2GTXA

Structural basis of catalysis by mononuclear methionine aminopeptidase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 86
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gtxA00
2GG2A 2IW2A 4U71A 2GU6A 1QXYA 2BHDA 2ZSGA 4U1BA 4ZWUA 1XNZA 2BB7A 2P9AA 3FM3A 1CHMA 2Q96A 3MATA 5CE6A 4PV4A 4U6EA 5JI6A 2Q93A 2V3ZA 4U6CA 5FCHA 1O0XA 2EA4A 2BHCA 5E5BA 2EVCA 2BHBA 1C24A 4S01A 4U6WA 2Q94A 2GG5A 5CDLA 3PKDA 1BN5A 2GG3A 3D27A 3MX6A 1QZYA 3IU7A 5JFRA 5JHUA 2DFIA 2GU5A 2ADUA 1N51A 2G6PA 1A16A 2GG9A 2Q8KA 5CDEA 4OOKA 1WBQA 4JUQA 2V6CA 4FLIA 4S2TP 2GG8A 5D6FA 2GA2A 4A6WA 4A6VA 2BWYA 4IDYA 4R60A 3PKAA 2P98A 4B28A 2MATA 4Z7MA 1PV9A 1XGSA 3FMRA 2BH3A 4ZWOA 1QXWA 1KQ9A 4PNCA 1WY2A 3TB5A 4U76A 5CIKA 1WKMA 4FO7A 2BWVA 4HXXA 1XGOA 3CB6A 4EGEA 3CB5A 1B59A 2BHAA 5FCFA 2NQ6A 1MATA 1XGMA 4IKSA 3CTZA 1KQ0A 3MR1A 2GU4A 2B3HA 5CDVA 1WN1A 2GZ5A 4RZYA 2GU7A 3L24A 1C21A 3PKEA 1YW9A 1XGNA 2HOWA 2OKNA 4FKCA 5D6EA 4U6ZA 3RORA 1WL9A 2BWWA 4U70A 1R5HA 4IPAA 1YJ3A 2BWSA 4ZWPA 1YVMA 3RVAA 2V3XA 2EVOA 1C23A 1KP0A 1R58A 2B3KA 2BWTA 2OAZA 3PKBA 2EA2A 3Q6DA 4IU6A 4U69A 2BN7A 3FMQA 4FUKA 1WLRA 2B3LA 2GG0A 4ZNGA 3IG4A 4IECA 1YW8A 1C22A 4RGZ1 2BWUA 4U6JA 1C27A 1JAWA 4FLJA 2P99A 2GGBA 4FLLA 3PKCA 1B6AA 5CLSA 4FO8A 2NQ7A 3IU9A 2Q95A 2BWXA 3TAVA 2GGCA 4MATA 3BITA 3BIPA 4IKRA 4QR8A 4IKTA 1W7VA 1BOAA 5CNXA 2GTXA 3IU8A 4KM3A 4S00A 3BIQA 4U75A 3S6BA 1M35A 2GG7A 4S2RP 4RZZA 4IF7A 1Y1NA 1WL6A 1QXZA 3L7GA 1W2MA 1R5GA 4IKUA 2V3YA 2EVMA 1YW7A 2Q92A 4U73A 4FLKA
chains in the Genus database with same CATH superfamily
2GG2A 2IW2A 4U71A 2GU6A 1QXYA 2BHDA 2ZSGA 4U1BA 4ZWUA 1XNZA 2BB7A 2P9AA 3FM3A 1CHMA 2Q96A 3MATA 5CE6A 4PV4A 4U6EA 5JI6A 2Q93A 2V3ZA 4U6CA 5FCHA 1O0XA 2EA4A 2BHCA 5E5BA 2EVCA 2BHBA 1C24A 4S01A 4U6WA 2Q94A 2GG5A 5CDLA 3PKDA 1BN5A 2GG3A 3D27A 3MX6A 1QZYA 3IU7A 5JFRA 5JHUA 2DFIA 2GU5A 2ADUA 1N51A 2G6PA 1A16A 2GG9A 2Q8KA 5CDEA 4OOKA 1WBQA 4JUQA 2V6CA 4FLIA 4S2TP 2GG8A 5D6FA 2GA2A 4A6WA 4A6VA 2BWYA 4IDYA 4R60A 3PKAA 2P98A 4B28A 2MATA 4Z7MA 1PV9A 1XGSA 3FMRA 2BH3A 4ZWOA 1QXWA 