2DFIA

Crystal structure of pf-map(1-292)-c
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
301
structure length
301
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 94
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dfiA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2dfiA01
4ZYEA 3N97A 2M5WA 3J81K 3K9TA 4IJAA 4EGEA 1IW7F 3CB6A 3H92A 3BITA 1EH6A 1WSUA 2YU3A 2E7XA 3P9CA 1V4RA 4B09A 2M30A 4RAZA 1FSEA 2Y0MA 4KIBA 1B9NA 2XAFA 2DPDA 4M9XA 3Q9VA 5F64A 2YX7A 2JZYA 1ZN2A 1BI0A 4HX4A 2A6HF 4U7BA 4Q47A 2LF7A 1J0RA 1PV9A 1YIOA 2EWNA 2EVMA 2OAZA 3W6JB 3F72A 5E1WA 4ENNA 4M74A 4I0BA 4EJWA 1YTYA 1HW5A 2MH9A 3KEQA 5E1ZB 3SZTA 2D1VA 2BV6A 1MZBA 2ZFWA 4RGXA 5FD5A 3BPXA 4ZWUA 3FMQA 2K4JA 5JR3A 4MNUA 2BHCA 2HWVA 1IN6A 2RC4A 5CE6A 2XRNA 4A0YA 3Q6DA 3FHZA 4HA8A 3HRUA 1JHHA 3I64A 5E20A 2KIMA 2L4AA 1PP8F 4IECA 3GFLA 3QAHA 4U88A 3KZYA 2WTEA 5D5WB 1D8JA 1PDNC 1ON2A 4U0WA 2BHDA 3BIPA 3B73A 1C0WA 3WTVC 5LEJA 1HSTA 2KIFA 4Z7MA 3KCCA 4U71A 4Z2YA 3KEOA 2VOPA 3TKYA 3WTXC 2JPBA 4HXXA 2EV5A 5HDGA 5ERIA 1RIOH 4UVAA 2DT5A 2K27A 1MGTA 4EJVA 2XHKA 4IVNA 3GZ5A 3BJOA 3GX4X 1LDJA 3I71A 3CTAA 2COMA 2JT1A 5KK1A 2VODA 1CF7A 3LA3A 4QLCU 1WN1A 3QRFF 1EH7A 3GXOA 3LAPA 1HXDA 1FNNA 2QBYA 2PJPA 4OMYA 4RB1A 5CDVA 1ODDA 2OU2A 4O6JA 2GZWA 3CUQA 4L9NA 1XDSA 5HOOA 2HZTA 3IC7A 1T38A 3MZYA 3ROUA 2BWWA 1XGNA 2KJBA 2XKPA 3LFKA 1R5GA 1KU9A 3DFGA 1O7LA 4OINF 1UHWA 1D3YA 4HW0A 2ZXJA 3SFZA 1W4MA 2XAGA 4B8XA 3ZQ7A 5BPDA 5DV5A 1R1UA 1W7VA 1TLHB 3KP5A 4IF7A 2V6CA 4GO1A 2GXGA 2ESHA 2BWVA 5JFRA 3J80Z 4JQFA 5DUIA 4RS8A 4EMSA 1BIBA 2VN2A 5E8GA 1LEAA 3ZMZA 5FD6A 1XGSA 4LK0F 3V8JA 5DD4A 3E6DA 1C21A 3CUQB 3BPVA 5DUKA 1FOKA 4G9YA 2ZNYA 1Y1NA 3L00A 2LDUA 3GZ6A 1BJAA 2GG8A 1M35A 2FNPA 1I1SA 2K4BA 2A07F 2G6PA 2A61A 4KMFA 2HEOA 2A6EF 1FYMA 4GGGA 3R0JA 4UXNA 3AAFA 1YO5C 3U1DA 4S00A 2VBWA 4QWQA 2L54A 1USTA 2AS5F 2FOKA 2MBFA 1BI2A 1KU3A 2IPQX 1UHMA 3QPTA 2IP2A 4XSZF 2IA0A 5H6RA 3CB5A 3K1PA 3LSTA 1TQMA 2XASA 2O0YA 2Q95A 4M6YA 1DPRA 3JSOA 3NRVA 2XAHA 1K6OA 2VE8A 3IWFA 3ZP5A 2ZBKA 2RGVA 4G6QA 2EA2A 4FLKA 4Y17A 2G9WA 1QBJA 2NRAC 4EV0A 1MJBA 3GF2A 2XVCA 1R22A 4UHTA 5D6FA 4IHTA 5CDEA 4CXFA 4PNCA 3WTZA 1QO0D 1HKQA 2YR2A 3TO9A 2XAJA 3O2PE 2JSCA 5CNXA 2IA2A 4M71A 3VOEA 3WG9A 4FO7A 3I5UA 1MDMA 1IF1A 4I0AA 1BIAA 5CVIA 2NNYA 1B4AA 2BWTA 4HZFA 4U75A 2Q93A 4CO8A 3IRQA 3BP8A 2EV6A 2XROA 2X4HA 5FFZA 2CYYA 2VXZA 1IAWA 2BWUA 3ELKA 1ZLJA 3K2ZA 5A2QZ 3FXQA 5L3GA 1SMYF 4NQWA 2D1HA 3SZPA 1BOAA 4A6VA 4P55A 3HHGA 1RUOA 2PBIA 1R7JA 1WBQA 2JPCA 2B0LA 2E1NA 4FUKA 3FZVA 5LLQA 3IHUA 6PAXA 4O3MA 1BI1A 1O3RA 2STTA 3REOA 3P9KA 5AIQA 1SD5A 3HRSA 1YJ3A 3WTWC 4UVBA 1H9TA 3V8LA 3FXUA 2P6SA 2OZ6A 4CZZA 1QNTA 2ADUA 4A2UA 3C1DA 4CYDA 3Q5FA 2P4WA 1U3EM 2QVOA 3EQLF 1RUNA 5BPIA 2HOWA 4U0YA 5ICGA 2R3SA 3BJ6A 2QYOA 1K7AA 4RB2C 1YLFA 4L5IA 2Q94A 3HOTA 4KFCA 3V8KA 3GFIA 2F5DA 4ZYDA 5BS6A 2MC3A 2LSOA 3BOQA 2TDXA 1IXRC 4QR8A 2GA2A 1F4KA 4LMYA 4XLPF 2Q92A 3ZMVA 4I2OA 3F8MA 4G8XA 3QPHA 2FEZA 3KE2A 5EEHA 3F3XA 1J7KA 1W7PD 1OPCA 1O3TA 4OOIA 2FMLA 2GQQA 5HS9A 5HS7A 3OOPA 3FXRA 3FMRA 3J80K 4L9VA 1YYVA 2GA1A 1K79A 3E5QA 3CUOA 1C22A 1R23A 3DPLC 2DU9A 2BH3A 3RYPA 1BC8C 2ZO4A 4RGSA 5LHIA 2DPUA 2HYGD 1MD0A 3ERED 3N4MA 3CO6C 2ZMEB 4G7OF 4GXOA 5E18F 3BY6A 4KUMA 2RV8A 1X3UA 4GYIA 4EGZA 1R58A 3JTGA 2OQRA 5BQTA 3WU1B 1XCVA 3IU9A 5K5RA 1FP2A 1H9GA 4PGHA 4IXAA 4LJZF 2L3DA 4N9HA 1BN5A 1T39A 2DK8A 4RGUA 2BHAA 1OKRA 3L9FA 4ZYHA 3GLXA 1ZGJA 4EQQA 1J59A 4ZWOA 1FYKA 2M1BA 1O3SA 1BBYA 3V7CA 3FM5A 1JE8A 4WWCA 4U73A 2HQNA 3HSRA 4OOKA 5LHGA 4KDPA 2Z99A 2OKNA 2STWA 4KIFA 3KP2A 2ZKZA 2ESNA 5L3BA 3BWGA 2V79A 4WXCA 3TGNA 1GVJA 1G3YA 1QGPA 1XD7A 5FLXZ 2RDPA 2GG7A 4NB5A 1CHMA 3M8FA 2G7UA 3ECHA 4M9ZA 3WTSC 2V1UA 4U6JA 2BWXA 4AIKA 2RKHA 4N9IA 3RI4A 2Q0OA 1IRFA 1O0XA 3L7GA 2A69F 3CTZA 3JAMK 3DP7A 2B3HA 3RVAA 2NS0A 4A5NA 2VC1A 3Q9SA 2GG9A 2EB7A 2WWYA 3ML6A 4A6DA 1FBSA 4AWXB 1KQ0A 1XMKA 2EFNA 5F1RA 4MQVA 5IT9K 1LJ9A 4A6WA 3BROA 3ZMTA 5DCMB 5FCFA 1SMTA 2HFHA 1SD7A 4P9FA 4EM0B 5K5QA 3WE3A 4IRHA 2MD5A 4WF2A 4UNOA 3DPTA 2VT2A 3RYRA 3GO5A 5LRSA 1Z7UA 1LDDA 2FE3A 1I6XA 1Z1DA 4IF4A 4HBLA 3HTSB 5CLSA 4FKCA 2P6TA 1G6NA 3R60A 4XBFA 1ZG1A 1U5TB 3TDZC 4I01A 3K0LA 4U6EA 2GU6A 4S2TP 1SD6A 2EFQA 1WWXA 1B9MA 3TO7A 2MATA 2YSRA 4HDVA 1T6SA 2D2WA 1DDNA 1G4DA 3KETA 4XSXF 1ZREA 5LBQA 2UZKA 2CO5A 2GG0A 2HKOA 5AONA 1DP7P 5CYVA 2QLZA 1QZZA 3F6OA 4RGZ1 1JXSA 1HQCA 2BN7A 5HDNA 1FY7A 3CUQC 3MX6A 2B3LA 2MA3A 3H3ZA 1Z6TA 3CO7C 1FT9A 4HLXA 1E17A 2F5CA 2ZJ2A 1B6AA 1JAWA 3V4GA 2VOOA 2QQAA 3KZZA 3E5XA 2GXBA 3PFIA 2OQGA 3DV8A 4G94A 2GG2A 3RJPA 4UVCA 3DKWA 2CQKA 4LLLA 2QUFA 3VODA 5FLXK 3OV8A 2YPRA 1IUYA 3DF8A 2L4MA 3RKXA 1WL9A 2RVCA 1P2FA 2QM3A 2RNJA 3EYIA 2V1XA 1F9NA 2M45A 2Q96A 3M9AA 2JTVA 5D4RA 3IU8A 1TQIA 4KT5C 5TJJA 5EEGA 3T8TA 1XSVA 2KKOA 3LWFA 4WX9A 4L9TA 3U9GA 4FX0A 1R5HA 3K1MA 1ZARA 1HBXG 2GWRA 4BXUA 3R6SA 1W5SA 4YG2F 2H6CA 2GGCA 3HRTA 1XN7A 1FBQA 4KNYA 4LB6B 3RKYA 1J9IA 1J2XA 2PMUA 3NQOA 2UXNA 1ZRDA 2DQLA 5L3FA 4DNCA 3I53A 1P92A 3VFZA 3RPQA 3T0YA 2OZUA 1GHCA 2GU5A 