2GTXA

Structural basis of catalysis by mononuclear methionine aminopeptidase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
261
structure length
261
Chain Sequence
b'SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 86
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gtxA00
1YVMA 2BWUA 3CB5A 3MX6A 4A6VA 3IU7A 4MATA 4B28A 2GG5A 2Q92A 2V3XA 2BHBA 5E5BA 1XGMA 2GG2A 4ZNGA 4FUKA 2Q93A 1O0XA 5D6EA 1XGNA 2GU6A 1BN5A 2V6CA 2GU5A 4ZWOA 3IG4A 1WLRA 1N51A 2GG8A 2MATA 2GU4A 3PKBA 1YJ3A 2BHDA 2P99A 4HXXA 4U6CA 4U73A 3FMQA 1YW8A 1QXYA 1YW9A 1KQ9A 2Q96A 4U75A 3Q6DA 5CLSA 2ADUA 5D6FA 4U6JA 2BB7A 2NQ7A 1C21A 2GTXA 3MATA 1R58A 4EGEA 1Y1NA 4PNCA 2ZSGA 1XGOA 3FMRA 4IKUA 2P9AA 4U6EA 4FO8A 4U1BA 1R5GA 2GG0A 1WKMA 4OOKA 1JAWA 1BOAA 1WL9A 3BIQA 3L7GA 2IW2A 2BWVA 4U76A 4IF7A 3PKAA 4IKSA 4IKTA 4S01A 4U70A 1KQ0A 2EA4A 3CTZA 2HOWA 4RZZA 5FCHA 1PV9A 2EVMA 2GG9A 4ZWUA 3L24A 3PKEA 2BN7A 5CDLA 1R5HA 2BWWA 5JI6A 1WL6A 3FM3A 2NQ6A 3D27A 1XGSA 4QR8A 4RZYA 1C27A 3MR1A 1XNZA 2Q95A 1WY2A 2EVOA 4FO7A 4IDYA 3PKCA 4U69A 2B3HA 3RVAA 1W7VA 2BHCA 4FLLA 4A6WA 2EVCA 4FLKA 3S6BA 1C22A 4FKCA 1M35A 1QXWA 2BWXA 4KM3A 1C24A 4IU6A 1C23A 2Q8KA 4IPAA 3PKDA 4S2RP 4RGZ1 5CDVA 2BH3A 3BITA 2GG3A 1WBQA 2GGCA 3IU9A 1QXZA 2V3YA 4R60A 3IU8A 1YW7A 2EA2A 4S2TP 2BWYA 2OKNA 2BWTA 4IECA 2G6PA 5JHUA 1KP0A 2BWSA 1CHMA 2GGBA 2Q94A 1B59A 1W2MA 4U6WA 2DFIA 5CNXA 4ZWPA 3TB5A 2P98A 1B6AA 3RORA 4FLIA 2GG7A 4FLJA 4S00A 5FCFA 3TAVA 1WN1A 4IKRA 2GZ5A 1A16A 2B3LA 4U71A 2BHAA 2GA2A 4U6ZA 3CB6A 2V3ZA 2B3KA 2GU7A 2OAZA 4Z7MA 4PV4A 5CIKA 1MATA 5CDEA 5CE6A 5JFRA 3BIPA 1QZYA 4JUQA
chains in the Genus database with same CATH superfamily
1YVMA 2BWUA 3CB5A 3MX6A 4A6VA 3IU7A 4MATA 4B28A 2GG5A 2Q92A 2V3XA 2BHBA 5E5BA 1XGMA 2GG2A 4ZNGA 4FUKA 2Q93A 1O0XA 5D6EA 1XGNA 2GU6A 1BN5A 2V6CA 2GU5A 4ZWOA 3IG4A 1WLRA 1N51A 2GG8A 2MATA 2GU4A 3PKBA 1YJ3A 2BHDA 2P99A 4HXXA 4U6CA 4U73A 3FMQA 1YW8A 1QXYA 1YW9A 1KQ9A 2Q96A 4U75A 3Q6DA 5CLSA 2ADUA 5D6FA 4U6JA 2BB7A 2NQ7A 1C21A 2GTXA 3MATA 1R58A 4EGEA 1Y1NA 4PNCA 2ZSGA 1XGOA 3FMRA 4IKUA 2P9AA 4U6EA 