2GTXA

Structural basis of catalysis by mononuclear methionine aminopeptidase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
total genus 86
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gtxA00
2ADUA 4S2RP 1A16A 1XGSA 4U6CA 4U6ZA 2BB7A 3MATA 4S2TP 4ZWPA 4S00A 3IG4A 2HOWA 1WL9A 2BHCA 4FLKA 4FLJA 4IU6A 4U73A 5CIKA 4FKCA 5D6FA 5CDEA 4IKUA 3PKAA 4RZZA 4ZWUA 1QXWA 1XGOA 4RZYA 2GU4A 4MATA 4ZNGA 2EA4A 4U76A 1WL6A 2EVCA 2BWVA 2GU5A 3CTZA 2V6CA 3Q6DA 3S6BA 2DFIA 1C24A 4IF7A 1C23A 3IU9A 4QR8A 2BHDA 2BH3A 3PKBA 4FO8A 4ZWOA 1B59A 2Q93A 2P9AA 2Q95A 1WKMA 2EVOA 3FM3A 3D27A 2GGCA 4PNCA 2GU7A 5D6EA 2BHAA 2GG0A 4JUQA 3MR1A 2MATA 2GGBA 4U70A 1YVMA 3BIPA 2OAZA 3L7GA 2B3HA 2B3LA 2Q92A 5JI6A 1N51A 1C21A 1PV9A 5E5BA 2GG2A 4IKSA 1KP0A 1Y1NA 1W7VA 2GG7A 4B28A 2BWWA 4IKTA 4A6VA 1BN5A 4IKRA 1XGNA 4PV4A 1MATA 5FCHA 2BWXA 1QZYA 2BWTA 3CB6A 1C22A 5CLSA 1YW7A 2V3YA 2V3XA 1XGMA 5FCFA 2ZSGA 4IECA 1R5GA 4U71A 4OOKA 1WY2A 3BIQA 5JHUA 5CDLA 1QXZA 4IDYA 3CB5A 1B6AA 2GG3A 4U1BA 3TB5A 2BWYA 2BHBA 4Z7MA 1O0XA 4RGZ1 4U6WA 4U6EA 1WLRA 1W2MA 2EVMA 2GA2A 2NQ6A 2P99A 4FO7A 4EGEA 3TAVA 2BWUA 3IU8A 2GU6A 3FMQA 3FMRA 2OKNA 2GTXA 4R60A 2BN7A 3PKCA 4FUKA 3RORA 1CHMA 3BITA 3RVAA 1QXYA 3MX6A 1WBQA 1BOAA 2EA2A 4U6JA 5CDVA 5CE6A 1C27A 5JFRA 1WN1A 1YJ3A 1YW8A 2Q94A 2GG5A 2IW2A 1XNZA 1JAWA 4S01A 2GG9A 1YW9A 1R5HA 2NQ7A 4KM3A 4U69A 3PKDA 2Q8KA 1M35A 2G6PA 1R58A 1KQ9A 2GZ5A 4FLIA 4A6WA 2V3ZA 3L24A 4FLLA 4U75A 2P98A 3PKEA 2B3KA 2Q96A 5CNXA 4IPAA 3IU7A 1KQ0A 2BWSA 2GG8A 4HXXA
chains in the Genus database with same CATH superfamily
2ADUA 4S2RP 1A16A 1XGSA 4U6CA 4U6ZA 2BB7A 3MATA 4S2TP 4ZWPA 4S00A 3IG4A 2HOWA 1WL9A 2BHCA 4FLKA 4FLJA 4IU6A 4U73A 5CIKA 4FKCA 5D6FA 5CDEA 4IKUA 3PKAA 4RZZA 4ZWUA 1QXWA 1XGOA 4RZYA 2GU4A 4MATA 4ZNGA 2EA4A 4U76A 1WL6A 2EVCA 2BWVA 2GU5A 3CTZA 2V6CA 3Q6DA 3S6BA 2DFIA 1C24A 4IF7A 1C23A 3IU9A 4QR8A 2BHDA 2BH3A 3PKBA 4FO8A 4ZWOA 1B59A 2Q93A 2P9AA 2Q95A 1WKMA 2EVOA 3FM3A 3D27A 2GGCA 4PNCA 2GU7A 5D6EA 2BHAA 2GG0A 4JUQA 3MR1A 2MATA 2GGBA 4U70A 1YVMA 3BIPA 2OAZA 3L7GA 2B3HA 