3WGGA 5LHHA 1USSA 4IKRA 4U76A 2Z33A 2K86A 4G7ZF 1MJ9A 3QOPA 1KYWA 2ZSGA 4FO8A 5FB2A 5ICCA 4WXDA 2DTRA 1FX7A 1OYYA 2OA4A 3GFMA 2V3XA 1ONVA 4L0ZB 2FBHA 2R7FA 4HDUA 3D5LA 2J5PA 2QQ9A 2FQ3A 3PQJA 2F5EA 3IWZA 3GEZA 4KIGA 3ZN1A 1KGSA 4S04A 4R8HA 1ZG3A 1KU7A 1F5TA 1N51A 3I58A 3WU0A 1WQ2A 1XGMA 3TB5A 2BEOA 3FF5A 2MH2A 4EGYA 2HGCA 5CJ9A 3V7RA 4ETSA 4KYWA 4CHUA 2OD5A 1UB9A 2Z9OA 3FWEA 5D5VB 4RZZA 4N0BA 1HW1A 3PQKA 2P5VA 2FSWA 1BM9A 3FM3A 3HSFA 4LD5A 4ENJA 1RZ4A 2X0LA 5E17F 2W24A 2CGPA 2DO7A 3KLNA 3VEPA 4MEXF 1S6LA 2P5LC 4JUQA 3R61A 4GCVA 2NNNA 2W57A 1YW9A 4HV5A 1XGOA 4BHCA 2WV0A 3HSEA 1NHAA 5TRDA 2HKXA 1ZGAA 4KA4A 2PFBA 5LGUA 2H27A 3PKCA 2FF4A 2P5KA 4IRIA 4JK1X 3IL2A 4ZWPA 4UV8A 3ZMSA 4IU6A 3MQ0A 3L09A 5D5XB 4HF2A 3HHHA 2PLYA 2XAQA 3F21A 2P98A 1GXPA 4HOBA 4P96A 2LF8A 4GYGA 5D8LB 3ULQB 5IT3A 4P9UA 4BQAA 4ASNA 2DQRA 3LAJA 4MTDA 3SQNA 2B3KA 4OIPF 1T98A 2QQBA 5DYMA 3R0AA 1I5ZA 3O6BB 1T2KA 3PKBA 1W5TA 3I54A 1ZHFA 5L3DA 2A3SA 3T8RA 5FFXA 5LGNA 4RB0A 4IRGA 1OR7A 3WTUC 2VC0A 4BHPA 2RN7A 3E6CC 1TQPA 4I98B 3M7GA 2VONA 4ZYGA 4EJTA 2HOEA 4IKUA 2FRHA 5HLHA 2ISZA 3QP6A 1YS7A 4IPAA 2P99A 2CSOA 3RIRA 3G73A 3I59B 1S8NA 4H0EA 3DXJF 1WKMA 4UUVA 4Q48A 3F23A 5E8IA 5FCHA 5J8FA 1KYZA 3L24A 4P5OA 1G3SA 3IG4A 5BOXA 4Q4ZF 1D8KA 4AVPA 1ULYA 5CVJA 5HLIA 3ISPA 4EVIA 4RB3C 4MATA 2O6GE 2A68F 5ILUA 4R79A 1ZRFA 1KU2A 1REPC 2LNBA 4BHBA 2EA4A 2Q2EA 2PN6A 3GUDA 1P4WA 5BMZA 4M9SA 2EFPA 3P9IA 3M1EA 3ECOA 2Q8KA 4G7HF 3LQRA 2OBPA 1W2MA 4HLYA 5D6EA 1FYLA 1UCRA 1WY2A 2NQ7A 2E7WA 1IRGA 3S6BA 2EFWA 3TOAA 1LDKB 1SAXA 1ZAOA 5H20A 4LFUA 1FP1D 2GIVA 2Y75A 4KN7X 4BAYA 1QZYA 4G6DA 2F2EA 2NQ6A 1VTNC 4OIRF 3L7WA 4UV9A 2IA1A 4YFNF 5HDKA 1SFUA 2PG4A 1C23A 4KN4X 1J75A 3IRRA 3MZHA 1ZYRF 3TO6A 2BWSA 4MGRA 4KICA 1W7PA 1AOYA 2FU4A 3E3VA 3GVAA 2EV0A 1HKTA 2CWEA 2DI3A 3K1NA 2KRFA 3E6BA 3F8BA 3I0TA 3E6MA 1H0MA 3EDPA 1IXCA 3KP7A 4A0XA 1ZRCA 3PKEA 5D8KB 4FLIA 3M8EA 1KQ9A 3TOBA 2QBYB 1U8RA 3B02A 4PCQA 3JW4A 4U1BA 4RGRA 4Y13A 1YVMA 3RKWA 5FO5A 3HIFA 1O7FA 1HSJA 3VB2A 2ELHA 3O3KA 4U0VA 2GG5A 2L02A 4YFKF 1KA8A 2H94A 4EM2A 1B59A 1Z9CA 5LRRA 2GAUA 1L3LA 1Q1HA 3ABTA 2XGXA 1S7AA 1S29A 3J81Z 1WL6A 2HDCA 2IJLA 3D0SA 5E5BA 3C3WA 4M73A 3F8FA 1FC3A 3WE2A 5ILSA 2P9AA 3F22A 4OMZA 3KFWX 3GYHX 1C24A 2GU4A 3KP3A 2MLGA 4D0PA 2ACJA 5AIPA 2J5OA 1IN8A 4A12A 1QQIA 2M8EA 5FGMA 4KMUX 1XCBA 4HF1A 3KP4A 1MKMA 1LB2A 4PDKA 2C6YA 4K2EA 4B28A 5JHUA 1QXZA 1FZPB 1R36A 4I09A 1W7PB 4M72A 3SHFA 4HX7A 2Z3YA 2EJRA 1YG2A 1QXYA 5DDGA 1MDMB 3CLOA 3I4PA 4PGGA 2PMHA 5D4SA 2VBXA 4HV6A 4PV4A 4FLJA 1IN7A 2W85A 1XSXA 4BH9A 4YIFA 1OMIA 3GW2A 3MAJA 4ENKA 4WK8F 2PI0A 1IZ1A 3HUGA 5ILVA 3V7SA 1LVAA 2XKOA 3LA7A 1XMAA 1IN5A 1XB4A 4AIJA 2G7HA 4LLGF 1FLIA 3COAC 4LG0B 1U78A 1XDUA 4OIOF 1JGSA 2XIGA 4ESJA 5HLGA 4OU0A 1Z91A 4IKSA 2L01A 1Z6RA 4XRFA 1QPMA 2VT3A 2EFOA 3F8NA 3WTYC 3C7JA 3TQNA 1MJAA 1G3WA 2DK5A 2MLKA 1JHFA 1YW8A 4F7ZA 2CG4A 2VBZA 2QWWA 2KIUA 4L9JA 5ICEA 2UWMA 1TW3A 2QENA 5L3EA 4AD9A 4CGZA 1BC7C 3F6VA 1E2XA 1KP0A 2D45A 3GFJA 4A5MA 3P7NA 4BYYA 4DQ2A 1HKSA 4Y15A 2IVMA 4OIQF 4O5VA 4LLNA 4BNCA 2HTSA 3E97A 1CF7B 3C18A 5K1YA 1LQ1A 4R1HA 5ICFA 1ON1A 1UFMA 5HS8A 3U2RA 2E1CA 5CIKA 3QP5A 4M6XA 2EVCA 2CFXA 2P7CB 1C27A 3BJAA 2FBIA 2BYVE 3QU3A 2ISYA 4U7DA 1I27A 4ZH4F 1TW2A 2CW0F 2HR3A 3K69A 1P6RA 4I02A 1FPQA 4U6ZA 4NHJA 2BBYA 4HQMA 2NAZA 5IT9Z 4ZZLA 1AWCA 4YIIA 1XSDA 1GXQA 1LEBA 2P7VB 4A0ZA 2XV4S 1P4AA 1SFXA 5KVRA 5LGTA 3EYYA 3E5UA 3T5XA 2O61A 3CJNA 1G3TA 3DEUA 2HTJA 1A16A 1SFEA 1DPUA 1WRJA 2O8XA 1FSHA 3ZMDA 4EJOA 4ENMA 2IRFG 2GG3A 3J7AO 2GZ5A 2O03A 5F6FA 1WLRA 1CGPA 3EETA 5A2QK 1R00A 1F1ZA 3T1BA 4U6WA 2ZMEA 3BIQA 3WODF 3ZMUA 4LGWA 4YFXF 5DD8A 4EJUA 2AXLA 2V3ZA 1EV7A 4CICA 5J8CA 3ZPLA 3HRMA 5CDLA 1YS6A 2DFIA 3ABUA 2WC2A 1EH8A 3TAVA 3MATA 1QXWA 1OYWA 1A04A 2HQRA 2GU7A 4MTEA 3IKVA 4MHGA 1FBUA 3FMSA 1V3FA 1D5VA 2H09A 1B1BA 3S2WA 4HAMA 3SXYA 3RDIA 1J5YA 4AIHA 2EK5A 1Z05A 4ZZDA 2IT0A 2K7LA 2DLLA 2HS5A 2PQ8A 4HQEA 3KLOA 5DCFA 2YX4A 3PKDA 1BI3A 2M87A 3EUHA 2RQPA 3R4KA 3MCZA 4ZNGA 1WI9A 4S2RP 1OYIA 4MEYF 3ZN0A 3GWZA 2JRTA 4JBAA 3I59A 3MR1A 3L2CA 1ZG5A 3WGIA 3JSPA 1O57A 2DBBA 1RNLA 4E70A 3MWMA 1O3QA 2V9VA 2BGCA 3BDDA 5DCMA 3RTRA 1ZLKA 4HX8A 5JVTA 1PUEE 1FWZA 2F5FA 4RZYA 3DQVC 3JTHA 5H6QA 4L18B 2H6BA 2K02A 5HVQC 3G3ZA 1LNWA 1U2WA 3RPUA 4LK1F 3HTUA 4RAYA 3D27A 2GGBA 3RORA 3W6KB 2IW2A 1P4XA 4XLNF 3TDUC 2LKPA 1ZH5A 1U5TC 4FLLA 1XNZA 4S05A 2R7DA 1I1GA 3QU6A 4HYEA 3F8CA 2FNAA 4R60A 2V1DA 2IW5A 2FA5A 4LG0A 1PP7U 2A5YB 2FMYA 3WTTC 5D5UB 5LEKA 1U5TA 1KQ8A 4CDGA 2XUBA 5K5OA 2O3FA 3LA2A 2FBKA 1TBXA 1YQAA 5J6XA 4FT8A 3IKTA 4IDYA 4I7HA 2GTXA 5JI6A 4EM1A 2ZCWA 1K78A 3FX3A 4FHTA 3HOSA 5L3CA 2BE5F 4PZJA 2Z5UA 4IKTA 4L5JA 1IN4A 3KP6A 3MEXA 4U70A 3MFKA 3BZ6A 1TTYA 1T0FA 3JAMZ 1MATA 2BWYA 4S01A 4LB5A 3PKAA 5CVRA 4ESFA 3WGHA 3LQQA 4IHSA 1Y0UA 2V3YA 2BB7A 1HW2A 1YW7A 1S3JA 2ZNZA 4HF0A 2DW4A 4ON0A 2DAOA 4L0YB 2NYXA 1RI7A 4FX4A 4WXHA 5E1XA 4U6CA 2P8TA 2W25A 2KJCA 3NEUA 4MQ9F 2BHBA 2EVOA 4ESBA 1U6GA 1L0OC 2W84A 1YFHA 2HYFA 4WCGA 1R1VA 1TNSA 3IU7A 1R1TA 2ETHA 1TNTA 3H3UA 4U69A 1IXSB 2Y48A 2VE9A 1SD4A 4Q5SF 4KM3A 2VBYA 1S7OA 2UXXA 5CVVA 5DEQA 2QZ8A 1K78B 3HYIA 4A6EA 3CDHA 1DUXC 4TV7A 1STZA 2FXAA 5ED4A 5CVUA 2PEXA
