2GTXA

Structural basis of catalysis by mononuclear methionine aminopeptidase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 86
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gtxA00
4ZWOA 1C24A 4ZWPA 5CIKA 2OKNA 2BHAA 5D6FA 1KP0A 3FMRA 2GG8A 2GG0A 2P99A 2BWVA 4S00A 4RZYA 3TAVA 5FCFA 2Q8KA 5CDEA 4IKSA 4U6EA 3PKBA 2GG2A 4FO7A 2DFIA 1WL9A 5CLSA 4IF7A 3PKDA 2NQ7A 1B59A 4HXXA 1N51A 2V3YA 4U6CA 2OAZA 4S01A 2BHBA 2Q94A 4RZZA 3RVAA 2EVCA 3PKEA 3L7GA 1R5HA 2EVMA 4S2RP 3BIPA 1BN5A 2BWXA 1WKMA 1C23A 1W7VA 2BWUA 2G6PA 4A6WA 2Q92A 3IU7A 1XGMA 3CTZA 1C22A 3MATA 3PKAA 2NQ6A 3MR1A 2MATA 2GG3A 2GG5A 2Q96A 3RORA 1YJ3A 1R58A 3MX6A 2BWYA 2V3ZA 4ZNGA 1QXYA 4Z7MA 1Y1NA 5CE6A 2Q95A 1BOAA 2BWWA 4EGEA 3IU9A 2B3LA 4U1BA 2GU5A 1W2MA 4ZWUA 1YW8A 2IW2A 1XNZA 1M35A 4OOKA 3TB5A 2BWTA 2GZ5A 1A16A 2BB7A 1QXZA 1XGNA 1WLRA 2BHDA 1R5GA 1O0XA 5JI6A 5CDLA 2GU7A 2GGCA 4U69A 2BH3A 4FLKA 4IECA 1C27A 1WN1A 1XGSA 1WBQA 4FO8A 4U76A 2EVOA 4U71A 4KM3A 1WL6A 1QXWA 3PKCA 4IKRA 4A6VA 2V3XA 2B3KA 4S2TP 4FLIA 4IDYA 1MATA 2GU6A 3L24A 4MATA 4U75A 2EA4A 2V6CA 2P9AA 3D27A 3Q6DA 1PV9A 3CB5A 5JHUA 1KQ0A 2ZSGA 2BN7A 4IPAA 4U6WA 4PV4A 1YW7A 5D6EA 4IKTA 3BITA 2EA2A 5FCHA 1YW9A 2GG9A 2HOWA 4B28A 1CHMA 2Q93A 4FLLA 4FKCA 4U6ZA 3IU8A 3FMQA 2BHCA 1QZYA 2ADUA 5CDVA 2GTXA 2B3HA 2GGBA 4JUQA 3CB6A 4U73A 1B6AA 2GU4A 2GA2A 2P98A 4IU6A 3IG4A 1YVMA 4FUKA 5E5BA 3BIQA 4IKUA 4RGZ1 2BWSA 4PNCA 5JFRA 4FLJA 1JAWA 5CNXA 2GG7A 1WY2A 1XGOA 3FM3A 4QR8A 4R60A 4U6JA 3S6BA 1KQ9A 4U70A 1C21A
chains in the Genus database with same CATH superfamily
4ZWOA 1C24A 4ZWPA 5CIKA 2OKNA 2BHAA 5D6FA 1KP0A 3FMRA 2GG8A 2GG0A 2P99A 2BWVA 4S00A 4RZYA 3TAVA 5FCFA 2Q8KA 5CDEA 4IKSA 4U6EA 3PKBA 2GG2A 4FO7A 2DFIA 1WL9A 5CLSA 4IF7A 3PKDA 2NQ7A 1B59A 4HXXA 1N51A 2V3YA 4U6CA 2OAZA 4S01A 2BHBA 2Q94A 4RZZA 3RVAA 2EVCA 3PKEA 3L7GA 1R5HA 2EVMA 4S2RP 3BIPA 1BN5A 2BWXA 1WKMA 1C23A 1W7VA 2BWUA 2G6PA 4A6WA 2Q92A 3IU7A 1XGMA 3CTZA 1C22A 3MATA 3PKAA 2NQ6A 3MR1A 2MATA 2GG3A 2GG5A 2Q96A 3RORA 1YJ3A 1R58A 3MX6A 2BWYA 2V3ZA 4ZNGA 1QXYA 4Z7MA 1Y1NA 