4FO8A 4U1BA 1R5GA 2GG0A 1WKMA 4OOKA 1JAWA 1BOAA 1WL9A 3BIQA 3L7GA 2IW2A 2BWVA 4U76A 4IF7A 3PKAA 4IKSA 4IKTA 4S01A 4U70A 1KQ0A 2EA4A 3CTZA 2HOWA 4RZZA 5FCHA 1PV9A 2EVMA 2GG9A 4ZWUA 3L24A 3PKEA 2BN7A 5CDLA 1R5HA 2BWWA 5JI6A 1WL6A 3FM3A 2NQ6A 3D27A 1XGSA 4QR8A 4RZYA 1C27A 3MR1A 1XNZA 2Q95A 1WY2A 2EVOA 4FO7A 4IDYA 3PKCA 4U69A 2B3HA 3RVAA 1W7VA 2BHCA 4FLLA 4A6WA 2EVCA 4FLKA 3S6BA 1C22A 4FKCA 1M35A 1QXWA 2BWXA 4KM3A 1C24A 4IU6A 1C23A 2Q8KA 4IPAA 3PKDA 4S2RP 4RGZ1 5CDVA 2BH3A 3BITA 2GG3A 1WBQA 2GGCA 3IU9A 1QXZA 2V3YA 4R60A 3IU8A 1YW7A 2EA2A 4S2TP 2BWYA 2OKNA 2BWTA 4IECA 2G6PA 5JHUA 1KP0A 2BWSA 1CHMA 2GGBA 2Q94A 1B59A 1W2MA 4U6WA 2DFIA 5CNXA 4ZWPA 3TB5A 2P98A 1B6AA 3RORA 4FLIA 2GG7A 4FLJA 4S00A 5FCFA 3TAVA 1WN1A 4IKRA 2GZ5A 1A16A 2B3LA 4U71A 2BHAA 2GA2A 4U6ZA 3CB6A 2V3ZA 2B3KA 2GU7A 2OAZA 4Z7MA 4PV4A 5CIKA 1MATA 5CDEA 5CE6A 5JFRA 3BIPA 1QZYA 4JUQA
chains in the Genus database with same CATH topology
1YVMA 2BWUA 3CB5A 3MX6A 4A6VA 3IU7A 4MATA 4B28A 2GG5A 2Q92A 2V3XA 2BHBA 5E5BA 1XGMA 2GG2A 4ZNGA 4FUKA 2Q93A 1O0XA 5D6EA 1XGNA 2GU6A 1BN5A 2V6CA 2GU5A 4ZWOA 3IG4A 1WLRA 1N51A 2GG8A 2MATA 2GU4A 3PKBA 1YJ3A 2BHDA 2P99A 4HXXA 4U6CA 4U73A 3FMQA 1YW8A 1QXYA 1YW9A 1KQ9A 2Q96A 4U75A 3Q6DA 5CLSA 2ADUA 5D6FA 4U6JA 2BB7A 2NQ7A 1C21A 2GTXA 3MATA 1R58A 4EGEA 1Y1NA 4PNCA 2ZSGA 1XGOA 3FMRA 4IKUA 2P9AA 4U6EA 4FO8A 4U1BA 1R5GA 2GG0A 1WKMA 4OOKA 1JAWA 1BOAA 1WL9A 3BIQA 3L7GA 2IW2A 2BWVA 4U76A 4IF7A 3PKAA 4IKSA 4IKTA 4S01A 4U70A 1KQ0A 2EA4A 3CTZA 2HOWA 4RZZA 5FCHA 1PV9A 2EVMA 2GG9A 4ZWUA 3L24A 3PKEA 2BN7A 5CDLA 1R5HA 2BWWA 5JI6A 1WL6A 3FM3A 2NQ6A 3D27A 1XGSA 4QR8A 4RZYA 1C27A 3MR1A 1XNZA 2Q95A 1WY2A 2EVOA 4FO7A 4IDYA 3PKCA 4U69A 2B3HA 3RVAA 1W7VA 2BHCA 4FLLA 4A6WA 2EVCA 4FLKA 3S6BA 1C22A 4FKCA 1M35A 1QXWA 2BWXA 4KM3A 1C24A 4IU6A 1C23A 2Q8KA 4IPAA 3PKDA 4S2RP 4RGZ1 5CDVA 2BH3A 3BITA 2GG3A 1WBQA 2GGCA 3IU9A 1QXZA 2V3YA 4R60A 3IU8A 1YW7A 2EA2A 4S2TP 2BWYA 2OKNA 2BWTA 4IECA 2G6PA 5JHUA 1KP0A 2BWSA 1CHMA 2GGBA 2Q94A 1B59A 1W2MA 4U6WA 2DFIA 5CNXA 4ZWPA 3TB5A 2P98A 1B6AA 3RORA 4FLIA 2GG7A 4FLJA 4S00A 