chains in the Genus database with same CATH superfamily
4ZYEA 3N97A 1WJEA 5FRNA 4I6ZA 2M5WA 4XKBA 4DYCA 3J81K 3SYTA 3KIOA 3K9TA 1OCOH 4IJAA 2JA2A 4EGEA 1IW7F 4YIRX 3CB6A 3H92A 3K4NA 3BITA 2H1KA 1EH6A 1WSUA 2YU3A 5GPAA 3ZQLA 3FK6A 2E7XA 3FXJA 3P9CA 1V4RA 4B09A 3OIPA 3CCQI 2M30A 5GADJ 4RAZA 1FSEA 2Y0MA 4KIBA 2L7MP 2KISA 2VKVA 4II3A 4XRMA 1B9NA 2XAFA 1OQYA 2DPDA 4M9XA 3Q9VA 3A02A 2Q1ZB 5C4JJ 5F64A 2NVTJ 4D7NA 2YX7A 2JZYA 5EG0B 1WH7A 2KZVA 3CLQA 1ZN2A 1BI0A 2IS6A 2F5VA 4HX4A 1DU0A 2A6HF 4U7BA 3S2HJ 4Q47A 2LF7A 4XOPA 3S1RJ 1J0RA 1JI8A 3CC7I 1PV9A 1YIOA 4LOCA 2EWNA 1RR8C 1UMQA 2EVMA 4AIDA 3TBIA 2OAZA 4U87A 3W6JB 3F72A 5E1WA 3EUKL 4ENNA 1LKXA 4M74A 4I0BA 4XN3A 4EJWA 1RKWA 1YTYA 3RZDJ 1HW5A 3PSIA 3QPLA 3OMYA 3PSFA 2MH9A 4BJ5C 4D1QA 3KEQA 5E1ZB 3SZTA 3PUBA 3I3LA 3H3VK 1PUFB 2D1VA 1Y1WJ 2BV6A 2GOXB 2L7FP 1MZBA 2ZFWA 3H5NA 4RGXA 5FD5A 3BPXA 2L7KA 1OCRH 4ZWUA 3FMQA 2K4JA 1ETWA 5JR3A 4MNUA 2BHCA 2HWVA 1IN6A 3DU6A 1I39A 2RC4A 3GTQJ 5CE6A 2XRNA 4A3GJ 2KLOA 2GBYA 4BKXA 3IV5A 4Z6YA 3J7YJ 2M8GX 1LPQA 4A0YA 3Q6DA 4QIWN 3FHZA 2LK2A 4F52A 4HA8A 3HRUA 1JHHA 3BG7A 3I64A 5E20A 1OR7C 4JOMA 2KIMA 2L4AA 2WB1N 3HB9A 1PP8F 4IECA 3O8GA 3OYGA 3GFLA 4F93B 3QAHA 4S0HB 4U88A 5K7HA 5E3MA 2YS9A 3AG3H 3KZYA 5K7FA 2WTEA 5CQEA 5D5WB 4CYCA 2CV0A 2VKEA 4B3XA 1D8JA 1PDNC 4UUSB 1ON2A 4U0WA 2K3FA 4FE4A 2IAIA 4IHVA 2BHDA 3BR0A 1MSEC 3BIPA 3B73A 2XF6A 1C0WA 3WTVC 5LEJA 1HSTA 4N4OB 2KIFA 4Z7MA 3KCCA 3RQ4A 1B72B 4U71A 4Z2YA 1K6YA 3K4KA 2BW3A 3ONQA 3KEOA 2VOPA 2DT6A 3TKYA 3CQZJ 3WTXC 2ZC2A 3HOZJ 2BOLA 2JPBA 2ZMEC 2EV5A 4HXXA 4XMYA 4NUBA 5HDGA 5EG0A 1HLVA 5ERIA 2LY2A 1RIOH 3A01A 3PM1A 1AKHA 4B47A 1JJ8C 3JRAA 3SFIA 4UVAA 2DT5A 2K27A 5LFAA 1MGTA 2DMUA 4EJVA 2XHKA 4PJLA 4DYQA 4IVNA 3GZ5A 4NC6A 5F0CA 1Q1VA 3BJOA 3GX4X 1LDJA 3I71A 4A93J 3CTAA 2COMA 2F6CA 2JT1A 3EUAA 5KK1A 2VODA 1CF7A 1D0XA 3NWTA 4G12A 2CUZA 3LA3A 3VSKA 2MABA 4QLCU 1WN1A 4JX6A 3QRFF 1EH7A 3CCLI 3GXOA 3LAPA 1HXDA 1Z3XA 2MG4A 2CU7A 3PNVA 3VYUB 4XM3A 1FNNA 1N25A 2QBYA 5JHFA 5IPAA 4RB1A 4OMYA 2PJPA 2HOSA 2IGNA 5CDVA 1D1CA 1ODDA 4B48A 3A4CA 3ZRGA 2OU2A 4XLAA 4O6JA 2GZWA 3CUQA 1WJFA 4L9NA 5FKNA 1XDSA 2X9DA 1A31A 5HOOA 2HZTA 2XC7A 3IC7A 3OWTA 3MZYA 5J3LA 3ROUA 3AG2H 3F0CA 1T38A 2BWWA 1WI3A 2DYRH 1XGNA 2KJBA 3HGYA 1X58A 3HL2A 2FJ1A 2NOGA 2XKPA 2CQ7A 3LFKA 5GTIC 1R5GA 1KU9A 3DFGA 1UG0A 1O7LA 2HXOA 1WVRA 3HPGA 4OINF 1UHWA 2CV2A 5E3LA 1D3YA 2QA4I 4HW0A 2ZXJA 3SFZA 1W4MA 2XAGA 2DDAA 1A6IA 4BEHA 4B8XA 2OUMA 4PUSA 3V42A 2ECBA 3ZQ7A 5BPDA 1HDDC 5DV5A 1W36C 1R5ID 2WV1A 4E7KA 1R1UA 1W7VA 5GAGJ 2WY7Q 4UB8C 4MIMA 3CCEI 1TLHB 3KP5A 4HEA2 4IF7A 2V6CA 4GO1A 2GXGA 1IDYA 1ZELA 5FKLA 1ETKA 1LUJB 2ESHA 2BWVA 2M7BA 3H0GJ 3CDIA 5JFRA 3J80Z 4JQFA 1SEUA 2R7QA 3DKXA 5DUIA 4RS8A 4PJ0C 2DDBA 4EMSA 1BIBA 2L2OA 2R7WA 2V26A 2VN2A 5EZGA 2PX9A 1TWGJ 5E8GA 1OLTA 4EATA 1LEAA 3DCFA 5LD2C 3ZMZA 2EBIA 5FD6A 4KJZA 1XGSA 3LSRA 5KAIC 1PYVA 2JA5J 4LK0F 3V8JA 5DD4A 2LBFB 3AFHA 1T8IA 4CCMA 1G8XA 1WJCA 2CFOA 3E6DA 1C21A 1JKOC 1IRXA 3CUQB 3SEQA 5M3FJ 4XONA 3BPVA 1FTTA 5DUKA 1FOKA 4G9YA 2L9VA 2ZNYA 5FLMJ 1Y1NA 3L00A 3ZQCA 2LDUA 3QYBA 3FXMA 3GZ6A 4M3EA 1D5YA 1NG7A 3KZIC 5EJCA 3W2AA 3GTMJ 3AL0B 1BJAA 2GG8A 1M35A 1LFBA 2FNPA 4BXXJ 1I1SA 2K4BA 2A07F 2G6PA 4DIQA 3OIOA 1WCMJ 2A61A 3OYJA 4KMFA 2IGMA 2HEOA 2A6EF 2MGQA 3DPUA 5HODA 1K4TA 5GAHJ 4XL9A 1FYMA 4PJMA 4DBQA 2CUJA 2K5CA 3N05A 4GGGA 3U1KA 2OTJI 3R0JA 1PJRA 4UXNA 3AAFA 3SJMA 1SVOA 1T95A 1YO5C 4HPQA 4HSRA 4X1EA 3U1DA 4S00A 2DA5A 4OAZA 1R4MB 2VBWA 4QWQA 2ZXHA 2L54A 2VB6A 4E7SA 1USTA 2IS2A 2HZDA 2AS5F 2DTZA 2R7RA 1SAUA 2FOKA 2MBFA 2TRTA 1BI2A 1YE9A 2Y31A 4B1RA 4DBRA 1KU3A 2IPQX 1UHMA 3QPTA 2IP2A 4XSZF 1VNDA 3S2DJ 2IA0A 5H6RA 3CB5A 3DTIA 1SVLA 2VIXA 1XS9A 3K1PA 1D0ZA 2AQEA 1MMGA 2KRHA 2OF7A 3LSTA 1TQMA 1JTYA 2XASA 2DCEA 2O0YA 2WAQA 1OJLA 4M6YA 1DPRA 2Q95A 3JSOA 3NRVA 2XAHA 3ZQIA 1K6OA 2VE8A 2IBDA 3IWFA 3ZP5A 2ZBKA 3ZQFA 2RGVA 4G6QA 2EA2A 2LY9A 3S1NJ 4FISA 4QPOA 4FLKA 4M3DA 2EQRA 4Y17A 2G9WA 1QBJA 2X6XA 2NRAC 2DN0A 2OTLI 1WHUA 4EV0A 3A1YA 3JREA 1MJBA 3GF2A 2XVCA 1R22A 4CCKA 4UHTA 5D6FA 4IHTA 3HOUJ 5CDEA 4CXFA 1FOXA 1U0JA 3HGGA 1MMAA 3IH4A 1Z21A 2FQ4A 2XPUA 4PNCA 2HU9A 1MMDA 3WTZA 1TZLA 1QO0D 2LR8A 1HKQA 2YR2A 3TO9A 2XAJA 3O2PE 1LVKA 3FBNB 2JSCA 5KHDA 5CNXA 2OPTA 2IA2A 4M71A 3CMYA 2RAEA 3VOEA 3CMEI 3WG9A 2M4GA 2I5UA 4FO7A 3I5UA 1MDMA 3G2BA 1IF1A 4I0AA 1VQ8I 2K9QA 2K9MA 3H5RA 1BIAA 1X4OA 5CVIA 1D1AA 2NNYA 2ME6A 1B4AA 1YJ9I 2BWTA 2EIKH 4HZFA 4DJAA 5F1JA 3HBLA 4U75A 4RM3A 4C2MJ 2Q93A 4CO8A 3IRQA 1J09A 4V2GA 1ETVA 3BP8A 1ZTRA 2EV6A 2XROA 2JK3A 1ETOA 3CCMI 1N78A 2X4HA 5FFZA 2CYYA 2VXZA 4C3JJ 1AA7A 3K4BA 1IAWA 2E60A 2BWUA 3ELKA 1ZLJA 2CJJA 3K2ZA 5A2QZ 3W6VA 1QHHD 3FXQA 5L3GA 1SMYF 4NQWA 2D1HA 3SZPA 3HEFA 1YRNA 1BOAA 2OV7A 4LG3A 2LMDA 4A6VA 4P55A 2G0EA 3HHGA 1RUOA 2PBIA 2E1OA 5FRMA 1R7JA 1ETQA 4NDLA 3H0DA 2V9KA 2JSPA 1WBQA 3M1CA 2JPCA 3UR3C 1RETA 2B0LA 1XTAA 