1KQ9A 4PNCA 1WY2A 3TB5A 4U76A 5CIKA 1WKMA 4FO7A 2BWVA 4HXXA 1XGOA 3CB6A 4EGEA 3CB5A 1B59A 2BHAA 5FCFA 2NQ6A 1MATA 1XGMA 4IKSA 3CTZA 1KQ0A 3MR1A 2GU4A 2B3HA 5CDVA 1WN1A 2GZ5A 4RZYA 2GU7A 3L24A 1C21A 3PKEA 1YW9A 1XGNA 2HOWA 2OKNA 4FKCA 5D6EA 4U6ZA 3RORA 1WL9A 2BWWA 4U70A 1R5HA 4IPAA 1YJ3A 2BWSA 4ZWPA 1YVMA 3RVAA 2V3XA 2EVOA 1C23A 1KP0A 1R58A 2B3KA 2BWTA 2OAZA 3PKBA 2EA2A 3Q6DA 4IU6A 4U69A 2BN7A 3FMQA 4FUKA 1WLRA 2B3LA 2GG0A 4ZNGA 3IG4A 4IECA 1YW8A 1C22A 4RGZ1 2BWUA 4U6JA 1C27A 1JAWA 4FLJA 2P99A 2GGBA 4FLLA 3PKCA 1B6AA 5CLSA 4FO8A 2NQ7A 3IU9A 2Q95A 2BWXA 3TAVA 2GGCA 4MATA 3BITA 3BIPA 4IKRA 4QR8A 4IKTA 1W7VA 1BOAA 5CNXA 2GTXA 3IU8A 4KM3A 4S00A 3BIQA 4U75A 3S6BA 1M35A 2GG7A 4S2RP 4RZZA 4IF7A 1Y1NA 1WL6A 1QXZA 3L7GA 1W2MA 1R5GA 4IKUA 2V3YA 2EVMA 1YW7A 2Q92A 4U73A 4FLKA
chains in the Genus database with same CATH topology
2GG2A 2IW2A 4U71A 2GU6A 1QXYA 2BHDA 2ZSGA 4U1BA 4ZWUA 1XNZA 2BB7A 2P9AA 3FM3A 1CHMA 2Q96A 3MATA 5CE6A 4PV4A 4U6EA 5JI6A 2Q93A 2V3ZA 4U6CA 5FCHA 1O0XA 2EA4A 2BHCA 5E5BA 2EVCA 2BHBA 1C24A 4S01A 4U6WA 2Q94A 2GG5A 5CDLA 3PKDA 1BN5A 2GG3A 3D27A 3MX6A 1QZYA 3IU7A 5JFRA 5JHUA 2DFIA 2GU5A 2ADUA 1N51A 2G6PA 1A16A 2GG9A 2Q8KA 5CDEA 4OOKA 1WBQA 4JUQA 2V6CA 4FLIA 4S2TP 2GG8A 5D6FA 2GA2A 4A6WA 4A6VA 2BWYA 4IDYA 4R60A 3PKAA 2P98A 4B28A 2MATA 4Z7MA 1PV9A 1XGSA 3FMRA 2BH3A 4ZWOA 1QXWA 1KQ9A 4PNCA 1WY2A 3TB5A 4U76A 5CIKA 1WKMA 4FO7A 2BWVA 4HXXA 1XGOA 3CB6A 4EGEA 3CB5A 1B59A 2BHAA 5FCFA 2NQ6A 1MATA 1XGMA 4IKSA 3CTZA 1KQ0A 3MR1A 2GU4A 2B3HA 5CDVA 1WN1A 2GZ5A 4RZYA 2GU7A 3L24A 1C21A 3PKEA 1YW9A 1XGNA 2HOWA 2OKNA 4FKCA 5D6EA 4U6ZA 3RORA 1WL9A 2BWWA 4U70A 1R5HA 4IPAA 1YJ3A 2BWSA 4ZWPA 1YVMA 3RVAA 2V3XA 2EVOA 1C23A 1KP0A 1R58A 2B3KA 2BWTA 2OAZA 3PKBA 2EA2A 3Q6DA 4IU6A 4U69A 2BN7A 3FMQA 4FUKA 1WLRA 2B3LA 2GG0A 4ZNGA 3IG4A 4IECA 1YW8A 1C22A 4RGZ1 2BWUA 4U6JA 1C27A 1JAWA 4FLJA 2P99A 2GGBA 4FLLA 3PKCA 1B6AA 5CLSA 4FO8A 2NQ7A 3IU9A 2Q95A 2BWXA 3TAVA 2GGCA 4MATA 3BITA 3BIPA 4IKRA 4QR8A 4IKTA 1W7VA 1BOAA 5CNXA 2GTXA 3IU8A 4KM3A 4S00A 3BIQA 4U75A 3S6BA 1M35A 2GG7A 