2B3LA 2Q92A 5JI6A 1N51A 1C21A 1PV9A 5E5BA 2GG2A 4IKSA 1KP0A 1Y1NA 1W7VA 2GG7A 4B28A 2BWWA 4IKTA 4A6VA 1BN5A 4IKRA 1XGNA 4PV4A 1MATA 5FCHA 2BWXA 1QZYA 2BWTA 3CB6A 1C22A 5CLSA 1YW7A 2V3YA 2V3XA 1XGMA 5FCFA 2ZSGA 4IECA 1R5GA 4U71A 4OOKA 1WY2A 3BIQA 5JHUA 5CDLA 1QXZA 4IDYA 3CB5A 1B6AA 2GG3A 4U1BA 3TB5A 2BWYA 2BHBA 4Z7MA 1O0XA 4RGZ1 4U6WA 4U6EA 1WLRA 1W2MA 2EVMA 2GA2A 2NQ6A 2P99A 4FO7A 4EGEA 3TAVA 2BWUA 3IU8A 2GU6A 3FMQA 3FMRA 2OKNA 2GTXA 4R60A 2BN7A 3PKCA 4FUKA 3RORA 1CHMA 3BITA 3RVAA 1QXYA 3MX6A 1WBQA 1BOAA 2EA2A 4U6JA 5CDVA 5CE6A 1C27A 5JFRA 1WN1A 1YJ3A 1YW8A 2Q94A 2GG5A 2IW2A 1XNZA 1JAWA 4S01A 2GG9A 1YW9A 1R5HA 2NQ7A 4KM3A 4U69A 3PKDA 2Q8KA 1M35A 2G6PA 1R58A 1KQ9A 2GZ5A 4FLIA 4A6WA 2V3ZA 3L24A 4FLLA 4U75A 2P98A 3PKEA 2B3KA 2Q96A 5CNXA 4IPAA 3IU7A 1KQ0A 2BWSA 2GG8A 4HXXA
chains in the Genus database with same CATH topology
2ADUA 4S2RP 1A16A 1XGSA 4U6CA 4U6ZA 2BB7A 3MATA 4S2TP 4ZWPA 4S00A 3IG4A 2HOWA 1WL9A 2BHCA 4FLKA 4FLJA 4IU6A 4U73A 5CIKA 4FKCA 5D6FA 5CDEA 4IKUA 3PKAA 4RZZA 4ZWUA 1QXWA 1XGOA 4RZYA 2GU4A 4MATA 4ZNGA 2EA4A 4U76A 1WL6A 2EVCA 2BWVA 2GU5A 3CTZA 2V6CA 3Q6DA 3S6BA 2DFIA 1C24A 4IF7A 1C23A 3IU9A 4QR8A 2BHDA 2BH3A 3PKBA 4FO8A 4ZWOA 1B59A 2Q93A 2P9AA 2Q95A 1WKMA 2EVOA 3FM3A 3D27A 2GGCA 4PNCA 2GU7A 5D6EA 2BHAA 2GG0A 4JUQA 3MR1A 2MATA 2GGBA 4U70A 1YVMA 3BIPA 2OAZA 3L7GA 2B3HA 2B3LA 2Q92A 5JI6A 1N51A 1C21A 1PV9A 5E5BA 2GG2A 4IKSA 1KP0A 1Y1NA 1W7VA 2GG7A 4B28A 2BWWA 4IKTA 4A6VA 1BN5A 4IKRA 1XGNA 4PV4A 1MATA 5FCHA 2BWXA 1QZYA 2BWTA 3CB6A 1C22A 5CLSA 1YW7A 2V3YA 2V3XA 1XGMA 5FCFA 2ZSGA 4IECA 1R5GA 4U71A 4OOKA 1WY2A 3BIQA 5JHUA 5CDLA 1QXZA 4IDYA 3CB5A 1B6AA 2GG3A 4U1BA 3TB5A 2BWYA 2BHBA 4Z7MA 1O0XA 4RGZ1 4U6WA 4U6EA 1WLRA 1W2MA 2EVMA 2GA2A 2NQ6A 2P99A 4FO7A 4EGEA 3TAVA 2BWUA 3IU8A 2GU6A 3FMQA 3FMRA 2OKNA 2GTXA 4R60A 2BN7A 3PKCA 4FUKA 3RORA 1CHMA 3BITA 3RVAA 1QXYA 3MX6A 1WBQA 1BOAA 2EA2A 4U6JA 5CDVA 5CE6A 1C27A 5JFRA 1WN1A 1YJ3A 1YW8A 2Q94A 2GG5A 2IW2A 1XNZA 1JAWA 4S01A 2GG9A 1YW9A 1R5HA 2NQ7A 4KM3A 4U69A 3PKDA 2Q8KA 1M35A 2G6PA 1R58A 1KQ9A 