOA 1MMSA 3FBNB 3KEYA 5J1UA 2NS7A 4MHGA 1GT0C 3GXOA 4Y7NJ 4L18B 2NQ6A 1QXYA 5BPIA 2OD5A 1WZ2A 5LHHA 2DJIA 3ZMDA 1SVMA 4KYWA 1R6RA 4E7IA 3RKQA 2EJRA 6PAXA 2PMZA 1JKQC 3IU7A 3LAJA 2F4IA 2F6CA 2DW4A 1Z7UA 2AQFA 4FKCA 4IHSA 5CYVA 5ICGA 3A0HC 3A1YA 1Z67A 2L7ZA 1BIAA 4FHTA 2OKNA 2K85A 3BJAA 1Z6RA 3OIPA 1A35A 2HQ5A 5C3EJ 2KL4A 1V4RA 2KLOA 5JVTA 1KYWA 3HUGA 2LP0A 2GWRA 4XLAA 5D4RA 2D1VA 3HZJA 2RC4A 4XOPA 3K2ZA 5BPDA 1IAWA 1ETXA 4HW0A 2DA7A 3F72A 2HOEA 5FKKA 1XDUA 3CDHA 3FF5A 2M9HA 4YELA 2XUBA 4S01A 4NQWB 1SAXA 3R0JA 2YSRA 4GXOA 2E2IJ 5ILSA 4HV6A 3HJEA 3COAC 3A2KA 2COMA 4C9YA 2R7SA 2DFHA 3LA2A 4KDPA 3JRCA 2QBYA 3L2VA 1QGPA 3P9IA 1X3ZB 1YW9A 3GTOJ 3ASOH 3G6EI 4FO7A 3ZPLA 1TWGJ 3C1DA 4BHPA 1IO2A 3CUQC 3DLLF 1VQ7I 3WTWC 1IZ1A 3F8MA 1VQ5I 2M34A 4A5NA 4Q4ZF 2HGCA 4FT8A 1C27A 1K4SA 2KIUA 4JX4A 4BS9A 1I50J 2JRTA 2YR2A 1W0TA 4I0BA 4EJUA 5E20A 4PJMA 2M1BA 5H6QA 2OZ6A 4A93J 3V4GA 3GTJJ 4Z7MA 1TWAJ 2VBXA 1ZLKA 3FXRA 4ZYAA 4R60A 1U5TB 4L9JA 2ETHA 2P98A 2UXXA 3R6SA 1EV7A 2L54A 5F0FA 2XC7A 1R5GA 3OOUA 2ESNA 4PNCA 2PMZN 1RUOA 2M7BA 1FEXA 1C23A 1RKTA 3GBGA 2IEKA 4NC7A 4PDKA 1Z3YA 4P9FA 3IV5A 1VF9A 3WU0A 3VODA 2QSHX 1KU7A 4FETA 4P96A 2X4HA 5ICFA 3BR2A 4P1WA 3DBRB 4ZJZA 2EIMH 3KP4A 5GP9A 3S32A 2Z99A 1FZPB 3CTAA 4G6DA 5IT9K 4QPOA 5LEJA 3DTIA 2IP2A 4BQQA 2LKXA 2Q2EB 3I59B 5KNLA 4LG3A 5TISC 2DA2A 2O61A 1LPQA 4S0HB 2E2HJ 2HXOA 2XKOA 1XGSA 2V1XA 4AIHA 2LF8A 3CF5F 1RKWA 1BIBA 4QPQA 1LEBA 4L9TA 3L1PA 1UZCA 2IA0A 1LDKB 2P81A 3TBIA 2A3SA 5FFZA 3HTSB 3RVAA 3F0CA 5ICCA 4NQWA 4D7MA 2OQRA 2IAIA 3TB5A 1A31A 5AIPA 3SDBA 1KA8A 1Z0XA 2VJJA 5HLIA 3H9QA 4LIUA 4XBFA 3PQKA 1H8AC 2CV2A 2L9SA 1ERDA 3VYRB 1OR7C 4XLNF 2L4AA 4U7BA 3BY6A 1P2FA 1WJBA 1TQIA 1OFCX 3GTMJ 2BE5F 2DA4A 4KICA 5E1WA 3F6VA 3F6OA 4KA4A 4PUSA 1LNWA 2DLLA 2V26A 2GOMA 2Q0OA 2L2OA 2VBYA 4CCJA 1VQMI 2G6PA 