4S2RP 4RZZA 4IF7A 1Y1NA 1WL6A 1QXZA 3L7GA 1W2MA 1R5GA 4IKUA 2V3YA 2EVMA 1YW7A 2Q92A 4U73A 4FLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG2 A;  2IW2 A;  4U71 A;  2GU6 A;  1QXY A;  2BHD A;  2ZSG A;  4U1B A;  4ZWU A;  1XNZ A;  2BB7 A;  2P9A A;  3FM3 A;  1CHM A;  2Q96 A;  3MAT A;  5CE6 A;  4PV4 A;  4U6E A;  5JI6 A;  2Q93 A;  2V3Z A;  4U6C A;  5FCH A;  1O0X A;  2EA4 A;  2BHC A;  5E5B A;  2EVC A;  2BHB A;  1C24 A;  4S01 A;  4U6W A;  2Q94 A;  2GG5 A;  5CDL A;  3PKD A;  1BN5 A;  2GG3 A;  3D27 A;  3MX6 A;  1QZY A;  3IU7 A;  5JFR A;  5JHU A;  2DFI A;  2GU5 A;  2ADU A;  1N51 A;  2G6P A;  1A16 A;  2GG9 A;  2Q8K A;  5CDE A;  4OOK A;  1WBQ A;  4JUQ A;  2V6C A;  4FLI A;  4S2T P;  2GG8 A;  5D6F A;  2GA2 A;  4A6W A;  4A6V A;  2BWY A;  4IDY A;  4R60 A;  3PKA A;  2P98 A;  4B28 A;  2MAT A;  4Z7M A;  1PV9 A;  1XGS A;  3FMR A;  2BH3 A;  4ZWO A;  1QXW A;  1KQ9 A;  4PNC A;  1WY2 A;  3TB5 A;  4U76 A;  5CIK A;  1WKM A;  4FO7 A;  2BWV A;  4HXX A;  1XGO A;  3CB6 A;  4EGE A;  3CB5 A;  1B59 A;  2BHA A;  5FCF A;  2NQ6 A;  1MAT A;  1XGM A;  4IKS A;  3CTZ A;  1KQ0 A;  3MR1 A;  2GU4 A;  2B3H A;  5CDV A;  1WN1 A;  2GZ5 A;  4RZY A;  2GU7 A;  3L24 A;  1C21 A;  3PKE A;  1YW9 A;  1XGN A;  2HOW A;  2OKN A;  4FKC A;  5D6E A;  4U6Z A;  3ROR A;  1WL9 A;  2BWW A;  4U70 A;  1R5H A;  4IPA A;  1YJ3 A;  2BWS A;  4ZWP A;  1YVM A;  3RVA A;  2V3X A;  2EVO A;  1C23 A;  1KP0 A;  1R58 A;  2B3K A;  2BWT A;  2OAZ A;  3PKB A;  2EA2 A;  3Q6D A;  4IU6 A;  4U69 A;  2BN7 A;  3FMQ A;  4FUK A;  1WLR A;  2B3L A;  2GG0 A;  4ZNG A;  3IG4 A;  4IEC A;  1YW8 A;  1C22 A;  4RGZ 1;  2BWU A;  4U6J A;  1C27 A;  1JAW A;  4FLJ A;  2P99 A;  2GGB A;  4FLL A;  3PKC A;  1B6A A;  5CLS A;  4FO8 A;  2NQ7 A;  3IU9 A;  2Q95 A;  2BWX A;  3TAV A;  2GGC A;  4MAT A;  3BIT A;  3BIP A;  4IKR A;  4QR8 A;  4IKT A;  1W7V A;  1BOA A;  5CNX A;  2GTX A;  3IU8 A;  4KM3 A;  4S00 A;  3BIQ A;  4U75 A;  3S6B A;  1M35 A;  2GG7 A;  4S2R P;  4RZZ A;  4IF7 A;  1Y1N A;  1WL6 A;  1QXZ A;  3L7G A;  1W2M A;  1R5G A;  4IKU A;  2V3Y A;  2EVM A;  1YW7 A;  2Q92 A;  4U73 A;  4FLK A; 