1MW7A 2E1NA 2N8GA 4FUKA 3FZVA 2ZJQF 5LLQA 3S3MA 1IJWC 3IHUA 6PAXA 3AKZA 2AXTC 3A0HC 4O3MA 1BI1A 3IH2A 3VYRB 1O3RA 3REOA 1ENHA 2STTA 2VKHA 3P9KA 3ZCOA 4FTHA 2ZSHB 3OYIA 5AIQA 1SD5A 3FDYA 3HRSA 4ZTFA 1YJ3A 3WTWC 4UVBA 2R7VA 1H9TA 4Y7NJ 3V8LA 2CW7A 3FXUA 3JRIA 4E7IA 2P6SA 5HNHA 1YI2I 2OZ6A 4CZZA 2KIQA 1QNTA 2ADUA 4A2UA 3C1DA 4CYDA 3Q5FA 1NTCA 2NOJB 2P4WA 1U3EM 2QVOA 4BQOA 2ZXWH 3EQLF 1RUNA 5B66C 1ERDA 5BPIA 2HOWA 1V5EA 1VQ9I 3VPRA 2LP0A 4U0YA 5ICGA 2R3SA 4M6VA 2GOMA 3BJ6A 3BT9A 2X6WA 3ZR8X 2QYOA 3HC7A 1K7AA 4RB2C 1YLFA 4L5IA 5C4XJ 2IGKA 2Q94A 3HOTA 4KFCA 3V8KA 2EINH 3GFIA 3OL3A 2F5DA 4C3IJ 4ZYDA 5BS6A 2MC3A 2LSOA 3BOQA 2TDXA 1IXRC 4QR8A 2GA2A 2DFEA 1F4KA 4LMYA 4XLPF 1W0UA 1A35A 2Q92A 3ZMVA 5J1RA 3ZXSA 5M5YJ 4I2OA 3F8MA 1MMNA 4G8XA 1E0EA 3HKZN 3KYCB 3GZNB 3QPHA 2FEZA 3KE2A 5EEHA 5BNGA 1M1EB 2Z1DA 3F3XA 2ECCA 1J7KA 3HKZA 2WAQN 1W7PD 1OPCA 2V7FA 1O3TA 1WJAA 4OOIA 1BR4A 1VQKI 2FMLA 2GQQA 1JGGA 2A05A 2R7UA 4E7ZA 5HS9A 5HS7A 3SEZA 5EEAA 3OOPA 1Z0XA 3FXRA 3JRBA 1TWCJ 3FMRA 3J80K 4DYRA 4L9VA 1YYVA 3I55I 2GA1A 3OYLA 2HVSA 1GDTA 1K79A 3E5QA 2MD0A 3CUOA 3BTCA 3Q0WA 1C22A 1R23A 2K9LA 2O9LA 2EZLA 3DPLC 2DU9A 2M3AA 5C44J 2VASA 2Y2ZA 2BH3A 3RYPA 1BC8C 2ZO4A 2NS7A 4RGSA 4B4CA 2BY2A 4Y33A 2A6TA 5LHIA 3RZOJ 3DBHB 1JUPA 3CJQB 2DPUA 2HYGD 3L2UA 2HVRA 1MD0A 5CQGA 3ERED 3N4MA 4RDUA 3QWLA 3CO6C 2ZMEB 4G7OF 2QQ8A 4GXOA 5E18F 3BY6A 3OYFA 2GLOA 4KUMA 2DMQA 1MH3A 2RV8A 1X3UA 4GYIA 3HG9A 4EGZA 1R58A 3JTGA 2OQRA 3CF5F 5BQTA 3WU1B 1XCVA 3IU9A 1R4NB 5K5RA 2XF5A 3PIPF 1FP2A 1H9GA 4PGHA 4IXAA 3MMYB 4LJZF 4PJJA 2L3DA 4N9HA 3CMMA 2KP6A 1BN5A 3CP8A 4CZCA 1T39A 1BJZA 2DK8A 4RGUA 4CCJA 2BHAA 4CUGA 1OKRA 3VDXA 3FK7A 3L9FA 2UV1A 2RNGA 3K10A 4ZYHA 1YHQI 1JKQC 4DGWB 1HC8A 1BW5A 5IYCJ 3GLXA 1ZGJA 4EQQA 3D1NI 1J59A 4ZWOA 1FYKA 2M1BA 1O3SA 1BBYA 1QVTA 3GMEA 3V7CA 4AC0A 3UKGA 1HA8A 1DQUA 3FM5A 2XGCA 1JE8A 2BVMA 4XNFA 3M3YJ 1FIPA 1D0YA 3LSHA 4UUTA 4WWCA 2BZTA 4U73A 2HQNA 1DU6A 3HSRA 3G1MA 5J47A 4OOKA 2K85A 5LHGA 4KDPA 2Z99A 1X4PA 2OKNA 4XLEA 2STWA 4XN0A 2JVGA 2KRCA 4KIFA 3KP2A 5GAEJ 2ZKZA 2ESNA 1R71A 2IXSA 5L3BA 3BWGA 2V79A 5CKTA 4WXCA 1WFXA 3TGNA 4Y52J 3C2HA 1GVJA 2W48A 2MFZA 5E3OA 2HDWA 2JA6J 1G3YA 1QGPA 1T0FC 1XD7A 2LRDA 3IP4B 3Q3SA 1YJNI 2L9NA 2QF7A 5M5WJ 5FLXZ 2RDPA 4PSWA 2DMPA 2GG7A 1Y0NA 2PMZA 4NB5A 1CHMA 3IAM2 3M8FA 2G7UA 3ECHA 4M9ZA 4XK4A 3WTSC 2BY1A 2V1UA 3HDDA 4U6JA 2VJJA 3TEDA 2BWXA 4AIKA 4BDYA 3RSNA 4FE7A 4ZJZA 2RKHA 3DKYA 4MFDA 2DA3A 4N9IA 3RI4A 2Q0OA 1IRFA 1O0XA 3OYMA 3ZQQA 3L7GA 2A69F 4KT6A 3KX2A 3CTZA 3JAMK 3DP7A 4ZTJA 2B3HA 3RVAA 2NS0A 1B72A 1VZ0A 4A5NA 2XRLA 1Y56A 2EZIA 3C2BA 2VC1A 3Q9SA 1VFCA 2GG9A 2EB7A 2WWYA 1HCRA 3ML6A 4A6DA 5M3MJ 4BU2A 2M0MA 1FBSA 5H2FC 4AWXB 5IYDJ 2DMTA 1KQ0A 1XMKA 2EFNA 5F1RA 3KEYA 4MQVA 5IT9K 5FKKA 1LJ9A 3K2AA 4A6WA 2WA0A 3BROA 4XORA 4D7MA 4XLCA 3ZMTA 5DCMB 3KPHA 3FHNA 1ZR2A 3G1LA 3BTLA 1ACIA 2OCEA 4XOTA 5FCFA 3BG5A 4A3IJ 2DT7B 1ZQ3P 1SMTA 2HFHA 1SD7A 2MSYA 3CCYA 4E4HA 1FMWA 4P9FA 3BC8A 4Y4RA 4EM0B 5K5QA 3WE3A 4IRHA 2MD5A 2HQAA 4WF2A 4XKCA 4UNOA 3DPTA 4UUSA 4M3GA 2VT2A 1U9OA 1YX5A 3RYRA 3CMAI 3GO5A 5LRSA 1Z7UA 2Y0SN 1LDDA 2FE3A 1I6XA 1Z1DA 2LYCA 4IF4A 4HBLA 3HTSB 5CLSA 4FKCA 2P6TA 1G6NA 5IOYA 3R60A 4HNVA 3G71I 3HOVJ 4XBFA 3PNTA 3B6AA 1U5TB 3CCVI 1ZG1A 3TDZC 4I01A 2L0KA 4AVZA 3K0LA 2NVUB 2E36A 4U6EA 2GU6A 1Y1VJ 2I10A 4S2TP 1SD6A 4RM2A 2EFQA 2JRMA 1WWXA 1B9MA 3TO7A 4RLFA 3HUGB 4BQQA 2ELJA 2MATA 2YSRA 4HDVA 1T6SA 2DOFA 1RRJA 2D2WA 3GLLA 3OS0A 2JQ7A 1DDNA 1G4DA 1D1BA 3KETA 4XSXF 4M3FA 1BA5A 1ZREA 2VPRA 5LBQA 2UZKA 3H9GA 2CO5A 2GG0A 2KPMA 1CQTA 4XICA 2HKOA 2CMPA 5AONA 1DP7P 2JJ7A 5CYVA 3GTGJ 4E6KG 4RAGA 4H4KC 1T08B 3L1PA 2QLZA 1VQ6I 2EPFA 1QZZA 3F6OA 2H1LA 1X1PA 4RGZ1 1JXSA 1HQCA 2BN7A 5HDNA 3HOYJ 1X1DA 3S17J 2X51A 3HJEA 2IS1A 3RCOA 4J00A 1FY7A 3CUQC 3MX6A 2B3LA 3ESWB 4BACA 4FASD 2ICWG 2MA3A 3CF2A 3H3ZA 1MH4A 1Z6TA 4RLQA 3S93A 3WHCA 2IS4A 3CO7C 4IX7A 1FT9A 4HLXA 3IH3A 3OYEA 1E17A 2F5CA 2R5YB 2ZJ2A 1B6AA 1JAWA 4IHYA 1Y39A 3V4GA 2VOOA 2ME0A 4PK4A 2L9RA 2VQLA 4CYCB 1VQLI 3TW7A 2MW8A 2QQAA 3KZZA 4YEJA 2E2HJ 3Q0VA 3E5XA 2GXBA 1VF9A 3PFIA 2OQGA 4BJ6C 3DV8A 3CESA 4G94A 4BE1A 4Y3OA 1XC5A 3MVPA 2GG2A 3RJPA 4UVCA 3L2WA 1OCZH 3DKWA 2CQKA 4LLLA 2QUFA 3VODA 5FLXK 3QQAA 3OV8A 2OCCH 2YPRA 1MNMC 2CS3A 3DBRB 1IUYA 3DF8A 1BR1A 2L4MA 1HDPA 4ZDPA 3RKXA 1WL9A 1MMSA 2RVCA 4BJTA 1P2FA 3BR3A 3A2KA 4A3MJ 2HPIA 2MYSA 2R7SA 2E71A 2QM3A 2XSDC 1UELB 2RNJA 3NWSA 4P1WA 2E34A 4I99C 2V1XA 3EYIA 3CCSI 2FOWA 1N75A 1V54H 3ASOH 4XKWA 1F9NA 2BY0A 2M45A 1WJ5A 2Q96A 3M9AA 2JTVA 2QKLB 1B8IA 5D4RA 4AM3A 1U8BA 3IU8A 1E3HA 1TQIA 1W1WE 4KT5C 5TJJA 5EEGA 3T8TA 3MD2A 1XSVA 2EZHA 3JRFA 4A3LJ 5IY5H 2KKOA 3C2GA 2HQ5A 3LWFA 4WX9A 1TC3C 4L9TA 3U9GA 4FX0A 5B1BH 4NC7A 2VL8A 3K70D 2VKDA 1R5HA 3K1MA 4HRIA 4NBQA 3CJTB 2JMWA 1WH5A 1ZARA 1HBXG 3QYEA 2GXAA 2GWRA 4RBOA 1PVEA 4BXUA 4AUXA 3R6SA 1W5SA 4YG2F 1X2MA 2H6CA 2VPLA 3MZ8A 2GGCA 3HRTA 1TWFJ 1HOMA 1XN7A 3A0BC 1SFKA 3JR9A 3CCRI 1FBQA 4KNYA 3FXKA 2XB0X 4LB6B 3RKYA 1J9IA 2P81A 4ZDLA 4IOCF 1J2XA 4JP0A 1VQOI 2PMUA 3NQOA 