4H0EA 3RZDJ 1X4OA 2MC4A 3MKLA 2E1OA 2R7UA 4GDFA 4IEJA 3EDPA 1LEAA 1FYMA 1S3JA 4KM3A 2KKOA 4E7KA 3CCUI 3PNTA 2HFHA 3GWZA 3E1SA 3F8BA 3S2WA 1X1PA 1E3OC 1X1CA 2ELJA 3WTVC 3OYIA 1U5TA 3RQIA 1X2NA 3NWTA 5BOXA 2BXZA 3K4CA 1W7PB 4Y33A 1O3TA 2ZJ2A 5HDKA 1TL8A 4MO7A 4M9ZA 3SEZA 2KMUA 2BWTA 5IT3A 4D5CA 5EF6A 1FPQA 2ZMEC 1K78A 1UB9A 3FM3A 2QGUA 4ITVA 4XR6A 3KYDB 3CUOA 4RAZA 2TCTA 4I01A 1TTYA 2IGMA 2DN0A 4OOIA 3DV8A 4B3AA 4IRHA 5FCFA 2Q2EA 1ZKGA 1EH8A 2FMLA 1QZZA 1S6LA 3HOXJ 3K1PA 4U75A 1WLRA 4EM2A 4M73A 3CZ6A 4IHVA 1E3HA 2H6BA 4FQGA 3VYUB 3LOCA 3L2UA 3HOVJ 4RAGA 2CS3A 2V4JC 4IKTA 1MSFC 3BROA 3L2WA 1FC3A 4BE1A 2GXGA 4E7SA 3GFMA 3W3CA 3KP5A 3G1OA 5J3LA 5HS8A 5GPAA 4AM3A 3E6CC 1RNLA 2DMNA 3O8HA 3H5NA 1QPIA 4XKCA 3S1RJ 3BITA 3OYMA 2KZVA 3GZ5A 4MATA 1YOVB 3EUHC 1MKMA 3PJRA 5JI6A 2DOAA 2M4GA 1AHDP 2F5VA 4BQAA 4MIMA 5CQEA 3RPUA 3HG9A 5C4JJ 3H1CA 1ZARA 2ELHA 4F7ZA 1EF4A 2DK8A 3U9GA 3QOPA 1T38A 5B3SH 1O0XA 2P9AA 2HVRA 3RKYA 1T0FC 3RJPA 4HOBA 2Y30A 2VJIA 2LSOA 3O6BB 4A3KJ 2XF6A 3H0GJ 2CQXA 2BEOA 1MMAA 4WX9A 3HRUA 4WXHA 1OCZH 1MBEA 1MGTA 4J00A 2VONA 2W82A 1ON1A 2BYVE 3W6VA 1D5YA 3BG7A 2CO5A 3LSJA 1AKHB 2NS8A 2O7OA 3OIQA 4XLFA 1C0WA 1J0RA 3OYJA 2R7TA 3K9TA 2LY1A 3JTGA 5JLWA 4RMNA 5J1RA 2ZMEB 3R60A 1IN8A 1RIOH 5FRNA 1B4AA 4OWRB 1RC9A 4XICA 4IKFA 1UELB 2FUG2 1W7PA 2QM3A 3ERMA 3PKEA 4IX7A 4XN3A 2VI6A 1X58A 3ABTA 3L7WA 4N4OB 4A0ZA 5TJJA 4G7OF 2AHQA 1P4AA 1PUFB 4QSHA 4ZTFA 5LGTA 2L3DA 2B63J 1T6SA 3HIFA 4G6QA 4X1EA 5F27A 2EFQA 1M35A 4U6ZA 5M3MJ 3F8NA 1YW7A 2WBMA 2NVXJ 2FF4A 3IUOA 4CUGA 1WI3A 3TP3A 3LSGA 5DUKA 1HCRA 1HW1A 4BQOA 2DT6A 5K5OA 1YRNA 1ZTRA 4IKSA 3S3NA 3RORA 3VYTB 4W1UA 1WRJA 1SMYF 3NEUA 3WHCA 3CCVI 1MD0A 4WF2A 5CIKA 2RGVA 1W7PD 3OV8A 2A07F 1S7AA 2HI3A 4M6YA 1JGGA 2E71A 3V7SA 4U0YA 4N0BA 2DFIA 2X1CA 2CV1A 2BHAA 2XVCA 2UZKA 2ZXWH 1FMVA 4LK1F 