#chains in the Genus database with same CATH topology
 2GG2 A;  2IW2 A;  4U71 A;  2GU6 A;  1QXY A;  2BHD A;  2ZSG A;  4U1B A;  4ZWU A;  1XNZ A;  2BB7 A;  2P9A A;  3FM3 A;  1CHM A;  2Q96 A;  3MAT A;  5CE6 A;  4PV4 A;  4U6E A;  5JI6 A;  2Q93 A;  2V3Z A;  4U6C A;  5FCH A;  1O0X A;  2EA4 A;  2BHC A;  5E5B A;  2EVC A;  2BHB A;  1C24 A;  4S01 A;  4U6W A;  2Q94 A;  2GG5 A;  5CDL A;  3PKD A;  1BN5 A;  2GG3 A;  3D27 A;  3MX6 A;  1QZY A;  3IU7 A;  5JFR A;  5JHU A;  2DFI A;  2GU5 A;  2ADU A;  1N51 A;  2G6P A;  1A16 A;  2GG9 A;  2Q8K A;  5CDE A;  4OOK A;  1WBQ A;  4JUQ A;  2V6C A;  4FLI A;  4S2T P;  2GG8 A;  5D6F A;  2GA2 A;  4A6W A;  4A6V A;  2BWY A;  4IDY A;  4R60 A;  3PKA A;  2P98 A;  4B28 A;  2MAT A;  4Z7M A;  1PV9 A;  1XGS A;  3FMR A;  2BH3 A;  4ZWO A;  1QXW A;  1KQ9 A;  4PNC A;  1WY2 A;  3TB5 A;  4U76 A;  5CIK A;  1WKM A;  4FO7 A;  2BWV A;  4HXX A;  1XGO A;  3CB6 A;  4EGE A;  3CB5 A;  1B59 A;  2BHA A;  5FCF A;  2NQ6 A;  1MAT A;  1XGM A;  4IKS A;  3CTZ A;  1KQ0 A;  3MR1 A;  2GU4 A;  2B3H A;  5CDV A;  1WN1 A;  2GZ5 A;  4RZY A;  2GU7 A;  3L24 A;  1C21 A;  3PKE A;  1YW9 A;  1XGN A;  2HOW A;  2OKN A;  4FKC A;  5D6E A;  4U6Z A;  3ROR A;  1WL9 A;  2BWW A;  4U70 A;  1R5H A;  4IPA A;  1YJ3 A;  2BWS A;  4ZWP A;  1YVM A;  3RVA A;  2V3X A;  2EVO A;  1C23 A;  1KP0 A;  1R58 A;  2B3K A;  2BWT A;  2OAZ A;  3PKB A;  2EA2 A;  3Q6D A;  4IU6 A;  4U69 A;  2BN7 A;  3FMQ A;  4FUK A;  1WLR A;  2B3L A;  2GG0 A;  4ZNG A;  3IG4 A;  4IEC A;  1YW8 A;  1C22 A;  4RGZ 1;  2BWU A;  4U6J A;  1C27 A;  1JAW A;  4FLJ A;  2P99 A;  2GGB A;  4FLL A;  3PKC A;  1B6A A;  5CLS A;  4FO8 A;  2NQ7 A;  3IU9 A;  2Q95 A;  2BWX A;  3TAV A;  2GGC A;  4MAT A;  3BIT A;  3BIP A;  4IKR A;  4QR8 A;  4IKT A;  1W7V A;  1BOA A;  5CNX A;  2GTX A;  3IU8 A;  4KM3 A;  4S00 A;  3BIQ A;  4U75 A;  3S6B A;  1M35 A;  2GG7 A;  4S2R P;  4RZZ A;  4IF7 A;  1Y1N A;  1WL6 A;  1QXZ A;  3L7G A;  1W2M A;  1R5G A;  4IKU A;  2V3Y A;  2EVM A;  1YW7 A;  2Q92 A;  4U73 A;  4FLK A; 