5CE6A 2Q95A 1BOAA 2BWWA 4EGEA 3IU9A 2B3LA 4U1BA 2GU5A 1W2MA 4ZWUA 1YW8A 2IW2A 1XNZA 1M35A 4OOKA 3TB5A 2BWTA 2GZ5A 1A16A 2BB7A 1QXZA 1XGNA 1WLRA 2BHDA 1R5GA 1O0XA 5JI6A 5CDLA 2GU7A 2GGCA 4U69A 2BH3A 4FLKA 4IECA 1C27A 1WN1A 1XGSA 1WBQA 4FO8A 4U76A 2EVOA 4U71A 4KM3A 1WL6A 1QXWA 3PKCA 4IKRA 4A6VA 2V3XA 2B3KA 4S2TP 4FLIA 4IDYA 1MATA 2GU6A 3L24A 4MATA 4U75A 2EA4A 2V6CA 2P9AA 3D27A 3Q6DA 1PV9A 3CB5A 5JHUA 1KQ0A 2ZSGA 2BN7A 4IPAA 4U6WA 4PV4A 1YW7A 5D6EA 4IKTA 3BITA 2EA2A 5FCHA 1YW9A 2GG9A 2HOWA 4B28A 1CHMA 2Q93A 4FLLA 4FKCA 4U6ZA 3IU8A 3FMQA 2BHCA 1QZYA 2ADUA 5CDVA 2GTXA 2B3HA 2GGBA 4JUQA 3CB6A 4U73A 1B6AA 2GU4A 2GA2A 2P98A 4IU6A 3IG4A 1YVMA 4FUKA 5E5BA 3BIQA 4IKUA 4RGZ1 2BWSA 4PNCA 5JFRA 4FLJA 1JAWA 5CNXA 2GG7A 1WY2A 1XGOA 3FM3A 4QR8A 4R60A 4U6JA 3S6BA 1KQ9A 4U70A 1C21A
chains in the Genus database with same CATH topology
4ZWOA 1C24A 4ZWPA 5CIKA 2OKNA 2BHAA 5D6FA 1KP0A 3FMRA 2GG8A 2GG0A 2P99A 2BWVA 4S00A 4RZYA 3TAVA 5FCFA 2Q8KA 5CDEA 4IKSA 4U6EA 3PKBA 2GG2A 4FO7A 2DFIA 1WL9A 5CLSA 4IF7A 3PKDA 2NQ7A 1B59A 4HXXA 1N51A 2V3YA 4U6CA 2OAZA 4S01A 2BHBA 2Q94A 4RZZA 3RVAA 2EVCA 3PKEA 3L7GA 1R5HA 2EVMA 4S2RP 3BIPA 1BN5A 2BWXA 1WKMA 1C23A 1W7VA 2BWUA 2G6PA 4A6WA 2Q92A 3IU7A 1XGMA 3CTZA 1C22A 3MATA 3PKAA 2NQ6A 3MR1A 2MATA 2GG3A 2GG5A 2Q96A 3RORA 1YJ3A 1R58A 3MX6A 2BWYA 2V3ZA 4ZNGA 1QXYA 4Z7MA 1Y1NA 5CE6A 2Q95A 1BOAA 2BWWA 4EGEA 3IU9A 2B3LA 4U1BA 2GU5A 1W2MA 4ZWUA 1YW8A 2IW2A 1XNZA 1M35A 4OOKA 3TB5A 2BWTA 2GZ5A 1A16A 2BB7A 1QXZA 1XGNA 1WLRA 2BHDA 1R5GA 1O0XA 5JI6A 5CDLA 2GU7A 2GGCA 4U69A 2BH3A 4FLKA 4IECA 1C27A 1WN1A 1XGSA 1WBQA 4FO8A 4U76A 2EVOA 4U71A 4KM3A 1WL6A 1QXWA 3PKCA 4IKRA 4A6VA 2V3XA 2B3KA 4S2TP 4FLIA 4IDYA 1MATA 2GU6A 3L24A 4MATA 4U75A 2EA4A 2V6CA 2P9AA 3D27A 3Q6DA 1PV9A 3CB5A 5JHUA 1KQ0A 2ZSGA 2BN7A 4IPAA 4U6WA 4PV4A 1YW7A 5D6EA 4IKTA 3BITA 2EA2A 5FCHA 1YW9A 2GG9A 2HOWA 4B28A 1CHMA 2Q93A 4FLLA 4FKCA 4U6ZA 3IU8A 3FMQA 2BHCA 1QZYA 2ADUA 5CDVA 2GTXA 2B3HA 2GGBA 4JUQA 3CB6A 4U73A 1B6AA 2GU4A 2GA2A 2P98A 4IU6A 3IG4A 1YVMA 4FUKA 5E5BA 3BIQA 4IKUA 4RGZ1 2BWSA 