2Z2SB 5IOYA 3BZ6A 3E5QA 4CHUA 2WAEA 2NNYA 2GG3A 4B8XA 2AXLA 5JFRA 3KP3A 4CDGA 1ZQ3P 1N25A 2LKSA 4KT5C 4NDLA 3LSRA 5F6FA 1T56A 2M5WA 5DD8A 3DXJF 3SZPA 2FX0A 2OZUA 3MZHA 4GYIA 1LVKA 3WU2C 3MAJA 2VE8A 4HNUA 4BY7J 1R36A 1EH6A 3G71I 3FXMA 3DBHB 2DFEA 2QUFA 3H9GA 3MEXA 4LGWA 3V8LA 3S93A 1YFHA 1D0YA 1NK2P 4XLPF 2GG8A 1YS7A 4ZWPA 4UUSA 4Z2YA 3TDZC 2EPFA 2NVTJ 1JUSA 4FLJA 4BUPA 2JPCA 2V3XA 3H3UA 1YIJI 2ZFUA 1OCTC 1M1EB 2KRHA 4UVAA 5BNGA 4L5JA 2EV0A 2DTRA 4A3JJ 4M3DA 1XPXA 1SFUA 5FGMA 3U2RA 3FX3A 4I2OA 2FBHA 3AG1H 3W2VA 4BYYA 3DU5A 2X48A 4XLCA 1PJRA 2VOPA 5DM6F 1U78A 3GTKJ 5LGNA 4LIVA 3DU6A 3QRFF 4CZCA 5E17F 2PN6A 5FLXZ 4M3FA 4A3GJ 4U6JA 3IWZA 3RPQA 2R7FA 2EFPA 2E35A 2EVMA 3KZIC 3CCQI 3D0SA 2V1UA 5D5UB 2H1LA 1WI9A 4HYEA 3GW2A 1GLNA 2ICWG 2ZB9A 4M71A 2FSWA 4B1RA 3OYBA 1B8IA 3W2AA 1WBQA 2LBFA 2KZGA 2E1MC 5D5VB 4UXNA 3OYFA 4OOKA 5CE6A 1D1AA 1XNZA 2XF7A 3QAHA 1T39A 5FROA 1FX7A 3AG2H 3DKYA 2EWNA 3E6BA 3GVAA 3EYYA 5FRMA 4U0WA 4V2GA 2BHBA 2VXDA 3KEQA 4G6TB 2DMQA 3RDIA 3VB2A 2V3ZA 4E6KG 2LG4A 3K1MA 5E79C 2VUMJ 4UVCA 2KP6A 2WADA 5J4YA 1I1SA 3ABKH 3HOTA 2OTLI 3HC7A
chains in the Genus database with same CATH topology
4B28A 1T98A 2H09A 1QQIA 4MTEA 1I27A 5ED4A 1XMAA 3WTSC 3MQ0A 2V79A 2FNPA 3ZN1A 1I1GA 1N51A 4OIOF 1I5ZA 3KCCA 2ZKZA 1K7AA 3MX6A 1MDMB 4MTDA 3D5LA 2A68F 3K1NA 3SXYA 2RDPA 4U6WA 4KFCA 5FFXA 2HZTA 4A12A 5D4SA 4IKUA 2ZCWA 1BI1A 2EB7A 2L01A 4U76A 1FSEA 4RGRA 2K02A 4IECA 2KRFA 3VOEA 5BMZA 1OMIA 1AWCA 3BOQA 3F23A 1XD7A 3JSOA 3O3KA 3G73A 2F5CA 1JAWA 2GG7A 1FP1D 2F5EA 1DUXC 3VEPA 2OBPA 1W7VA 1MATA 5DYMA 3ZMTA 2DI3A 3ISPA 4R8HA 2Y48A 4EVIA 3NRVA 2G7UA 5HLHA 2HEOA 2GA1A 2K86A 2MH2A 2BWXA 1ONVA 1SD5A 2Z9OA 2O03A 4GO1A 3IHUA 1R7JA 1L0OC 2QBYB 2LF7A 3I54A 3ZMVA 3FXQA 5JHUA 4ENKA 1HBXG 4U6CA 3T0YA 3SHFA 1IXRC 4XSZF 1XCVA 1B9NA 3TOBA 2QLZA 1TW2A 