5FCFA 3TAVA 1WN1A 4IKRA 2GZ5A 1A16A 2B3LA 4U71A 2BHAA 2GA2A 4U6ZA 3CB6A 2V3ZA 2B3KA 2GU7A 2OAZA 4Z7MA 4PV4A 5CIKA 1MATA 5CDEA 5CE6A 5JFRA 3BIPA 1QZYA 4JUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVM A;  2BWU A;  3CB5 A;  3MX6 A;  4A6V A;  3IU7 A;  4MAT A;  4B28 A;  2GG5 A;  2Q92 A;  2V3X A;  2BHB A;  5E5B A;  1XGM A;  2GG2 A;  4ZNG A;  4FUK A;  2Q93 A;  1O0X A;  5D6E A;  1XGN A;  2GU6 A;  1BN5 A;  2V6C A;  2GU5 A;  4ZWO A;  3IG4 A;  1WLR A;  1N51 A;  2GG8 A;  2MAT A;  2GU4 A;  3PKB A;  1YJ3 A;  2BHD A;  2P99 A;  4HXX A;  4U6C A;  4U73 A;  3FMQ A;  1YW8 A;  1QXY A;  1YW9 A;  1KQ9 A;  2Q96 A;  4U75 A;  3Q6D A;  5CLS A;  2ADU A;  5D6F A;  4U6J A;  2BB7 A;  2NQ7 A;  1C21 A;  2GTX A;  3MAT A;  1R58 A;  4EGE A;  1Y1N A;  4PNC A;  2ZSG A;  1XGO A;  3FMR A;  4IKU A;  2P9A A;  4U6E A;  4FO8 A;  4U1B A;  1R5G A;  2GG0 A;  1WKM A;  4OOK A;  1JAW A;  1BOA A;  1WL9 A;  3BIQ A;  3L7G A;  2IW2 A;  2BWV A;  4U76 A;  4IF7 A;  3PKA A;  4IKS A;  4IKT A;  4S01 A;  4U70 A;  1KQ0 A;  2EA4 A;  3CTZ A;  2HOW A;  4RZZ A;  5FCH A;  1PV9 A;  2EVM A;  2GG9 A;  4ZWU A;  3L24 A;  3PKE A;  2BN7 A;  5CDL A;  1R5H A;  2BWW A;  5JI6 A;  1WL6 A;  3FM3 A;  2NQ6 A;  3D27 A;  1XGS A;  4QR8 A;  4RZY A;  1C27 A;  3MR1 A;  1XNZ A;  2Q95 A;  1WY2 A;  2EVO A;  4FO7 A;  4IDY A;  3PKC A;  4U69 A;  2B3H A;  3RVA A;  1W7V A;  2BHC A;  4FLL A;  4A6W A;  2EVC A;  4FLK A;  3S6B A;  1C22 A;  4FKC A;  1M35 A;  1QXW A;  2BWX A;  4KM3 A;  1C24 A;  4IU6 A;  1C23 A;  2Q8K A;  4IPA A;  3PKD A;  4S2R P;  4RGZ 1;  5CDV A;  2BH3 A;  3BIT A;  2GG3 A;  1WBQ A;  2GGC A;  3IU9 A;  1QXZ A;  2V3Y A;  4R60 A;  3IU8 A;  1YW7 A;  2EA2 A;  4S2T P;  2BWY A;  2OKN A;  2BWT A;  4IEC A;  2G6P A;  5JHU A;  1KP0 A;  2BWS A;  1CHM A;  2GGB A;  2Q94 A;  1B59 A;  1W2M A;  4U6W A;  2DFI A;  5CNX A;  4ZWP A;  3TB5 A;  2P98 A;  1B6A A;  3ROR A;  4FLI A;  2GG7 A;  4FLJ A;  4S00 A;  5FCF A;  3TAV A;  1WN1 A;  4IKR A;  2GZ5 A;  1A16 A;  2B3L A;  4U71 A;  2BHA A;  2GA2 A;  4U6Z A;  3CB6 A;  2V3Z A;  2B3K A;  2GU7 A;  2OAZ A;  4Z7M A;  4PV4 A;  5CIK A;  1MAT A;  5CDE A;  5CE6 A;  5JFR A;  3BIP A;  1QZY A;  4JUQ A; 