2GZ5A 4FLIA 4A6WA 2V3ZA 3L24A 4FLLA 4U75A 2P98A 3PKEA 2B3KA 2Q96A 5CNXA 4IPAA 3IU7A 1KQ0A 2BWSA 2GG8A 4HXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADU A;  4S2R P;  1A16 A;  1XGS A;  4U6C A;  4U6Z A;  2BB7 A;  3MAT A;  4S2T P;  4ZWP A;  4S00 A;  3IG4 A;  2HOW A;  1WL9 A;  2BHC A;  4FLK A;  4FLJ A;  4IU6 A;  4U73 A;  5CIK A;  4FKC A;  5D6F A;  5CDE A;  4IKU A;  3PKA A;  4RZZ A;  4ZWU A;  1QXW A;  1XGO A;  4RZY A;  2GU4 A;  4MAT A;  4ZNG A;  2EA4 A;  4U76 A;  1WL6 A;  2EVC A;  2BWV A;  2GU5 A;  3CTZ A;  2V6C A;  3Q6D A;  3S6B A;  2DFI A;  1C24 A;  4IF7 A;  1C23 A;  3IU9 A;  4QR8 A;  2BHD A;  2BH3 A;  3PKB A;  4FO8 A;  4ZWO A;  1B59 A;  2Q93 A;  2P9A A;  2Q95 A;  1WKM A;  2EVO A;  3FM3 A;  3D27 A;  2GGC A;  4PNC A;  2GU7 A;  5D6E A;  2BHA A;  2GG0 A;  4JUQ A;  3MR1 A;  2MAT A;  2GGB A;  4U70 A;  1YVM A;  3BIP A;  2OAZ A;  3L7G A;  2B3H A;  2B3L A;  2Q92 A;  5JI6 A;  1N51 A;  1C21 A;  1PV9 A;  5E5B A;  2GG2 A;  4IKS A;  1KP0 A;  1Y1N A;  1W7V A;  2GG7 A;  4B28 A;  2BWW A;  4IKT A;  4A6V A;  1BN5 A;  4IKR A;  1XGN A;  4PV4 A;  1MAT A;  5FCH A;  2BWX A;  1QZY A;  2BWT A;  3CB6 A;  1C22 A;  5CLS A;  1YW7 A;  2V3Y A;  2V3X A;  1XGM A;  5FCF A;  2ZSG A;  4IEC A;  1R5G A;  4U71 A;  4OOK A;  1WY2 A;  3BIQ A;  5JHU A;  5CDL A;  1QXZ A;  4IDY A;  3CB5 A;  1B6A A;  2GG3 A;  4U1B A;  3TB5 A;  2BWY A;  2BHB A;  4Z7M A;  1O0X A;  4RGZ 1;  4U6W A;  4U6E A;  1WLR A;  1W2M A;  2EVM A;  2GA2 A;  2NQ6 A;  2P99 A;  4FO7 A;  4EGE A;  3TAV A;  2BWU A;  3IU8 A;  2GU6 A;  3FMQ A;  3FMR A;  2OKN A;  2GTX A;  4R60 A;  2BN7 A;  3PKC A;  4FUK A;  3ROR A;  1CHM A;  3BIT A;  3RVA A;  1QXY A;  3MX6 A;  1WBQ A;  1BOA A;  2EA2 A;  4U6J A;  5CDV A;  5CE6 A;  1C27 A;  5JFR A;  1WN1 A;  1YJ3 A;  1YW8 A;  2Q94 A;  2GG5 A;  2IW2 A;  1XNZ A;  1JAW A;  4S01 A;  2GG9 A;  1YW9 A;  1R5H A;  2NQ7 A;  4KM3 A;  4U69 A;  3PKD A;  2Q8K A;  1M35 A;  2G6P A;  1R58 A;  1KQ9 A;  2GZ5 A;  4FLI A;  4A6W A;  2V3Z A;  3L24 A;  4FLL A;  4U75 A;  2P98 A;  3PKE A;  2B3K A;  2Q96 A;  5CNX A;  4IPA A;  3IU7 A;  1KQ0 A;  2BWS A;  2GG8 A;  4HXX A; 