3RIRA 5HS9A 3F8FA 5FO5A 2QENA 5CVVA 4HV5A 3VFZA 3I5UA 1P4XA 4U71A 1DP7P 4PGHA 3KLNA 2Q94A 2ZFWA 2W84A 1ZN2A 3C18A 2DPDA 3PQJA 5K5QA 5D8LB 4RS8A 3HSFA 3IU8A 1KP0A 3DP7A 2IPQX 5CNXA 3TO7A 3HRSA 1U5TC 3RYPA 3V7RA 3MFKA 4CO8A 4KN4X 3T5XA 2LDUA 4A0XA 3ECOA 4ENMA 1ZRDA 2DPUA 3HSEA 1ZH5A 4FLKA 2XIGA 2B0LA 3KZZA 1C21A 1R1VA 1PP7U 3GUDA 2BV6A 4UHTA 1G3WA 3C3WA 4U1BA 3Q5FA 4RB2C 2HQRA 5HLGA 5ICEA 2XHKA 3Q9SA 4B09A 4U73A 3ZP5A 1QZYA 2FE3A 2STTA 4EM1A 2P5LC 2M45A 1XCBA 3L00A 2KIMA 2XAQA 5DCFA 4QLCU 3SQNA 4UV8A 2VODA 3BJOA 3RYRA 1G3TA 3WGHA 4CICA 4ASNA 4WK8F 3GEZA 4GYGA 1V3FA 2J5PA 1X3UA 4L9NA 3KP6A 2GA2A 3N4MA 1OYWA 3TQNA 1F5TA 2DK5A 1K78B 3ROUA 4R1HA 4XSXF 4YIIA 2P6TA 1FWZA 1J75A 2F5FA 1IW7F 1XDSA 4DNCA 2B3HA 3ELKA 4HX4A 1XMKA 3LSTA 3B02A 5L3DA 2EA2A 2ISYA 1LDJA 3REOA 2GU5A 5ERIA 1HXDA 2C6YA 2FBIA 1FNNA 3W6JB 4EV0A 4ZNGA 2MC3A 1J9IA 2VBZA 1S29A 5KK1A 1IN4A 3LAPA 4NHJA 2YU3A 2V3YA 3S6BA 2H6CA 3D27A 1XN7A 3DPTA 5DDGA 2GQQA 1WKMA 3PKDA 2NAZA 2IA1A 4MQVA 1ZG1A 2YX7A 4IDYA 4LB5A 4K2EA 2CWEA 2JZYA 1BC7C 3FZVA 2GGCA 2FNAA 1PDNC 1SD6A 3GFJA 3IKTA 2QQBA 4LB6B 1BI0A 5DUIA 1U8RA 3M8EA 4Y13A 5HVQC 2Y75A 3QP5A 1HW5A 5E1XA 1O3SA 3M9AA 2GG5A 3E6DA 3HRTA 1FT9A 3V8KA 1KGSA 4UNOA 4NB5A 5J8FA 3GO5A 1YS6A 4M6XA 2GZ5A 1YQAA 4PV4A 1REPC 2PMUA 1YW8A 3GLXA 2WTEA 1HSJA 4LFUA 4IXAA 2FEZA 1YYVA 5H6RA 4UUVA 1BJAA 4YFNF 4IF7A 5FB2A 2HWVA 3FMQA 1HQCA 4LG0A 5K5RA 3PKAA 4IU6A 2D2WA 2V6CA 3BIPA 3HSRA 2MLGA 4QR8A 2RN7A 1GVJA 3KP2A 3HOSA 2UWMA 4O5VA 4A2UA 5CJ9A 3E6MA 1ZREA 4LMYA 5TRDA 1T2KA 5FLXK 4CGZA 3BDDA 3CUQA 1USSA 5LRRA 3SZTA 1JHFA 1S8NA 1HW2A 1ZRFA 2STWA 3MR1A 3ZQ7A 1OKRA 5AIQA 2DU9A 3F3XA 3CB6A 1O3QA 2GGBA 3GFLA 1B9MA 1R23A 2VC0A 2K7LA 1IUYA 4FO8A 4JK1X 3KE2A 5EEHA 2CW0F 1JGSA 2ZSGA 2NRAC 1ZLJA 4HLYA 2DT5A 4P9UA 4Q5SF 1RUNA 1KYZA 5FCHA 4EGYA 4RB1A 2HTSA 