4PNCA 5JFRA 4FLJA 1JAWA 5CNXA 2GG7A 1WY2A 1XGOA 3FM3A 4QR8A 4R60A 4U6JA 3S6BA 1KQ9A 4U70A 1C21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWO A;  1C24 A;  4ZWP A;  5CIK A;  2OKN A;  2BHA A;  5D6F A;  1KP0 A;  3FMR A;  2GG8 A;  2GG0 A;  2P99 A;  2BWV A;  4S00 A;  4RZY A;  3TAV A;  5FCF A;  2Q8K A;  5CDE A;  4IKS A;  4U6E A;  3PKB A;  2GG2 A;  4FO7 A;  2DFI A;  1WL9 A;  5CLS A;  4IF7 A;  3PKD A;  2NQ7 A;  1B59 A;  4HXX A;  1N51 A;  2V3Y A;  4U6C A;  2OAZ A;  4S01 A;  2BHB A;  2Q94 A;  4RZZ A;  3RVA A;  2EVC A;  3PKE A;  3L7G A;  1R5H A;  2EVM A;  4S2R P;  3BIP A;  1BN5 A;  2BWX A;  1WKM A;  1C23 A;  1W7V A;  2BWU A;  2G6P A;  4A6W A;  2Q92 A;  3IU7 A;  1XGM A;  3CTZ A;  1C22 A;  3MAT A;  3PKA A;  2NQ6 A;  3MR1 A;  2MAT A;  2GG3 A;  2GG5 A;  2Q96 A;  3ROR A;  1YJ3 A;  1R58 A;  3MX6 A;  2BWY A;  2V3Z A;  4ZNG A;  1QXY A;  4Z7M A;  1Y1N A;  5CE6 A;  2Q95 A;  1BOA A;  2BWW A;  4EGE A;  3IU9 A;  2B3L A;  4U1B A;  2GU5 A;  1W2M A;  4ZWU A;  1YW8 A;  2IW2 A;  1XNZ A;  1M35 A;  4OOK A;  3TB5 A;  2BWT A;  2GZ5 A;  1A16 A;  2BB7 A;  1QXZ A;  1XGN A;  1WLR A;  2BHD A;  1R5G A;  1O0X A;  5JI6 A;  5CDL A;  2GU7 A;  2GGC A;  4U69 A;  2BH3 A;  4FLK A;  4IEC A;  1C27 A;  1WN1 A;  1XGS A;  1WBQ A;  4FO8 A;  4U76 A;  2EVO A;  4U71 A;  4KM3 A;  1WL6 A;  1QXW A;  3PKC A;  4IKR A;  4A6V A;  2V3X A;  2B3K A;  4S2T P;  4FLI A;  4IDY A;  1MAT A;  2GU6 A;  3L24 A;  4MAT A;  4U75 A;  2EA4 A;  2V6C A;  2P9A A;  3D27 A;  3Q6D A;  1PV9 A;  3CB5 A;  5JHU A;  1KQ0 A;  2ZSG A;  2BN7 A;  4IPA A;  4U6W A;  4PV4 A;  1YW7 A;  5D6E A;  4IKT A;  3BIT A;  2EA2 A;  5FCH A;  1YW9 A;  2GG9 A;  2HOW A;  4B28 A;  1CHM A;  2Q93 A;  4FLL A;  4FKC A;  4U6Z A;  3IU8 A;  3FMQ A;  2BHC A;  1QZY A;  2ADU A;  5CDV A;  2GTX A;  2B3H A;  2GGB A;  4JUQ A;  3CB6 A;  4U73 A;  1B6A A;  2GU4 A;  2GA2 A;  2P98 A;  4IU6 A;  3IG4 A;  1YVM A;  4FUK A;  5E5B A;  3BIQ A;  4IKU A;  4RGZ 1;  2BWS A;  4PNC A;  5JFR A;  4FLJ A;  1JAW A;  5CNX A;  2GG7 A;  1WY2 A;  1XGO A;  3FM3 A;  4QR8 A;  4R60 A;  4U6J A;  3S6B A;  1KQ9 A;  4U70 A;  1C21 A; 