#chains in the Genus database with same CATH topology
 1YVM A;  2BWU A;  3CB5 A;  3MX6 A;  4A6V A;  3IU7 A;  4MAT A;  4B28 A;  2GG5 A;  2Q92 A;  2V3X A;  2BHB A;  5E5B A;  1XGM A;  2GG2 A;  4ZNG A;  4FUK A;  2Q93 A;  1O0X A;  5D6E A;  1XGN A;  2GU6 A;  1BN5 A;  2V6C A;  2GU5 A;  4ZWO A;  3IG4 A;  1WLR A;  1N51 A;  2GG8 A;  2MAT A;  2GU4 A;  3PKB A;  1YJ3 A;  2BHD A;  2P99 A;  4HXX A;  4U6C A;  4U73 A;  3FMQ A;  1YW8 A;  1QXY A;  1YW9 A;  1KQ9 A;  2Q96 A;  4U75 A;  3Q6D A;  5CLS A;  2ADU A;  5D6F A;  4U6J A;  2BB7 A;  2NQ7 A;  1C21 A;  2GTX A;  3MAT A;  1R58 A;  4EGE A;  1Y1N A;  4PNC A;  2ZSG A;  1XGO A;  3FMR A;  4IKU A;  2P9A A;  4U6E A;  4FO8 A;  4U1B A;  1R5G A;  2GG0 A;  1WKM A;  4OOK A;  1JAW A;  1BOA A;  1WL9 A;  3BIQ A;  3L7G A;  2IW2 A;  2BWV A;  4U76 A;  4IF7 A;  3PKA A;  4IKS A;  4IKT A;  4S01 A;  4U70 A;  1KQ0 A;  2EA4 A;  3CTZ A;  2HOW A;  4RZZ A;  5FCH A;  1PV9 A;  2EVM A;  2GG9 A;  4ZWU A;  3L24 A;  3PKE A;  2BN7 A;  5CDL A;  1R5H A;  2BWW A;  5JI6 A;  1WL6 A;  3FM3 A;  2NQ6 A;  3D27 A;  1XGS A;  4QR8 A;  4RZY A;  1C27 A;  3MR1 A;  1XNZ A;  2Q95 A;  1WY2 A;  2EVO A;  4FO7 A;  4IDY A;  3PKC A;  4U69 A;  2B3H A;  3RVA A;  1W7V A;  2BHC A;  4FLL A;  4A6W A;  2EVC A;  4FLK A;  3S6B A;  1C22 A;  4FKC A;  1M35 A;  1QXW A;  2BWX A;  4KM3 A;  1C24 A;  4IU6 A;  1C23 A;  2Q8K A;  4IPA A;  3PKD A;  4S2R P;  4RGZ 1;  5CDV A;  2BH3 A;  3BIT A;  2GG3 A;  1WBQ A;  2GGC A;  3IU9 A;  1QXZ A;  2V3Y A;  4R60 A;  3IU8 A;  1YW7 A;  2EA2 A;  4S2T P;  2BWY A;  2OKN A;  2BWT A;  4IEC A;  2G6P A;  5JHU A;  1KP0 A;  2BWS A;  1CHM A;  2GGB A;  2Q94 A;  1B59 A;  1W2M A;  4U6W A;  2DFI A;  5CNX A;  4ZWP A;  3TB5 A;  2P98 A;  1B6A A;  3ROR A;  4FLI A;  2GG7 A;  4FLJ A;  4S00 A;  5FCF A;  3TAV A;  1WN1 A;  4IKR A;  2GZ5 A;  1A16 A;  2B3L A;  4U71 A;  2BHA A;  2GA2 A;  4U6Z A;  3CB6 A;  2V3Z A;  2B3K A;  2GU7 A;  2OAZ A;  4Z7M A;  4PV4 A;  5CIK A;  1MAT A;  5CDE A;  5CE6 A;  5JFR A;  3BIP A;  1QZY A;  4JUQ A; 