5CDEA 1QO0D 3RKXA 4ENNA 3LA3A 2QZ8A 3JAMZ 2EV5A 4BHBA 3M8FA 3RKWA 1HKQA 1HSTA 4U6EA 4EMSA 4OU0A 2A69F 1TNSA 4M9XA 3FHZA 4ZZLA 2Q95A 1U6GA 1R5HA 1ZAOA 1Y1NA 5E1ZB 2GZWA 1E17A 4HAMA 4LK0F 2PEXA 1J7KA 2UXNA 4HDUA 3WTZA 1QPMA 2GXBA 2K4JA 2CFXA 2M30A 3KLOA 2R7DA 4EGEA 2BB7A 2PQ8A 4IRIA 1O57A 2IJLA 1WY2A 2OA4A 1XSVA 1YJ3A 5F1RA 4RB3C 3DKWA 3BJ6A 2VOOA 2V9VA 1PP8F 2BWYA 3H3ZA 1ZGAA 1ZG5A 5LHGA 5H20A 2EVOA 2GU4A 2BN7A 4ESFA 3E5XA 5BS6A 1Z05A 2W24A 1IN6A 1STZA 2EV6A 3HYIA 4Y15A 2H94A 3L09A 3ZMZA 3QPHA 4LLNA 2VBWA 5LHIA 1B1BA 2HKXA 3WTXC 2D1HA 2MATA 1D8JA 3FM5A 2GIVA 1ODDA 2HQNA 1WSUA 4RAYA 3HRMA 5E5BA 4HQMA 1Z6TA 2HTJA 1IN5A 1P4WA 1I6XA 2PJPA 4JQFA 3BPVA 3BWGA 4U0VA 3LWFA 2BHDA 1D8KA 1S7OA 1VTNC 1CHMA 1ZHFA 3IL2A 2NYXA 2IRFG 2CGPA 4WCGA 1R1UA 2HR3A 2FOKA 1F9NA 3HHHA 1B59A 4YFXF 1YTYA 1LB2A 2W25A 5E18F 1FLIA 4I09A 3OOPA 3IWFA 3N97A 2O8XA 4G8XA 2GU6A 4KIFA 1H9GA 4FUKA 1MJ9A 2W57A 1C22A 1XB4A 4A6EA 3I64A 3DEUA 4HDVA 2B3KA 3J81K 2A61A 4Q47A 3CB5A 2XROA 2XAFA 3WU1B 4AIJA 2DAOA 4OIPF 5D5WB 1G4DA 4IRGA 3V8JA 1CF7A 4ESBA 2BWSA 5D6FA 4RGXA 3PKBA 2VE9A 1O7LA 3TOAA 5DEQA 4ZZDA 2E1NA 2IW2A 2BWWA 3E5UA 1BI3A 4A6WA 4AWXB 2FMYA 1DPRA 2KJCA 2GTXA 2KJBA 2AS5F 1SMTA 1J2XA 4RGUA 4M9SA 1DDNA 3TDUC 4ESJA 5DCMA 5BQTA 4ZYDA 1QXZA 1P6RA 3QU3A 1JXSA 1GHCA 4UV9A 1LVAA 2DQLA 3NQOA 2A5YB 5FD6A 2QVOA 2F2EA 4AD9A 1K6OA 3QPTA 3T8TA 1RZ4A 2OQGA 4FX4A 1BM9A 1ON2A 2RV8A 3K69A 4WXDA 3WE3A 2FRHA 1AOYA 1BBYA 2H27A 1WL9A 2BBYA 1IXSB 2M87A 2BWUA 1G3SA 4KIGA 2RVCA 4AVPA 4RZZA 2LKPA 1KQ9A 1FP2A 4L9VA 3GFIA 4U88A 4I7HA 2OU2A 4M74A 3FMSA 3GF2A 3ZN0A 5CVRA 1FYLA 1BOAA 1ULYA 4EJOA 3F8CA 1IRFA 2ZNZA 2XAJA 1H0MA 3J81Z 5HS7A 3BPXA 5LBQA 2D45A 3ABUA 4Q48A 1XGOA 5FD5A 1CGPA 1U2WA 1XSXA 3J7AO 2FBKA 5L3EA 3KZYA 1PUEE 4L5IA 5LGUA 2Q8KA 2WV0A 3HTUA 2DBBA 3TKYA 2M8EA 1IRGA 4L0ZB 2K27A 