2UXNA 1ZRDA 2DQLA 4DNCA 5L3FA 3I53A 3GTOJ 1P92A 4IEJA 3VFZA 1X1AA 2GM4A 4DZJA 3RPQA 4PJNA 3T0YA 2OZUA 1QHGA 1GHCA 2GU5A 2DJIA 3WGGA 5LHHA 1USSA 4QTRA 2R0QC 3CCUI 4IKRA 4U76A 3B6CA 5J4YA 5JLWA 4F55A 2Z33A 4PSXA 2K86A 4G7ZF 1MJ9A 1ITYA 2L9SA 3QOPA 1KYWA 3WHBA 2ZSGA 4FO8A 5FB2A 5ICCA 4WXDA 2DTRA 3FISA 2VUMJ 3OYBA 2V1NA 2BXZA 1FX7A 1OYYA 5FKMA 1XPXA 4A3FJ 2OA4A 3GFMA 4BL0B 4M3BA 2V3XA 1ONVA 2BW3B 4A3EJ 5DM7F 4L0ZB 2FBHA 2R7FA 1RESA 1OFCX 4HDUA 3KYLA 2P0WA 1X3ZB 3G1OA 3D5LA 4BBRJ 2J5PA 2L7ZA 2LC2A 2FQ3A 2QQ9A 3ZGKA 3PQJA 1K61A 2F5EA 3IWZA 4HNUA 3GEZA 4KIGA 1LE8A 1MBJA 3ZN1A 1KGSA 1WPKA 1S7EA 4S04A 4R8HA 3CCJI 3K4MA 3DEEA 2VJ5A 1ZG3A 3U21A 1KU7A 1F5TA 1N51A 3I58A 3WU0A 1WQ2A 5CPRB 5E79C 3JRHA 1XGMA 2LVSA 3TB5A 2BEOA 1JJ6C 2DMNA 3FF5A 2MH2A 4EGYA 2HGCA 5CJ9A 3V7RA 4ETSA 1GLNA 1WZ2A 9ANTA 3PO2J 1GV5A 4KYWA 3LL7A 2R5ZA 4CHUA 1ZKGA 2XGDA 2OD5A 2LREA 1UB9A 4B3AA 1WGXA 2M0CA 4AYBN 3TL4X 3BR1A 2Z9OA 3FWEA 5D5VB 4RZZA 4N0BA 1HW1A 3PQKA 2P5VA 4PFPA 1TT0A 1MIJA 4UY8I 2FSWA 1BM9A 1ZK8A 3FM3A 3HSFA 4BXFA 4LD5A 4ENJA 1RZ4A 2QSHX 1S5LC 3HM5A 2X0LA 3OL4A 5E17F 2W24A 2X6YA 2CGPA 2DO7A 3KLNA 3VEPA 4BE0A 4MEXF 1S6LA 1SVMA 3RPUD 3ABLH 2P5LC 2ID6A 4JUQA 4PFOA 3R61A 1Y8QB 5DM6F 4GCVA 1QPIA 2UUZA 2NNNA 2W57A 1YW9A 4HV5A 1XGOA 4BS9A 2DFHA 4BHCA 3HOXJ 3QYFA 2WV0A 4V19K 3HZJA 3HSEA 2V4JC 5FKOA 4B44A 3J7ZI 1NHAA 5TRDA 3HOWJ 2HKXA 1ZGAA 3GCMA 2PFBA 4C30A 2DA4A 5LGUA 3OYKA 4KA4A 2DA7A 2VQCA 2H27A 3PKCA 2FF4A 1VQPI 2V9PA 4D5CA 3GTJJ 3I4MJ 2P5KA 4IRIA 4JK1X 4A3BJ 3IL2A 4ZWPA 4UV8A 3ZMSA 2CQQA 4IU6A 1V5FA 4E7JA 4XRSA 3MQ0A 3JRGA 3L09A 4NC8A 3UNGC 1A5JA 5D5XB 4HF2A 3HHHA 2R7ZJ 2LOOA 2PLYA 2XAQA 3F21A 2P98A 1GXPA 1T33A 1XG1A 4HOBA 4CCOA 4P96A 1TT5B 5GP9A 5IP6A 2LF8A 2O5RA 1LFUP 4GYGA 2KQRA 3ULQB 1UJ8A 2WADA 5D8LB 4P9UA 5IT3A 5M5XJ 1YJWI 4BQAA 3M4OJ 3CDLA 4ASNA 2DQRA 3LAJA 2CV1A 4MTDA 3SQNA 4A3DJ 1IDZA 2B3KA 1APLC 4OIPF 3MKLA 1MBGA 3KYDB 1T98A 2R7OA 2AO9A 2QQBA 1V5GA 5DYMA 1QZEA 1ZR4A 3R0AA 5J40A 1GT0C 1Z77A 1I5ZA 3FKIJ 1T56A 5EZHA 3O6BB 1T2KA 3PKBA 1W5TA 3I54A 2VLAA 1BL0A 1ZHFA 5L3DA 2A3SA 1Y6IA 3T8RA 5FFXA 3M8JA 5LGNA 4RB0A 5DTDA 4IRGA 1OR7A 3WTUC 2VC0A 5C3EJ 4BHPA 2Y69H 2RN7A 1MNEA 1RC9A 2RREA 3E6CC 3E7LA 3MN2A 2KZGA 4FQGA 1TQPA 4I98B 3FIWA 3M7GA 1U9NA 1X1CA 2VONA 4ZYGA 2QCOA 4EJTA 2HOEA 4IKUA 2FRHA 4EEFG 4B43A 5HLHA 2ISZA 3S14J 3QP6A 2KDZA 1YS7A 2VQHA 4IPAA 4XR6A 4BEHB 5EYRA 2HNHA 2P99A 3A03A 2O8KA 2CSOA 3O8HA 3RIRA 3G73A 3CP2A 3I59B 1S8NA 1G59A 3OY9A 1UZCA 4H0EA 2Z2SB 3DXJF 1WKMA 4UUVA 4Q48A 3F23A 2FUG2 2DA2A 5E8IA 5FCHA 5J8FA 1ETYA 2FX0A 1KYZA 1K4SA 3L24A 4X0GA 4UB6C 4P5OA 3EUHC 1G3SA 4JX5A 3IG4A 5BOXA 2X1EA 4Q4ZF 1D8KA 3JCUC 4AVPA 1ULYA 5CVJA 2M4KA 5HLIA 4C9YA 3ISPA 4EVIA 4RB3C 4MATA 2EILH 2A68F 2O6GE 5ILUA 1I3QJ 2DXIA 4R79A 1RPWA 1JKRC 2ZXIA 1KU2A 4BUPA 1REPC 1ZRFA 2LNBA 3BLYA 3TMOA 4BHBA 3ASNH 2EA4A 2Q2EA 3VWBA 2PN6A 1QA6A 2YUSA 3BTIA 1MBEA 3GUDA 2JN6A 1P4WA 2LD5A 4DZPA 3DTEA 5BMZA 5K7ZA 1NG6A 4M9SA 4A3KJ 2EFPA 3P9IA 3M1EA 1MSFC 3BCBA 4ZDOA 1RKTA 3ECOA 2Q8KA 2PJRB 4G7HF 3LQRA 3AL0C 2OBPA 1W2MA 3LSKA 4HLYA 5D6EA 1VQ7I 3CD6I 5F04A 4W1UA 4IO9F 1FYLA 1UCRA 1WY2A 3BTJA 1I6HJ 2E7WA 1IRGA 2NQ7A 3S6BA 2EFWA 3TOAA 1LDKB 4BE2A 5HLTA 1SAXA 3QPSA 2DOEA 1ZAOA 5H20A 4LFUA 3I56I 1FP1D 2CUFA 2GIVA 2Y75A 3D5RC 4KN7X 1QZYA 4BAYA 3G6EI 3MKWB 2W1OA 4ZYAA 4F3QA 4G6DA 2F2EA 2NQ6A 3PUFA 2E2JJ 4BDZA 1VTNC 2M34A 4OIRF 3OSGA 3L7WA 4UV9A 1KZHA 2IA1A 4F92B 1YRNB 2X6OA 2H8RA 4YFNF 2JWTA 5HDKA 1SFUA 4FCYA 2PG4A 1UAAA 1C23A 2R7XA 4KN4X 1J75A 3IRRA 1EF4A 3DEWA 3WU2C 3MZHA 1ZYRF 4W97A 1JT0A 4GDFA 4XQFA 3TO6A 3J7AY 2BWSA 4MGRA 4KICA 4XRSG 1W7PA 1AOYA 4DOZA 1P7JA 2FU4A 2Q2EB 1X1BA 4L5EA 1G2HA 3GVAA 3E3VA 2EV0A 3OYCA 3LNQA 3S3OA 3JRCA 1HKTA 2CWEA 2DI3A 3K1NA 2KRFA 3E6BA 3F8BA 3I0TA 2JA7J 3E6MA 1V55H 1H0MA 1Y8RB 3BQZA 3EDPA 1IXCA 3KP7A 5IP9J 1FJLA 4A0XA 2AHQA 2I8DA 3OYHA 1ZRCA 3PKEA 1P9QC 3ZOBA 1VI0A 5D8KB 4FLIA 3M8EA 2MC4A 4BY1J 1KQ9A 3TOBA 1W36D 2QBYB 1U8RA 1OCPA 3B02A 2M7AA 4PCQA 3L2QA 3TW6A 2K9NA 3JW4A 3X2QH 4U1BA 4RGRA 4Y13A 3GBGA 1YVMA 3RKWA 5FO5A 3HIFA 1I50J 4IOAF 1O7FA 4IL6C 2V6EA 1HSJA 3VB2A 2ELHA 3LSIA 3O3KA 4U0VA 2GG5A 2L02A 4YFKF 1KA8A 2H94A 3BG6A 3DWLE 5KNLA 2R5YA 1H88C 4EM2A 1B59A 1Z9CA 5LRRA 4F91B 2GAUA 1L3LA 5FJ8J 1Q1HA 3ABTA 2XSJC 2B9SA 3FXOA 2M9HA 2XGXA 1S7AA 1S29A 2DA1A 2LBFA 4LIUA 3J81Z 5FLVA 1WL6A 2HDCA 2IJLA 3D0SA 5E5BA 4J01A 3C3WA 4M73A 3F8FA 2OJED 1FC3A 3WE2A 5ILSA 2B63J 2P9AA 1FEXA 2JVHA 1Z67A 3KFWX 4OMZA 3GYHX 4CCLA 2BVLA 3F22A 1C24A 2L5QA 2M2EA 2GU4A 2JUGA 3KP3A 2MLGA 3BG3A 2ID3A 4D0PA 2ACJA 5AIPA 2J5OA 1IN8A 2FD5A 2KL4A 2TCTA 4A12A 1X3WB 1QQIA 2M8EA 5FGMA 4KMUX 1XCBA 2QEXI 3KP4A 4HF1A 1MKMA 1S72I 2E2IJ 3BQYA 2CQXA 1LB2A 2R5ZB 4PDKA 4E7HA 2C6YA 4K2EA 1W0TA 4B28A 5JHUA 1QXZA 2KFDA 1FZPB 1R36A 4JX4A 2XB5A 2CRGA 4I09A 3ZQGA 1W7PB 4M72A 3GTPJ 3PJRA 3SHFA 4HX7A 2Z3YA 3OR2C 5E3NA 2X85A 2EJRA 1YG2A 1JUSA 1QXYA 5DDGA 1JTXA 1MDMB 3CLOA 3I4PA 3F9KA 4PGGA 4AU7A 5B3SH 2PMHA 1FOWA 2XDVA 5D4SA 5JLXA 1QRYA 2VBXA 3BCAA 4HV6A 4FLJA 4PV4A 1IN7A 1BOBA 5GTHC 