#chains in the Genus database with same CATH topology
 2ADU A;  4S2R P;  1A16 A;  1XGS A;  4U6C A;  4U6Z A;  2BB7 A;  3MAT A;  4S2T P;  4ZWP A;  4S00 A;  3IG4 A;  2HOW A;  1WL9 A;  2BHC A;  4FLK A;  4FLJ A;  4IU6 A;  4U73 A;  5CIK A;  4FKC A;  5D6F A;  5CDE A;  4IKU A;  3PKA A;  4RZZ A;  4ZWU A;  1QXW A;  1XGO A;  4RZY A;  2GU4 A;  4MAT A;  4ZNG A;  2EA4 A;  4U76 A;  1WL6 A;  2EVC A;  2BWV A;  2GU5 A;  3CTZ A;  2V6C A;  3Q6D A;  3S6B A;  2DFI A;  1C24 A;  4IF7 A;  1C23 A;  3IU9 A;  4QR8 A;  2BHD A;  2BH3 A;  3PKB A;  4FO8 A;  4ZWO A;  1B59 A;  2Q93 A;  2P9A A;  2Q95 A;  1WKM A;  2EVO A;  3FM3 A;  3D27 A;  2GGC A;  4PNC A;  2GU7 A;  5D6E A;  2BHA A;  2GG0 A;  4JUQ A;  3MR1 A;  2MAT A;  2GGB A;  4U70 A;  1YVM A;  3BIP A;  2OAZ A;  3L7G A;  2B3H A;  2B3L A;  2Q92 A;  5JI6 A;  1N51 A;  1C21 A;  1PV9 A;  5E5B A;  2GG2 A;  4IKS A;  1KP0 A;  1Y1N A;  1W7V A;  2GG7 A;  4B28 A;  2BWW A;  4IKT A;  4A6V A;  1BN5 A;  4IKR A;  1XGN A;  4PV4 A;  1MAT A;  5FCH A;  2BWX A;  1QZY A;  2BWT A;  3CB6 A;  1C22 A;  5CLS A;  1YW7 A;  2V3Y A;  2V3X A;  1XGM A;  5FCF A;  2ZSG A;  4IEC A;  1R5G A;  4U71 A;  4OOK A;  1WY2 A;  3BIQ A;  5JHU A;  5CDL A;  1QXZ A;  4IDY A;  3CB5 A;  1B6A A;  2GG3 A;  4U1B A;  3TB5 A;  2BWY A;  2BHB A;  4Z7M A;  1O0X A;  4RGZ 1;  4U6W A;  4U6E A;  1WLR A;  1W2M A;  2EVM A;  2GA2 A;  2NQ6 A;  2P99 A;  4FO7 A;  4EGE A;  3TAV A;  2BWU A;  3IU8 A;  2GU6 A;  3FMQ A;  3FMR A;  2OKN A;  2GTX A;  4R60 A;  2BN7 A;  3PKC A;  4FUK A;  3ROR A;  1CHM A;  3BIT A;  3RVA A;  1QXY A;  3MX6 A;  1WBQ A;  1BOA A;  2EA2 A;  4U6J A;  5CDV A;  5CE6 A;  1C27 A;  5JFR A;  1WN1 A;  1YJ3 A;  1YW8 A;  2Q94 A;  2GG5 A;  2IW2 A;  1XNZ A;  1JAW A;  4S01 A;  2GG9 A;  1YW9 A;  1R5H A;  2NQ7 A;  4KM3 A;  4U69 A;  3PKD A;  2Q8K A;  1M35 A;  2G6P A;  1R58 A;  1KQ9 A;  2GZ5 A;  4FLI A;  4A6W A;  2V3Z A;  3L24 A;  4FLL A;  4U75 A;  2P98 A;  3PKE A;  2B3K A;  2Q96 A;  5CNX A;  4IPA A;  3IU7 A;  1KQ0 A;  2BWS A;  2GG8 A;  4HXX A; 