1TQPA 5A2QK 5F64A 2Q96A 3IKVA 3L9FA 4E70A 3J80K 5HDGA 5CVUA 2XRNA 4RGZ1 3Q9VA 1GXPA 1ZRCA 3P7NA 4BNCA 2PLYA 3WGIA 1R00A 3GZ6A 2VN2A 3T1BA 2WC2A 5LLQA 3LFKA 1KU3A 3B73A 3TO6A 3QU6A 1YVMA 2HKOA 3IC7A 4U69A 1Z9CA 4IHTA 2HS5A 3RTRA 4HLXA 2FA5A 1HKTA 3EQLF 3ML6A 2ADUA 2VT2A 2JTVA 3U1DA 3WTYC 1KQ0A 5ILUA 3WGGA 2IW5A 3G3ZA 4A6VA 2IVMA 2FXAA 2A6HF 2MH9A 3TO9A 4ZYGA 3CO6C 4Y17A 2MLKA 4G94A 2VXZA 3F22A 4LJZF 5CVJA 4HF2A 1O3RA 3L24A 1YLFA 5DV5A 4ENJA 2CQKA 3O2PE 4HX8A 4I0AA 4LG0B 2ZNYA 4EJWA 4TV7A 3PFIA 2E7XA 3IRRA 3HHGA 4N9HA 4EJTA 1W2MA 5CVIA 2EA4A 5HDNA 3BIQA 4M72A 3QP6A 4IVNA 2TDXA 4S04A 2NQ7A 4EGZA 3R0AA 2JSCA 3ERED 2XASA 4L0YB 2Z33A 5A2QZ 4UVBA 3CUQB 1KQ8A 1WWXA 4I02A 1R22A 4P55A 3K0LA 2P7CB 3J80Z 2P5KA 3BP8A 2GG2A 2QYOA 4HF1A 3CO7C 2Z3YA 2JT1A 3WODF 3JAMK 3JTHA 1UFMA 3M1EA 4JBAA 2RQPA 1G6NA 2BWVA 5LEKA 4RGSA 1BI2A 2JPBA 2E7WA 4HZFA 1BC8C 1SFEA 2P99A 4FLIA 1KU9A 2WWYA 1L3LA 2RNJA 4OIQF 4ZH4F 4ZYEA 1Y0UA 4HA8A 3H92A 5KVRA 1ZG3A 1Z1DA 5J8CA 4S2TP 3I0TA 2BGCA 1F1ZA 1W5TA 4EQQA 5D6EA 4DQ2A 1OPCA 5D5XB 4KMUX 4I98B 4G7HF 2PG4A 3I4PA 1XGNA 3ECHA 2QQAA 4RZYA 1LDDA 4U70A 1J5YA 3LA7A 2NNNA 3I59A 3ZMUA 5JR3A 2GAUA 1LQ1A 2VC1A 3WG9A 2ZO4A 3PKCA 2EFNA 2B3LA 1IF1A 4GCVA 4IKRA 5IT9Z 3WE2A 3WTTC 4N9IA 4LD5A 4MQ9F 2W85A 4A5MA 2MBFA 3GX4X 2E1CA 4S00A 1ZYRF 2IA2A 1R58A 4WXCA 2O6GE 4CXFA 1TQMA 4HXXA 4S2RP 3Q6DA 1ZGJA 2PFBA 2P8TA 2XAGA 4ZWOA 2ZXJA 4D0PA 3MATA 3RI4A 2IT0A 2HDCA 3M7GA 3JSPA 1D3YA 2G7HA 1RI7A 4PGGA 3EYIA 1FOKA 4G7ZF 3I71A 4R79A 5ILVA 1OYIA 3AAFA 4QWQA 2V1DA 4BXUA 4RB0A 1WN1A 4IJAA 2DO7A 2O0YA 1KU2A 3ULQB 1E2XA 1Q1HA 4HF0A 2FQ3A 3DF8A 1JHHA 4OIRF 3E97A 3L2CA 3I53A 2XV4S 5L3FA 4YIFA 3KFWX 3IG4A 2K4BA 1OR7A 2NS0A 2PMHA 3FWEA 5CDVA 4IF4A 4BAYA 5L3GA 1UCRA 1WQ2A 1TBXA 1W4MA 2XKPA 3CLOA 4JUQA 1Z91A 2HYFA 3E3VA 3KP7A 4KMFA 1XGMA 1QNTA 3GYHX 