3W3CA 2W85A 2DOAA 1XSXA 4BH9A 4YIFA 1OMIA 3GW2A 3MAJA 3I4NJ 5TGTA 2R4GA 4ENKA 4WK8F 4X6AJ 2PI0A 1IZ1A 2W00A 3HUGA 2XPWA 5DS9A 1DGWY 5ILVA 3V7SA 3ABMH 3Q0UA 3S1MJ 3QODA 1LVAA 2XKOA 3LA7A 1XMAA 4XLHA 1IN5A 3L2RA 1XB4A 3LOCA 2WAEA 4QPQA 4BQNA 2G7HA 4AIJA 5KAFC 4LLGF 1FLIA 3COAC 4LG0B 1U78A 3MKYB 1XDUA 2KHMA 2CH0A 4OIOF 1JGSA 2XIGA 4ESJA 4XLFA 2KMUA 3LMMA 5HLGA 4OU0A 2CW8A 1Z91A 2CQNA 4IKSA 2F4OB 2L01A 1Z6RA 4XRFA 1QPMA 2VT3A 3OIQA 2EFOA 3F8NA 3C7JA 4V2FA 3TQNA 3WTYC 1MJAA 3NAUA 1G3WA 1OCCH 2DK5A 2D5VA 2XPVA 2Y9ZA 1IO2A 2BXYA 2MLKA 1JHFA 1YW8A 4F7ZA 5IP7J 2CG4A 4OAYA 2VBZA 1OISA 2QWWA 2KIUA 5F0HA 4L9JA 5ICEA 3OYDA 2UWMA 1IV6A 1MNDA 3GTLJ 1TW3A 2QENA 5L3EA 4AD9A 4CGZA 1POGA 1BC7C 3F6VA 2ZJRF 1E2XA 1KP0A 2D45A 1ETXA 3OS2A 3GFJA 4A5MA 3S1QJ 3P7NA 4BYYA 1NK3P 4DQ2A 1HKSA 4Y15A 2IVMA 3AG1H 4IHWA 4OIQF 4O5VA 4LLNA 4BNCA 3PL8A 1UG2A 1YIJI 2IEKA 1GV2A 2HTSA 3E97A 2EZKA 2K40A 1CF7B 3C18A 5K1YA 1LQ1A 4R1HA 5ICFA 1ON1A 3CC2I 1UHSA 1UFMA 3H9JA 5HS8A 2WY8Q 3U2RA 2VJ4A 4IQ4A 2E1CA 2ZFUA 5FROA 2ZJPF 2Y30A 5CIKA 4BY7J 3E1SA 3QP5A 3HXLA 4M6XA 2F4MB 3OS1A 3VSLA 4HSTA 2EVCA 2CFXA 2P7CB 4D9JA 1C27A 4NQWB 5J1YA 3BJAA 2FBIA 2BYVE 4CH7A 2EIJH 1MBHA 3I9V2 4J19A 3QU3A 2ISYA 4U7DA 1I27A 2NVYJ 3LSPA 1TW2A 2CW0F 4ZH4F 2HR3A 1FTZA 3K69A 4ZC3A 2E35A 5EGOB 1X2NA 1FOYA 2F48A 1P6RA 1R6RA 4I02A 1FPQA 4U6ZA 4NHJA 2BBYA 4HQMA 2NAZA 5IT9Z 4ZZLA 3E0JB 1AWCA 4YIIA 2AQFA 2CUEA 2X1DA 1XSDA 3S32A 1GXQA 1LEBA 4CSWA 2P7VB 3A01B 3GTKJ 4A0ZA 3CJRB 4A3JJ 1AHDP 2XV4S 4OWRB 1P4AA 2F4IA 1SFXA 2HI3A 1LE8B 5KVRA 5LGTA 3OYAA 3EYYA 1OCTC 3E5UA 3T5XA 2O61A 2NS8A 3CJNA 1G3TA 3DEUA 2HTJA 4XIDA 1A16A 1JT6A 2R93J 2A5WA 1SFEA 1IC8A 1DPUA 1WRJA 2O8XA 5JVGF 1FSHA 1A6QA 4C2UA 3ZMDA 4EJOA 5EF6A 4ENMA 2IRFG 3H35A 2HVQA 3J7AO 2GG3A 2O03A 5F6FA 1WLRA 2GZ5A 1GVDA 1CGPA 3EETA 5B1AH 1SANA 5A2QK 4E7LA 1R00A 5B5EC 3S8PA 1F1ZA 2BY3A 3DTKA 1EJ9A 3T1BA 4MFEA 1H8AC 4U6WA 3OR1C 3K4CA 4YELA 2ZMEA 2LFBA 3BIQA 3WODF 3ZMUA 4AYBA 4LGWA 4YFXF 5DD8A 3FKJA 2EIMH 5EGOA 4EJUA 3RKQA 2AXLA 1XMXA 3CZ6A 3CC4I 2Y0SA 2V3ZA 3WG7H 3DLLF 1ORKA 2LLKA 1EV7A 2LH9A 4MLOA 4CICA 5J8CA 3ZPLA 1Z7LA 2LKXA 3HRMA 5CDLA 1YS6A 2Z16A 2DFIA 1VQNI 3ABUA 2WC2A 1VQ4I 1SFOJ 1EH8A 3TAVA 3MATA 1QXWA 3JRDA 1MBKA 1OYWA 1A04A 4N4NB 2HQRA 3K4LA 2R92J 2GU7A 2ZB9A 1YOVB 3K7AJ 4MTEA 3S3NA 3IKVA 4MHGA 2VI6A 2O7OA 4RA2A 3SZGA 1FBUA 3FMSA 1TWHJ 2PJRA 1H89C 1V3FA 1D5VA 2H09A 1LFPA 3S16J 1B1BA 3RQIA 3S2WA 3NARA 1KONA 4HAMA 3SXYA 4MO7A 3RDIA 1J5YA 3H5AA 3OYNA 1DGRM 4AIHA 1AU7A 1F43A 4JYKA 2DFFA 2EK5A 2ELKA 2K9SA 1Z05A 2DJNA 2WBMA 2VJIA 2W82A 4ZZDA 2E1MB 3PFYA 4II2A 2IT0A 2K7LA 2DLLA 2HS5A 2PQ8A 4C3HJ 4HQEA 2BHZA 3KLOA 2HPMA 3H36A 1IG7A 4IQJA 5DCFA 3PO3J 2YX4A 3PKDA 1BI3A 2K3PA 2M87A 3EUHA 3IAS2 2LKSA 2RQPA 5TISC 3R4KA 2NVXJ 3MCZA 5IYBJ 1WI9A 1IRZA 4ZNGA 1GUUA 4D5FA 4S2RP 2E5ZA 1OYIA 1R49A 1FMVA 4MEYF 3ZN0A 4ANJA 3GWZA 4GFBA 2JRTA 4JBAA 1TP4A 4ITVA 3TP3A 3I59A 1PUFA 1A36A 5F08A 1WJBA 3MR1A 1E3OC 4CA0A 5J4VA 3L2CA 1ZG5A 1X19A 2W7NA 3WGIA 1NH3A 3JSPA 1O57A 5J1UA 2DBBA 4HG2A 1RNLA 2HYJA 2R7TA 2E1MC 4E70A 3EPZA 1B8IB 3AG4H 5F0FA 3MWMA 1O3QA 2ZSIB 2V9VA 3BG9A 1IV8A 2BGCA 2XAUA 3BDDA 1BR2A 5DCMA 3RTRA 1RR7A 3BR2A 2OC6A 1ZLKA 4HX8A 4IZZA 2COBA 5JVTA 1JKPC 1PUEE 2X48A 2YU9J 2B7EA 2QGUA 2XGEA 3BR5A 1FWZA 2F5FA 4RZYA 2H8WA 2QSFX 3DQVC 1I3AA 3JTHA 5H6QA 4L18B 2KDOA 3BR6A 3H1CA 2H6BA 1P7IA 2K02A 2DODA 5HVQC 3K70C 3G3ZA 2IGOA 3L2VA 1LNWA 1U2WA 1QVUA 4LK1F 4RMNA 3RPUA 5HNFA 3HTUA 3D5SC 3LSGA 3QOEA 4RAYA 3PIOF 4BGDA 2JA8J 3D27A 3VYSB 2GGBA 2LY1A 3RORA 3W6KB 3W2WA 2IW2A 1BW6A 1DP3A 4CCNA 1P4XA 1Z3YA 4KISA 4YRVA 4XLNF 3TDUC 3G4SI 3BZKA 2LKPA 1ZH5A 3FBIB 4G6TB 3DBLB 5GPCA 1U5TC 1TL8A 4FETA 4FLLA 3LSJA 1XNZA 1EA3A 4S05A 2R7DA 1I1GA 3DU5A 1W5CC 2KT0A 3QU6A 4HYEA 4BBSJ 3F8CA 2VQGA 2QKMB 2FNAA 2QSGX 4ABZA 3IUOA 1YX3A 1HF0A 3ERMA 4R60A 2RQQA 2V1DA 3VYTB 2IW5A 2FA5A 4LG0A 1PP7U 2A5YB 2W4SA 2WAFA 2FMYA 3WTTC 5D5UB 5LEKA 2HOTA 1U5TA 2EH3A 1O4XA 2LTPA 1KQ8A 1TWAJ 1F36A 4CDGA 3HPHA 2XUBA 1JUMA 5K5OA 2O3FA 3LA2A 2FBKA 4XKVA 3P5JA 3ABKH 1TBXA 1YQAA 5J6XA 4FT8A 3IKTA 1AKHB 4IDYA 2LG4A 1E3PA 4I7HA 2GTXA 5JI6A 4IKFA 4RAFA 2ZCWA 4EM1A 1VQMI 1K78A 3FX3A 4FHTA 3HOSA 5F27A 5L3CA 3K4JA 3W2VA 2BE5F 4NNJA 3MKZA 3K6GA 1XX5A 4PZJA 1IGNA 2Z5UA 4IKTA 4L5JA 1IN4A 2BHYA 3KP6A 2HDDA 3MEXA 4U70A 2PMZN 4KITB 2JUCA 3MFKA 3LSMA 3BZ6A 1N77A 1TTYA 1T0FA 1S9HA 3OSFA 3JAMZ 1FIAA 2X1CA 1MATA 2E5NA 3S15J 2BWYA 4LB5A 4S01A 2HOAA 3PKAA 5CVRA 4ESFA 2GIZA 3WGHA 3LQQA 4HNTA 2XF7A 3BZCA 3ZQHA 4IHSA 1Y0UA 5IOZA 2V3YA 3M07A 4DW6A 2BB7A 4C2TA 1HW2A 1YW7A 1S3JA 2ZNZA 4HF0A 2DW4A 4ON0A 1IUFA 2DAOA 1WJDA 4L0YB 2NYXA 1VQ5I 1RI7A 4FX4A 2WB1A 4GRIA 4WXHA 5E1XA 3SDBA 4U6CA 4A69C 4A3CJ 4LIVA 2NVQJ 2P8TA 2W25A 2KJCA 2NXNB 3NEUA 4LITA 4MQ9F 2BHBA 2EVOA 4ESBA 1U6GA 1L0OC 2W84A 1YFHA 3FXLA 2DYSH 2HYFA 1R1VA 1TNSA 4I76A 4WCGA 3IU7A 1R1TA 2ETHA 1TNTA 2E19A 3TP0A 3H3UA 3DLAA 4U69A 1IXSB 2Y48A 1QU3A 2VE9A 1NK2P 1SD4A 3OOUA 4Q5SF 4KM3A 2VBYA 3LFUA 1S7OA 1EKEA 1MBFA 2UXXA 4IHXA 5CVVA 2DA6A 5DEQA 1K83J 2HXIA 2QZ8A 3SDGA 1K78B 3HYIA 4A6EA 3CDHA 1DUXC 4TV7A 3PNYA 5EDNA 3H9QA 1ZGWA 1STZA 5KCMA 2FXAA 1YITI 4QSHA 2VXDA 5ED4A 5CVUA 1R9TJ 2PEXA 1SC7A 2Y9YA