#chains in the Genus database with same CATH homology
 2GG2 A;  2IW2 A;  4U71 A;  2GU6 A;  1QXY A;  2BHD A;  2ZSG A;  4U1B A;  4ZWU A;  1XNZ A;  2BB7 A;  2P9A A;  3FM3 A;  1CHM A;  2Q96 A;  3MAT A;  5CE6 A;  4PV4 A;  4U6E A;  5JI6 A;  2Q93 A;  2V3Z A;  4U6C A;  5FCH A;  1O0X A;  2EA4 A;  2BHC A;  5E5B A;  2EVC A;  2BHB A;  1C24 A;  4S01 A;  4U6W A;  2Q94 A;  2GG5 A;  5CDL A;  3PKD A;  1BN5 A;  2GG3 A;  3D27 A;  3MX6 A;  1QZY A;  3IU7 A;  5JFR A;  5JHU A;  2DFI A;  2GU5 A;  2ADU A;  1N51 A;  2G6P A;  1A16 A;  2GG9 A;  2Q8K A;  5CDE A;  4OOK A;  1WBQ A;  4JUQ A;  2V6C A;  4FLI A;  4S2T P;  2GG8 A;  5D6F A;  2GA2 A;  4A6W A;  4A6V A;  2BWY A;  4IDY A;  4R60 A;  3PKA A;  2P98 A;  4B28 A;  2MAT A;  4Z7M A;  1PV9 A;  1XGS A;  3FMR A;  2BH3 A;  4ZWO A;  1QXW A;  1KQ9 A;  4PNC A;  1WY2 A;  3TB5 A;  4U76 A;  5CIK A;  1WKM A;  4FO7 A;  2BWV A;  4HXX A;  1XGO A;  3CB6 A;  4EGE A;  3CB5 A;  1B59 A;  2BHA A;  5FCF A;  2NQ6 A;  1MAT A;  1XGM A;  4IKS A;  3CTZ A;  1KQ0 A;  3MR1 A;  2GU4 A;  2B3H A;  5CDV A;  1WN1 A;  2GZ5 A;  4RZY A;  2GU7 A;  3L24 A;  1C21 A;  3PKE A;  1YW9 A;  1XGN A;  2HOW A;  2OKN A;  4FKC A;  5D6E A;  4U6Z A;  3ROR A;  1WL9 A;  2BWW A;  4U70 A;  1R5H A;  4IPA A;  1YJ3 A;  2BWS A;  4ZWP A;  1YVM A;  3RVA A;  2V3X A;  2EVO A;  1C23 A;  1KP0 A;  1R58 A;  2B3K A;  2BWT A;  2OAZ A;  3PKB A;  2EA2 A;  3Q6D A;  4IU6 A;  4U69 A;  2BN7 A;  3FMQ A;  4FUK A;  1WLR A;  2B3L A;  2GG0 A;  4ZNG A;  3IG4 A;  4IEC A;  1YW8 A;  1C22 A;  4RGZ 1;  2BWU A;  4U6J A;  1C27 A;  1JAW A;  4FLJ A;  2P99 A;  2GGB A;  4FLL A;  3PKC A;  1B6A A;  5CLS A;  4FO8 A;  2NQ7 A;  3IU9 A;  2Q95 A;  2BWX A;  3TAV A;  2GGC A;  4MAT A;  3BIT A;  3BIP A;  4IKR A;  4QR8 A;  4IKT A;  1W7V A;  1BOA A;  5CNX A;  2GTX A;  3IU8 A;  4KM3 A;  4S00 A;  3BIQ A;  4U75 A;  3S6B A;  1M35 A;  2GG7 A;  4S2R P;  4RZZ A;  4IF7 A;  1Y1N A;  1WL6 A;  1QXZ A;  3L7G A;  1W2M A;  1R5G A;  4IKU A;  2V3Y A;  2EVM A;  1YW7 A;  2Q92 A;  4U73 A;  4FLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...