2GU7A 4FX0A 4FLLA 1PV9A 4OINF 4OMZA 1CF7B 4HX7A 4PZJA 2VT3A 2XGXA 2P5VA 2P4WA 4YG2F 3WTUC 2DQRA 1A04A 2CYYA 2LNBA 3MCZA 1G3YA 1TNTA 2J5OA 2ZMEA 3C7JA 2L02A 2KIFA 1B6AA 1K79A 5LRSA 4O3MA 3FMRA 5J6XA 2ESHA 2Y0MA 5DCMB 2GG0A 4A0YA 1FBSA 1YIOA 3DQVC 3P9KA 4OMYA 2YPRA 5D8KB 4U7DA 1WL6A 4KN7X 4A6DA 3KETA 1MJBA 4LLLA 5EEGA 4CYDA 3F21A 2ACJA 1FBQA 5CLSA 3EUHA 5AONA 1EH7A 1A16A 4S05A 2CSOA 1YO5C 3LQQA 1W5SA 5E8GA 2EK5A 2EFWA 4MEYF 5L3BA 1FY7A 3KEOA 1GXQA 3ZMSA 2BH3A 2MA3A 2QWWA 5CDLA 3EETA 1T0FA 2ZBKA 2F5DA 1P92A 5K1YA 2Z5UA 4XRFA 1H9TA 2ISZA 4PCQA 2A6EF 4CZZA 1NHAA 4LLGF 2BHCA 1OYYA 1TLHB 2P6SA 2PBIA 3CTZA 1FBUA 4ZWUA 3MZYA 2Q92A 1IN7A 2R3SA 3SFZA 1UHMA 1F4KA 1R1TA 3DFGA 1BN5A 3V7CA 1MZBA 1SFXA 4EJVA 4HBLA 4HQEA 4YFKF 2RKHA 3I58A 1HKSA 3JW4A 1USTA 1SD7A 3IU9A 1C24A 3MWMA 2XAHA 3TAVA 4KUMA 1TW3A 1FSHA 4MNUA 4MEXF 1D5VA 2QQ9A 4AIKA 3FXUA 4G9YA 5DD4A 3IRQA 2X0LA 4WWCA 2HOWA 4MGRA 4P5OA 1XSDA 5E8IA 2HYGD 2OAZA 4ETSA 1O7FA 2P7VB 3LQRA 1QBJA 1J59A 3R61A 4EM0B 1LJ9A 2FU4A 1U3EM 3L7GA 2EVCA 4BHCA 1FYKA 4O6JA 4IPAA 2O3FA 4GGGA 3DPLC 1UHWA 1YG2A 3CJNA 3T8RA 4ZYHA 2G9WA 4KNYA 1MJAA 4KIBA 2GG9A 1IXCA 2Q93A 4BH9A 2L4MA 3R4KA 1MDMA 1JE8A 1QXWA 3W6KB 5L3CA 3TGNA 4ON0A 2YX4A 1DPUA 2CG4A 5HOOA 2PI0A 2MD5A 3P9CA 1SD4A 2EFOA 4MHGA 3GXOA 4L18B 2NQ6A 1QXYA 5BPIA 2OD5A 5LHHA 3ZMDA 4KYWA 2EJRA 6PAXA 3IU7A 3LAJA 2DW4A 1Z7UA 4FKCA 4IHSA 5CYVA 5ICGA 4FHTA 1BIAA 2OKNA 3BJAA 1Z6RA 1V4RA 5JVTA 1KYWA 3HUGA 2GWRA 5D4RA 2D1VA 2RC4A 3K2ZA 5BPDA 1IAWA 4HW0A 3F72A 2HOEA 1XDUA 3CDHA 3FF5A 2XUBA 4S01A 1SAXA 3R0JA 2YSRA 4GXOA 5ILSA 4HV6A 3COAC 2COMA 3LA2A 4KDPA 2QBYA 1QGPA 3P9IA 1YW9A 4FO7A 3ZPLA 3C1DA 4BHPA 3CUQC 3WTWC 1IZ1A 3F8MA 4A5NA 4Q4ZF 2HGCA 4FT8A 1C27A 2KIUA 2JRTA 2YR2A 4I0BA 4EJUA 5E20A 2M1BA 5H6QA 2OZ6A 3V4GA 4Z7MA 2VBXA 1ZLKA 3FXRA 4R60A 1U5TB 4L9JA 