#chains in the Genus database with same CATH topology
 4ZWO A;  1C24 A;  4ZWP A;  5CIK A;  2OKN A;  2BHA A;  5D6F A;  1KP0 A;  3FMR A;  2GG8 A;  2GG0 A;  2P99 A;  2BWV A;  4S00 A;  4RZY A;  3TAV A;  5FCF A;  2Q8K A;  5CDE A;  4IKS A;  4U6E A;  3PKB A;  2GG2 A;  4FO7 A;  2DFI A;  1WL9 A;  5CLS A;  4IF7 A;  3PKD A;  2NQ7 A;  1B59 A;  4HXX A;  1N51 A;  2V3Y A;  4U6C A;  2OAZ A;  4S01 A;  2BHB A;  2Q94 A;  4RZZ A;  3RVA A;  2EVC A;  3PKE A;  3L7G A;  1R5H A;  2EVM A;  4S2R P;  3BIP A;  1BN5 A;  2BWX A;  1WKM A;  1C23 A;  1W7V A;  2BWU A;  2G6P A;  4A6W A;  2Q92 A;  3IU7 A;  1XGM A;  3CTZ A;  1C22 A;  3MAT A;  3PKA A;  2NQ6 A;  3MR1 A;  2MAT A;  2GG3 A;  2GG5 A;  2Q96 A;  3ROR A;  1YJ3 A;  1R58 A;  3MX6 A;  2BWY A;  2V3Z A;  4ZNG A;  1QXY A;  4Z7M A;  1Y1N A;  5CE6 A;  2Q95 A;  1BOA A;  2BWW A;  4EGE A;  3IU9 A;  2B3L A;  4U1B A;  2GU5 A;  1W2M A;  4ZWU A;  1YW8 A;  2IW2 A;  1XNZ A;  1M35 A;  4OOK A;  3TB5 A;  2BWT A;  2GZ5 A;  1A16 A;  2BB7 A;  1QXZ A;  1XGN A;  1WLR A;  2BHD A;  1R5G A;  1O0X A;  5JI6 A;  5CDL A;  2GU7 A;  2GGC A;  4U69 A;  2BH3 A;  4FLK A;  4IEC A;  1C27 A;  1WN1 A;  1XGS A;  1WBQ A;  4FO8 A;  4U76 A;  2EVO A;  4U71 A;  4KM3 A;  1WL6 A;  1QXW A;  3PKC A;  4IKR A;  4A6V A;  2V3X A;  2B3K A;  4S2T P;  4FLI A;  4IDY A;  1MAT A;  2GU6 A;  3L24 A;  4MAT A;  4U75 A;  2EA4 A;  2V6C A;  2P9A A;  3D27 A;  3Q6D A;  1PV9 A;  3CB5 A;  5JHU A;  1KQ0 A;  2ZSG A;  2BN7 A;  4IPA A;  4U6W A;  4PV4 A;  1YW7 A;  5D6E A;  4IKT A;  3BIT A;  2EA2 A;  5FCH A;  1YW9 A;  2GG9 A;  2HOW A;  4B28 A;  1CHM A;  2Q93 A;  4FLL A;  4FKC A;  4U6Z A;  3IU8 A;  3FMQ A;  2BHC A;  1QZY A;  2ADU A;  5CDV A;  2GTX A;  2B3H A;  2GGB A;  4JUQ A;  3CB6 A;  4U73 A;  1B6A A;  2GU4 A;  2GA2 A;  2P98 A;  4IU6 A;  3IG4 A;  1YVM A;  4FUK A;  5E5B A;  3BIQ A;  4IKU A;  4RGZ 1;  2BWS A;  4PNC A;  5JFR A;  4FLJ A;  1JAW A;  5CNX A;  2GG7 A;  1WY2 A;  1XGO A;  3FM3 A;  4QR8 A;  4R60 A;  4U6J A;  3S6B A;  1KQ9 A;  4U70 A;  1C21 A; 