chains in the Genus database with same CATH topology
4ZYEA 3N97A 2M5WA 3J81K 3K9TA 4IJAA 4EGEA 1IW7F 3CB6A 3H92A 3BITA 1EH6A 1WSUA 2YU3A 2E7XA 3P9CA 1V4RA 4B09A 2M30A 4RAZA 1FSEA 2Y0MA 4KIBA 1B9NA 2XAFA 2DPDA 4M9XA 3Q9VA 5F64A 2YX7A 2JZYA 1ZN2A 1BI0A 4HX4A 2A6HF 4U7BA 4Q47A 2LF7A 1J0RA 1PV9A 1YIOA 2EWNA 2EVMA 2OAZA 3W6JB 3F72A 5E1WA 4ENNA 4M74A 4I0BA 4EJWA 1YTYA 1HW5A 2MH9A 3KEQA 5E1ZB 3SZTA 2D1VA 2BV6A 1MZBA 2ZFWA 4RGXA 5FD5A 3BPXA 4ZWUA 3FMQA 2K4JA 5JR3A 4MNUA 2BHCA 2HWVA 1IN6A 2RC4A 5CE6A 2XRNA 4A0YA 3Q6DA 3FHZA 4HA8A 3HRUA 1JHHA 3I64A 5E20A 2KIMA 2L4AA 1PP8F 4IECA 3GFLA 3QAHA 4U88A 3KZYA 2WTEA 5D5WB 1D8JA 1PDNC 1ON2A 4U0WA 2BHDA 3BIPA 3B73A 1C0WA 3WTVC 5LEJA 1HSTA 2KIFA 4Z7MA 3KCCA 4U71A 4Z2YA 3KEOA 2VOPA 3TKYA 3WTXC 2JPBA 4HXXA 2EV5A 5HDGA 5ERIA 1RIOH 4UVAA 2DT5A 2K27A 1MGTA 4EJVA 2XHKA 4IVNA 3GZ5A 3BJOA 3GX4X 1LDJA 3I71A 3CTAA 2COMA 2JT1A 5KK1A 2VODA 1CF7A 3LA3A 4QLCU 1WN1A 3QRFF 1EH7A 3GXOA 3LAPA 1HXDA 1FNNA 2QBYA 2PJPA 4OMYA 4RB1A 5CDVA 1ODDA 2OU2A 4O6JA 2GZWA 3CUQA 4L9NA 1XDSA 5HOOA 2HZTA 3IC7A 1T38A 3MZYA 3ROUA 2BWWA 1XGNA 2KJBA 2XKPA 3LFKA 1R5GA 1KU9A 3DFGA 1O7LA 4OINF 1UHWA 1D3YA 4HW0A 2ZXJA 3SFZA 1W4MA 2XAGA 4B8XA 3ZQ7A 5BPDA 5DV5A 1R1UA 1W7VA 1TLHB 3KP5A 4IF7A 2V6CA 4GO1A 2GXGA 2ESHA 2BWVA 5JFRA 3J80Z 4JQFA 5DUIA 4RS8A 4EMSA 1BIBA 2VN2A 5E8GA 1LEAA 3ZMZA 5FD6A 1XGSA 4LK0F 3V8JA 5DD4A 3E6DA 1C21A 3CUQB 3BPVA 5DUKA 1FOKA 4G9YA 2ZNYA 1Y1NA 3L00A 2LDUA 3GZ6A 1BJAA 2GG8A 1M35A 2FNPA 1I1SA 2K4BA 2A07F 2G6PA 2A61A 4KMFA 2HEOA 2A6EF 1FYMA 4GGGA 3R0JA 4UXNA 3AAFA 1YO5C 3U1DA 4S00A 2VBWA 4QWQA 2L54A 1USTA 2AS5F 2FOKA 2MBFA 1BI2A 1KU3A 2IPQX 1UHMA 3QPTA 2IP2A 4XSZF 2IA0A 5H6RA 3CB5A 3K1PA 3LSTA 1TQMA 2XASA 2O0YA 2Q95A 4M6YA 1DPRA 3JSOA 3NRVA 2XAHA 1K6OA 2VE8A 3IWFA 3ZP5A 2ZBKA 2RGVA 4G6QA 2EA2A 4FLKA 4Y17A 2G9WA 1QBJA 2NRAC 4EV0A 1MJBA 3GF2A 2XVCA 1R22A 4UHTA 5D6FA 4IHTA 5CDEA 4CXFA 4PNCA 3WTZA 1QO0D 1HKQA 2YR2A 3TO9A 2XAJA 3O2PE 2JSCA 5CNXA 2IA2A 4M71A 3VOEA 3WG9A 4FO7A 3I5UA 1MDMA 1IF1A 4I0AA 1BIAA 5CVIA 2NNYA 1B4AA 2BWTA 4HZFA 4U75A 2Q93A 4CO8A 3IRQA 3BP8A 2EV6A 2XROA 2X4HA 5FFZA 2CYYA 2VXZA 1IAWA 2BWUA 3ELKA 1ZLJA 3K2ZA 5A2QZ 3FXQA 5L3GA 1SMYF 4NQWA 2D1HA 3SZPA 1BOAA 4A6VA 4P55A 3HHGA 1RUOA 2PBIA 1R7JA 1WBQA 2JPCA 2B0LA 2E1NA 4FUKA 3FZVA 5LLQA 3IHUA 6PAXA 4O3MA 1BI1A 1O3RA 2STTA 3REOA 3P9KA 5AIQA 1SD5A 3HRSA 1YJ3A 3WTWC 4UVBA 1H9TA 3V8LA 3FXUA 2P6SA 2OZ6A 4CZZA 1QNTA 2ADUA 4A2UA 3C1DA 4CYDA 3Q5FA 2P4WA 1U3EM 2QVOA 3EQLF 1RUNA 5BPIA 2HOWA 4U0YA 5ICGA 2R3SA 3BJ6A 2QYOA 1K7AA 4RB2C 1YLFA 4L5IA 2Q94A 3HOTA 4KFCA 3V8KA 3GFIA 2F5DA 4ZYDA 5BS6A 2MC3A 2LSOA 3BOQA 2TDXA 1IXRC 4QR8A 2GA2A 1F4KA 4LMYA 4XLPF 2Q92A 3ZMVA 4I2OA 3F8MA 4G8XA 3QPHA 2FEZA 3KE2A 5EEHA 3F3XA 1J7KA 1W7PD 1OPCA 1O3TA 4OOIA 2FMLA 2GQQA 5HS9A 5HS7A 3OOPA 3FXRA 3FMRA 3J80K 4L9VA 1YYVA 2GA1A 1K79A 3E5QA 3CUOA 1C22A 1R23A 3DPLC 2DU9A 2BH3A 3RYPA 1BC8C 2ZO4A 4RGSA 5LHIA 2DPUA 2HYGD 1MD0A 3ERED 3N4MA 3CO6C 2ZMEB 4G7OF 4GXOA 5E18F 3BY6A 4KUMA 2RV8A 1X3UA 4GYIA 4EGZA 1R58A 3JTGA 2OQRA 5BQTA 3WU1B 1XCVA 3IU9A 5K5RA 1FP2A 1H9GA 4PGHA 4IXAA 4LJZF 2L3DA 4N9HA 1BN5A 1T39A 2DK8A 4RGUA 2BHAA 1OKRA 3L9FA 4ZYHA 3GLXA 1ZGJA 4EQQA 1J59A 4ZWOA 1FYKA 2M1BA 1O3SA 1BBYA 3V7CA 3FM5A 1JE8A 4WWCA 4U73A 2HQNA 3HSRA 4OOKA 5LHGA 4KDPA 2Z99A 2OKNA 2STWA 4KIFA 3KP2A 2ZKZA 2ESNA 5L3BA 3BWGA 2V79A 4WXCA 3TGNA 1GVJA 1G3YA 1QGPA 1XD7A 5FLXZ 2RDPA 2GG7A 4NB5A 1CHMA 3M8FA 2G7UA 3ECHA 4M9ZA 3WTSC 2V1UA 4U6JA 2BWXA 4AIKA 2RKHA 4N9IA 3RI4A 2Q0OA 1IRFA 1O0XA 3L7GA 2A69F 3CTZA 3JAMK 3DP7A 2B3HA 3RVAA 2NS0A 4A5NA 2VC1A 3Q9SA 2GG9A 2EB7A 2WWYA 3ML6A 4A6DA 1FBSA 4AWXB 1KQ0A 1XMKA 2EFNA 5F1RA 4MQVA 5IT9K 1LJ9A 4A6WA 3BROA 3ZMTA 5DCMB 5FCFA 1SMTA 2HFHA 1SD7A 4P9FA 4EM0B 5K5QA 3WE3A 4IRHA 2MD5A 4WF2A 4UNOA 3DPTA 2VT2A 3RYRA 3GO5A 5LRSA 1Z7UA 1LDDA 2FE3A 1I6XA 1Z1DA 4IF4A 4HBLA 3HTSB 5CLSA 4FKCA 2P6TA 1G6NA 3R60A 4XBFA 1ZG1A 1U5TB 3TDZC 4I01A 3K0LA 4U6EA 2GU6A 4S2TP 1SD6A 2EFQA 1WWXA 1B9MA 3TO7A 2MATA 2YSRA 4HDVA 1T6SA 2D2WA 1DDNA 1G4DA 3KETA 4XSXF 1ZREA 5LBQA 2UZKA 2CO5A 2GG0A 2HKOA 5AONA 1DP7P 5CYVA 2QLZA 1QZZA 3F6OA 4RGZ1 1JXSA 1HQCA 2BN7A 5HDNA 1FY7A 3CUQC 3MX6A 2B3LA 2MA3A 3H3ZA 1Z6TA 3CO7C 1FT9A 4HLXA 1E17A 2F5CA 2ZJ2A 1B6AA 1JAWA 3V4GA 2VOOA 2QQAA 3KZZA 3E5XA 2GXBA 3PFIA 2OQGA 3DV8A 4G94A 2GG2A 3RJPA 4UVCA 3DKWA 2CQKA 4LLLA 2QUFA 3VODA 5FLXK 3OV8A 2YPRA 1IUYA 3DF8A 2L4MA 3RKXA 1WL9A 2RVCA 1P2FA 2QM3A 2RNJA 3EYIA 2V1XA 1F9NA 2M45A 2Q96A 3M9AA 2JTVA 5D4RA 3IU8A 1TQIA 4KT5C 5TJJA 5EEGA 3T8TA 1XSVA 2KKOA 3LWFA 4WX9A 4L9TA 3U9GA 4FX0A 1R5HA 3K1MA 1ZARA 1HBXG 2GWRA 4BXUA 3R6SA 1W5SA 4YG2F 2H6CA 2GGCA 3HRTA 1XN7A 1FBQA 4KNYA 4LB6B 3RKYA 1J9IA 1J2XA 2PMUA 3NQOA 2UXNA 1ZRDA 2DQLA 5L3FA 4DNCA 3I53A 1P92A 3VFZA 3RPQA 3T0YA 2OZUA 1GHCA 2GU5A 3WGGA 5LHHA 1USSA 4IKRA 4U76A 2Z33A 2K86A 4G7ZF 1MJ9A 3QOPA 1KYWA 2ZSGA 4FO8A 5FB2A 5ICCA 4WXDA 2DTRA 1FX7A 1OYYA 