2ETHA 2P98A 2UXXA 3R6SA 1EV7A 2L54A 1R5GA 2ESNA 4PNCA 1RUOA 1C23A 4PDKA 4P9FA 3WU0A 3VODA 1KU7A 4P96A 2X4HA 5ICFA 3KP4A 2Z99A 1FZPB 3CTAA 4G6DA 5IT9K 5LEJA 2IP2A 3I59B 2O61A 2XKOA 1XGSA 2V1XA 4AIHA 2LF8A 1BIBA 1LEBA 4L9TA 2IA0A 1LDKB 2A3SA 5FFZA 3HTSB 3RVAA 5ICCA 4NQWA 2OQRA 3TB5A 5AIPA 1KA8A 5HLIA 4XBFA 3PQKA 4XLNF 2L4AA 4U7BA 3BY6A 1P2FA 1TQIA 2BE5F 4KICA 5E1WA 3F6VA 3F6OA 4KA4A 1LNWA 2DLLA 2G6PA 2Q0OA 2VBYA 4H0EA 3EDPA 1LEAA 1FYMA 1S3JA 4KM3A 2KKOA 2HFHA 3GWZA 3F8BA 3S2WA 3WTVC 1U5TA 5BOXA 1W7PB 1O3TA 2ZJ2A 5HDKA 4M9ZA 2BWTA 5IT3A 1FPQA 1K78A 1UB9A 3FM3A 3CUOA 4RAZA 4I01A 1TTYA 4OOIA 3DV8A 4IRHA 5FCFA 2Q2EA 1EH8A 2FMLA 1QZZA 1S6LA 3K1PA 4U75A 1WLRA 4EM2A 4M73A 2H6BA 4IKTA 3BROA 1FC3A 2GXGA 3GFMA 3KP5A 5HS8A 3E6CC 1RNLA 3BITA 3GZ5A 4MATA 1MKMA 5JI6A 4BQAA 3RPUA 1ZARA 2ELHA 4F7ZA 2DK8A 3U9GA 3QOPA 1T38A 1O0XA 2P9AA 3RKYA 3RJPA 4HOBA 2LSOA 3O6BB 2BEOA 4WX9A 3HRUA 4WXHA 1MGTA 2VONA 1ON1A 2BYVE 2CO5A 1C0WA 1J0RA 3K9TA 3JTGA 2ZMEB 3R60A 1IN8A 1RIOH 1B4AA 1W7PA 2QM3A 3PKEA 3ABTA 3L7WA 4A0ZA 5TJJA 4G7OF 1P4AA 5LGTA 2L3DA 1T6SA 3HIFA 4G6QA 1M35A 4U6ZA 2EFQA 3F8NA 1YW7A 2FF4A 5DUKA 1HW1A 5K5OA 4IKSA 3RORA 1WRJA 1SMYF 3NEUA 1MD0A 4WF2A 5CIKA 2RGVA 1W7PD 3OV8A 2A07F 1S7AA 4M6YA 3V7SA 4U0YA 4N0BA 2DFIA 2BHAA 2XVCA 2UZKA 4LK1F 3BZ6A 3E5QA 4CHUA 2NNYA 2GG3A 4B8XA 2AXLA 5JFRA 3KP3A 4CDGA 4KT5C 5F6FA 2M5WA 5DD8A 3DXJF 3SZPA 2OZUA 3MZHA 4GYIA 3MAJA 2VE8A 1R36A 1EH6A 2QUFA 3MEXA 4LGWA 3V8LA 1YFHA 4XLPF 2GG8A 1YS7A 4ZWPA 4Z2YA 3TDZC 4FLJA 2JPCA 2V3XA 3H3UA 4UVAA 4L5JA 2EV0A 2DTRA 1SFUA 5FGMA 3U2RA 3FX3A 4I2OA 2FBHA 4BYYA 2VOPA 1U78A 5LGNA 3QRFF 5E17F 5FLXZ 2PN6A 4U6JA 3IWZA 3RPQA 2R7FA 2EFPA 2EVMA 3D0SA 2V1UA 5D5UB 1WI9A 4HYEA 3GW2A 4M71A 2FSWA 1WBQA 5D5VB 4UXNA 4OOKA 5CE6A 1XNZA 3QAHA 1T39A 1FX7A 3GVAA 2EWNA 3E6BA 3EYYA 4U0WA 2BHBA 3KEQA