#chains in the Genus database with same CATH homology
 4ZWO A;  1C24 A;  4ZWP A;  5CIK A;  2OKN A;  2BHA A;  5D6F A;  1KP0 A;  3FMR A;  2GG8 A;  2GG0 A;  2P99 A;  2BWV A;  4S00 A;  4RZY A;  3TAV A;  5FCF A;  2Q8K A;  5CDE A;  4IKS A;  4U6E A;  3PKB A;  2GG2 A;  4FO7 A;  2DFI A;  1WL9 A;  5CLS A;  4IF7 A;  3PKD A;  2NQ7 A;  1B59 A;  4HXX A;  1N51 A;  2V3Y A;  4U6C A;  2OAZ A;  4S01 A;  2BHB A;  2Q94 A;  4RZZ A;  3RVA A;  2EVC A;  3PKE A;  3L7G A;  1R5H A;  2EVM A;  4S2R P;  3BIP A;  1BN5 A;  2BWX A;  1WKM A;  1C23 A;  1W7V A;  2BWU A;  2G6P A;  4A6W A;  2Q92 A;  3IU7 A;  1XGM A;  3CTZ A;  1C22 A;  3MAT A;  3PKA A;  2NQ6 A;  3MR1 A;  2MAT A;  2GG3 A;  2GG5 A;  2Q96 A;  3ROR A;  1YJ3 A;  1R58 A;  3MX6 A;  2BWY A;  2V3Z A;  4ZNG A;  1QXY A;  4Z7M A;  1Y1N A;  5CE6 A;  2Q95 A;  1BOA A;  2BWW A;  4EGE A;  3IU9 A;  2B3L A;  4U1B A;  2GU5 A;  1W2M A;  4ZWU A;  1YW8 A;  2IW2 A;  1XNZ A;  1M35 A;  4OOK A;  3TB5 A;  2BWT A;  2GZ5 A;  1A16 A;  2BB7 A;  1QXZ A;  1XGN A;  1WLR A;  2BHD A;  1R5G A;  1O0X A;  5JI6 A;  5CDL A;  2GU7 A;  2GGC A;  4U69 A;  2BH3 A;  4FLK A;  4IEC A;  1C27 A;  1WN1 A;  1XGS A;  1WBQ A;  4FO8 A;  4U76 A;  2EVO A;  4U71 A;  4KM3 A;  1WL6 A;  1QXW A;  3PKC A;  4IKR A;  4A6V A;  2V3X A;  2B3K A;  4S2T P;  4FLI A;  4IDY A;  1MAT A;  2GU6 A;  3L24 A;  4MAT A;  4U75 A;  2EA4 A;  2V6C A;  2P9A A;  3D27 A;  3Q6D A;  1PV9 A;  3CB5 A;  5JHU A;  1KQ0 A;  2ZSG A;  2BN7 A;  4IPA A;  4U6W A;  4PV4 A;  1YW7 A;  5D6E A;  4IKT A;  3BIT A;  2EA2 A;  5FCH A;  1YW9 A;  2GG9 A;  2HOW A;  4B28 A;  1CHM A;  2Q93 A;  4FLL A;  4FKC A;  4U6Z A;  3IU8 A;  3FMQ A;  2BHC A;  1QZY A;  2ADU A;  5CDV A;  2GTX A;  2B3H A;  2GGB A;  4JUQ A;  3CB6 A;  4U73 A;  1B6A A;  2GU4 A;  2GA2 A;  2P98 A;  4IU6 A;  3IG4 A;  1YVM A;  4FUK A;  5E5B A;  3BIQ A;  4IKU A;  4RGZ 1;  2BWS A;  4PNC A;  5JFR A;  4FLJ A;  1JAW A;  5CNX A;  2GG7 A;  1WY2 A;  1XGO A;  3FM3 A;  4QR8 A;  4R60 A;  4U6J A;  3S6B A;  1KQ9 A;  4U70 A;  1C21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...