2OA4A 3GFMA 2V3XA 1ONVA 4L0ZB 2FBHA 2R7FA 4HDUA 3D5LA 2J5PA 2QQ9A 2FQ3A 3PQJA 2F5EA 3IWZA 3GEZA 4KIGA 3ZN1A 1KGSA 4S04A 4R8HA 1ZG3A 1KU7A 1F5TA 1N51A 3I58A 3WU0A 1WQ2A 1XGMA 3TB5A 2BEOA 3FF5A 2MH2A 4EGYA 2HGCA 5CJ9A 3V7RA 4ETSA 4KYWA 4CHUA 2OD5A 1UB9A 2Z9OA 3FWEA 5D5VB 4RZZA 4N0BA 1HW1A 3PQKA 2P5VA 2FSWA 1BM9A 3FM3A 3HSFA 4LD5A 4ENJA 1RZ4A 2X0LA 5E17F 2W24A 2CGPA 2DO7A 3KLNA 3VEPA 4MEXF 1S6LA 2P5LC 4JUQA 3R61A 4GCVA 2NNNA 2W57A 1YW9A 4HV5A 1XGOA 4BHCA 2WV0A 3HSEA 1NHAA 5TRDA 2HKXA 1ZGAA 4KA4A 2PFBA 5LGUA 2H27A 3PKCA 2FF4A 2P5KA 4IRIA 4JK1X 3IL2A 4ZWPA 4UV8A 3ZMSA 4IU6A 3MQ0A 3L09A 5D5XB 4HF2A 3HHHA 2PLYA 2XAQA 3F21A 2P98A 1GXPA 4HOBA 4P96A 2LF8A 4GYGA 5D8LB 3ULQB 5IT3A 4P9UA 4BQAA 4ASNA 2DQRA 3LAJA 4MTDA 3SQNA 2B3KA 4OIPF 1T98A 2QQBA 5DYMA 3R0AA 1I5ZA 3O6BB 1T2KA 3PKBA 1W5TA 3I54A 1ZHFA 5L3DA 2A3SA 3T8RA 5FFXA 5LGNA 4RB0A 4IRGA 1OR7A 3WTUC 2VC0A 4BHPA 2RN7A 3E6CC 1TQPA 4I98B 3M7GA 2VONA 4ZYGA 4EJTA 2HOEA 4IKUA 2FRHA 5HLHA 2ISZA 3QP6A 1YS7A 4IPAA 2P99A 2CSOA 3RIRA 3G73A 3I59B 1S8NA 4H0EA 3DXJF 1WKMA 4UUVA 4Q48A 3F23A 5E8IA 5FCHA 5J8FA 1KYZA 3L24A 4P5OA 1G3SA 3IG4A 5BOXA 4Q4ZF 1D8KA 4AVPA 1ULYA 5CVJA 5HLIA 3ISPA 4EVIA 4RB3C 4MATA 2O6GE 2A68F 5ILUA 4R79A 1ZRFA 1KU2A 1REPC 2LNBA 4BHBA 2EA4A 2Q2EA 2PN6A 3GUDA 1P4WA 5BMZA 4M9SA 2EFPA 3P9IA 3M1EA 3ECOA 2Q8KA 4G7HF 3LQRA 2OBPA 1W2MA 4HLYA 5D6EA 1FYLA 1UCRA 1WY2A 2NQ7A 2E7WA 1IRGA 3S6BA 2EFWA 3TOAA 1LDKB 1SAXA 1ZAOA 5H20A 4LFUA 1FP1D 2GIVA 2Y75A 4KN7X 4BAYA 1QZYA 4G6DA 2F2EA 2NQ6A 1VTNC 4OIRF 3L7WA 4UV9A 2IA1A 4YFNF 5HDKA 1SFUA 2PG4A 1C23A 4KN4X 1J75A 3IRRA 3MZHA 1ZYRF 3TO6A 2BWSA 4MGRA 4KICA 1W7PA 1AOYA 2FU4A 3E3VA 3GVAA 2EV0A 1HKTA 2CWEA 2DI3A 3K1NA 2KRFA 3E6BA 3F8BA 3I0TA 3E6MA 1H0MA 3EDPA 1IXCA 3KP7A 4A0XA 1ZRCA 3PKEA 5D8KB 4FLIA 3M8EA 1KQ9A 3TOBA 2QBYB 1U8RA 3B02A 4PCQA 3JW4A 4U1BA 4RGRA 4Y13A 1YVMA 3RKWA 5FO5A 3HIFA 1O7FA 1HSJA 3VB2A 2ELHA 3O3KA 4U0VA 2GG5A 2L02A 4YFKF 1KA8A 2H94A 4EM2A 1B59A 1Z9CA 5LRRA 2GAUA 1L3LA 1Q1HA 3ABTA 2XGXA 1S7AA 1S29A 3J81Z 1WL6A 2HDCA 2IJLA 3D0SA 5E5BA 3C3WA 4M73A 3F8FA 1FC3A 3WE2A 5ILSA 2P9AA 3F22A 4OMZA 3KFWX 3GYHX 1C24A 2GU4A 3KP3A 2MLGA 4D0PA 2ACJA 5AIPA 2J5OA 1IN8A 4A12A 1QQIA 2M8EA 5FGMA 4KMUX 1XCBA 4HF1A 3KP4A 1MKMA 1LB2A 4PDKA 2C6YA 4K2EA 4B28A 5JHUA 1QXZA 1FZPB 1R36A 4I09A 1W7PB 4M72A 3SHFA 4HX7A 2Z3YA 2EJRA 1YG2A 1QXYA 5DDGA 1MDMB 3CLOA 3I4PA 4PGGA 2PMHA 5D4SA 2VBXA 4HV6A 4PV4A 4FLJA 1IN7A 2W85A 1XSXA 4BH9A 4YIFA 1OMIA 3GW2A 3MAJA 4ENKA 4WK8F 2PI0A 1IZ1A 3HUGA 5ILVA 3V7SA 1LVAA 2XKOA 3LA7A 1XMAA 1IN5A 1XB4A 4AIJA 2G7HA 4LLGF 1FLIA 3COAC 4LG0B 1U78A 1XDUA 4OIOF 1JGSA 2XIGA 4ESJA 5HLGA 4OU0A 1Z91A 4IKSA 2L01A 1Z6RA 4XRFA 1QPMA 2VT3A 2EFOA 3F8NA 3WTYC 3C7JA 3TQNA 1MJAA 1G3WA 2DK5A 2MLKA 1JHFA 1YW8A 4F7ZA 2CG4A 2VBZA 2QWWA 2KIUA 4L9JA 5ICEA 2UWMA 1TW3A 2QENA 5L3EA 4AD9A 4CGZA 1BC7C 3F6VA 1E2XA 1KP0A 2D45A 3GFJA 4A5MA 3P7NA 4BYYA 4DQ2A 1HKSA 4Y15A 2IVMA 4OIQF 4O5VA 4LLNA 4BNCA 2HTSA 3E97A 1CF7B 3C18A 5K1YA 1LQ1A 4R1HA 5ICFA 1ON1A 1UFMA 5HS8A 3U2RA 2E1CA 5CIKA 3QP5A 4M6XA 2EVCA 2CFXA 2P7CB 1C27A 3BJAA 2FBIA 2BYVE 3QU3A 2ISYA 4U7DA 1I27A 4ZH4F 1TW2A 2CW0F 2HR3A 3K69A 1P6RA 4I02A 1FPQA 4U6ZA 4NHJA 2BBYA 4HQMA 2NAZA 5IT9Z 4ZZLA 1AWCA 4YIIA 1XSDA 1GXQA 1LEBA 2P7VB 4A0ZA 2XV4S 1P4AA 1SFXA 5KVRA 5LGTA 3EYYA 3E5UA 3T5XA 2O61A 3CJNA 1G3TA 3DEUA 2HTJA 1A16A 1SFEA 1DPUA 1WRJA 2O8XA 1FSHA 3ZMDA 4EJOA 4ENMA 2IRFG 2GG3A 3J7AO 2GZ5A 2O03A 5F6FA 1WLRA 1CGPA 3EETA 5A2QK 1R00A 1F1ZA 3T1BA 4U6WA 2ZMEA 3BIQA 3WODF 3ZMUA 4LGWA 4YFXF 5DD8A 4EJUA 2AXLA 2V3ZA 1EV7A 4CICA 5J8CA 3ZPLA 3HRMA 5CDLA 1YS6A 2DFIA 3ABUA 2WC2A 1EH8A 3TAVA 3MATA 1QXWA 1OYWA 1A04A 2HQRA 2GU7A 4MTEA 3IKVA 4MHGA 1FBUA 3FMSA 1V3FA 1D5VA 2H09A 1B1BA 3S2WA 4HAMA 3SXYA 3RDIA 1J5YA 4AIHA 2EK5A 1Z05A 4ZZDA 2IT0A 2K7LA 2DLLA 2HS5A 2PQ8A 4HQEA 3KLOA 5DCFA 2YX4A 3PKDA 1BI3A 2M87A 3EUHA 2RQPA 3R4KA 3MCZA 4ZNGA 1WI9A 4S2RP 1OYIA 4MEYF 3ZN0A 3GWZA 2JRTA 4JBAA 3I59A 3MR1A 3L2CA 1ZG5A 3WGIA 3JSPA 1O57A 2DBBA 1RNLA 4E70A 3MWMA 1O3QA 2V9VA 2BGCA 3BDDA 5DCMA 3RTRA 1ZLKA 4HX8A 5JVTA 1PUEE 1FWZA 2F5FA 4RZYA 3DQVC 3JTHA 5H6QA 4L18B 2H6BA 2K02A 5HVQC 3G3ZA 1LNWA 1U2WA 3RPUA 4LK1F 3HTUA 4RAYA 3D27A 2GGBA 3RORA 3W6KB 2IW2A 1P4XA 4XLNF 3TDUC 2LKPA 1ZH5A 1U5TC 4FLLA 1XNZA 4S05A 2R7DA 1I1GA 3QU6A 4HYEA 3F8CA 2FNAA 4R60A 2V1DA 2IW5A 2FA5A 4LG0A 1PP7U 2A5YB 2FMYA 3WTTC 5D5UB 5LEKA 1U5TA 1KQ8A 4CDGA 2XUBA 5K5OA 2O3FA 3LA2A 2FBKA 1TBXA 1YQAA 5J6XA 4FT8A 3IKTA 4IDYA 4I7HA 2GTXA 5JI6A 4EM1A 2ZCWA 1K78A 3FX3A 4FHTA 3HOSA 5L3CA 2BE5F 4PZJA 2Z5UA 4IKTA 4L5JA 1IN4A 3KP6A 3MEXA 4U70A 3MFKA 3BZ6A 1TTYA 1T0FA 3JAMZ 1MATA 2BWYA 4S01A 4LB5A 3PKAA 5CVRA 4ESFA 3WGHA 3LQQA 4IHSA 1Y0UA 2V3YA 2BB7A 1HW2A 1YW7A 1S3JA 2ZNZA 4HF0A 2DW4A 4ON0A 2DAOA 4L0YB 2NYXA 1RI7A 4FX4A 4WXHA 5E1XA 4U6CA 2P8TA 2W25A 2KJCA 3NEUA 4MQ9F 2BHBA 2EVOA 4ESBA 1U6GA 1L0OC 2W84A 1YFHA 2HYFA 4WCGA 1R1VA 1TNSA 3IU7A 1R1TA 2ETHA 1TNTA 3H3UA 4U69A 1IXSB 2Y48A 2VE9A 1SD4A 4Q5SF 4KM3A 2VBYA 1S7OA 2UXXA 5CVVA 5DEQA 2QZ8A 1K78B 3HYIA 4A6EA 3CDHA 1DUXC