#chains in the Genus database with same CATH homology
 1YVM A;  2BWU A;  3CB5 A;  3MX6 A;  4A6V A;  3IU7 A;  4MAT A;  4B28 A;  2GG5 A;  2Q92 A;  2V3X A;  2BHB A;  5E5B A;  1XGM A;  2GG2 A;  4ZNG A;  4FUK A;  2Q93 A;  1O0X A;  5D6E A;  1XGN A;  2GU6 A;  1BN5 A;  2V6C A;  2GU5 A;  4ZWO A;  3IG4 A;  1WLR A;  1N51 A;  2GG8 A;  2MAT A;  2GU4 A;  3PKB A;  1YJ3 A;  2BHD A;  2P99 A;  4HXX A;  4U6C A;  4U73 A;  3FMQ A;  1YW8 A;  1QXY A;  1YW9 A;  1KQ9 A;  2Q96 A;  4U75 A;  3Q6D A;  5CLS A;  2ADU A;  5D6F A;  4U6J A;  2BB7 A;  2NQ7 A;  1C21 A;  2GTX A;  3MAT A;  1R58 A;  4EGE A;  1Y1N A;  4PNC A;  2ZSG A;  1XGO A;  3FMR A;  4IKU A;  2P9A A;  4U6E A;  4FO8 A;  4U1B A;  1R5G A;  2GG0 A;  1WKM A;  4OOK A;  1JAW A;  1BOA A;  1WL9 A;  3BIQ A;  3L7G A;  2IW2 A;  2BWV A;  4U76 A;  4IF7 A;  3PKA A;  4IKS A;  4IKT A;  4S01 A;  4U70 A;  1KQ0 A;  2EA4 A;  3CTZ A;  2HOW A;  4RZZ A;  5FCH A;  1PV9 A;  2EVM A;  2GG9 A;  4ZWU A;  3L24 A;  3PKE A;  2BN7 A;  5CDL A;  1R5H A;  2BWW A;  5JI6 A;  1WL6 A;  3FM3 A;  2NQ6 A;  3D27 A;  1XGS A;  4QR8 A;  4RZY A;  1C27 A;  3MR1 A;  1XNZ A;  2Q95 A;  1WY2 A;  2EVO A;  4FO7 A;  4IDY A;  3PKC A;  4U69 A;  2B3H A;  3RVA A;  1W7V A;  2BHC A;  4FLL A;  4A6W A;  2EVC A;  4FLK A;  3S6B A;  1C22 A;  4FKC A;  1M35 A;  1QXW A;  2BWX A;  4KM3 A;  1C24 A;  4IU6 A;  1C23 A;  2Q8K A;  4IPA A;  3PKD A;  4S2R P;  4RGZ 1;  5CDV A;  2BH3 A;  3BIT A;  2GG3 A;  1WBQ A;  2GGC A;  3IU9 A;  1QXZ A;  2V3Y A;  4R60 A;  3IU8 A;  1YW7 A;  2EA2 A;  4S2T P;  2BWY A;  2OKN A;  2BWT A;  4IEC A;  2G6P A;  5JHU A;  1KP0 A;  2BWS A;  1CHM A;  2GGB A;  2Q94 A;  1B59 A;  1W2M A;  4U6W A;  2DFI A;  5CNX A;  4ZWP A;  3TB5 A;  2P98 A;  1B6A A;  3ROR A;  4FLI A;  2GG7 A;  4FLJ A;  4S00 A;  5FCF A;  3TAV A;  1WN1 A;  4IKR A;  2GZ5 A;  1A16 A;  2B3L A;  4U71 A;  2BHA A;  2GA2 A;  4U6Z A;  3CB6 A;  2V3Z A;  2B3K A;  2GU7 A;  2OAZ A;  4Z7M A;  4PV4 A;  5CIK A;  1MAT A;  5CDE A;  5CE6 A;  5JFR A;  3BIP A;  1QZY A;  4JUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...