#chains in the Genus database with same CATH homology
 2ADU A;  4S2R P;  1A16 A;  1XGS A;  4U6C A;  4U6Z A;  2BB7 A;  3MAT A;  4S2T P;  4ZWP A;  4S00 A;  3IG4 A;  2HOW A;  1WL9 A;  2BHC A;  4FLK A;  4FLJ A;  4IU6 A;  4U73 A;  5CIK A;  4FKC A;  5D6F A;  5CDE A;  4IKU A;  3PKA A;  4RZZ A;  4ZWU A;  1QXW A;  1XGO A;  4RZY A;  2GU4 A;  4MAT A;  4ZNG A;  2EA4 A;  4U76 A;  1WL6 A;  2EVC A;  2BWV A;  2GU5 A;  3CTZ A;  2V6C A;  3Q6D A;  3S6B A;  2DFI A;  1C24 A;  4IF7 A;  1C23 A;  3IU9 A;  4QR8 A;  2BHD A;  2BH3 A;  3PKB A;  4FO8 A;  4ZWO A;  1B59 A;  2Q93 A;  2P9A A;  2Q95 A;  1WKM A;  2EVO A;  3FM3 A;  3D27 A;  2GGC A;  4PNC A;  2GU7 A;  5D6E A;  2BHA A;  2GG0 A;  4JUQ A;  3MR1 A;  2MAT A;  2GGB A;  4U70 A;  1YVM A;  3BIP A;  2OAZ A;  3L7G A;  2B3H A;  2B3L A;  2Q92 A;  5JI6 A;  1N51 A;  1C21 A;  1PV9 A;  5E5B A;  2GG2 A;  4IKS A;  1KP0 A;  1Y1N A;  1W7V A;  2GG7 A;  4B28 A;  2BWW A;  4IKT A;  4A6V A;  1BN5 A;  4IKR A;  1XGN A;  4PV4 A;  1MAT A;  5FCH A;  2BWX A;  1QZY A;  2BWT A;  3CB6 A;  1C22 A;  5CLS A;  1YW7 A;  2V3Y A;  2V3X A;  1XGM A;  5FCF A;  2ZSG A;  4IEC A;  1R5G A;  4U71 A;  4OOK A;  1WY2 A;  3BIQ A;  5JHU A;  5CDL A;  1QXZ A;  4IDY A;  3CB5 A;  1B6A A;  2GG3 A;  4U1B A;  3TB5 A;  2BWY A;  2BHB A;  4Z7M A;  1O0X A;  4RGZ 1;  4U6W A;  4U6E A;  1WLR A;  1W2M A;  2EVM A;  2GA2 A;  2NQ6 A;  2P99 A;  4FO7 A;  4EGE A;  3TAV A;  2BWU A;  3IU8 A;  2GU6 A;  3FMQ A;  3FMR A;  2OKN A;  2GTX A;  4R60 A;  2BN7 A;  3PKC A;  4FUK A;  3ROR A;  1CHM A;  3BIT A;  3RVA A;  1QXY A;  3MX6 A;  1WBQ A;  1BOA A;  2EA2 A;  4U6J A;  5CDV A;  5CE6 A;  1C27 A;  5JFR A;  1WN1 A;  1YJ3 A;  1YW8 A;  2Q94 A;  2GG5 A;  2IW2 A;  1XNZ A;  1JAW A;  4S01 A;  2GG9 A;  1YW9 A;  1R5H A;  2NQ7 A;  4KM3 A;  4U69 A;  3PKD A;  2Q8K A;  1M35 A;  2G6P A;  1R58 A;  1KQ9 A;  2GZ5 A;  4FLI A;  4A6W A;  2V3Z A;  3L24 A;  4FLL A;  4U75 A;  2P98 A;  3PKE A;  2B3K A;  2Q96 A;  5CNX A;  4IPA A;  3IU7 A;  1KQ0 A;  2BWS A;  2GG8 A;  4HXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...