2GTXA

Structural basis of catalysis by mononuclear methionine aminopeptidase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 86
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gtxA00
2DFIA 1XGNA 2EVOA 3L24A 2BB7A 2BN7A 2GG8A 1PV9A 1KQ0A 1QXWA 2GTXA 2OKNA 4U73A 4S00A 2ZSGA 4ZWOA 2EVMA 2GG7A 2GU5A 1N51A 4FLJA 4U6EA 2B3KA 1WL9A 4FLIA 2EVCA 5CE6A 1KP0A 4RZYA 5FCHA 2BWXA 1QXYA 4ZNGA 5E5BA 4ZWUA 2OAZA 4U6JA 3MATA 1C21A 2BWVA 1JAWA 3FM3A 3RORA 2Q93A 1WL6A 2Q96A 1B6AA 2GU7A 4Z7MA 3PKEA 4A6VA 4A6WA 3IU7A 4U75A 1BN5A 4FUKA 1W2MA 2BWSA 1O0XA 1WLRA 3FMRA 4S01A 4U69A 4IKRA 4OOKA 4R60A 4S2RP 2P99A 2ADUA 2BWTA 1C24A 4MATA 4PV4A 5CIKA 3MR1A 4HXXA 2GU4A 5JFRA 2GG3A 2GG0A 2NQ7A 2GGCA 2BHCA 2V6CA 3PKBA 3PKAA 5D6EA 4RZZA 3TB5A 2BH3A 3TAVA 1XNZA 2IW2A 3PKDA 4IKUA 3L7GA 1WBQA 3CB6A 3Q6DA 1YVMA 4FKCA 1B59A 1WY2A 4IKTA 3CB5A 4IPAA 3CTZA 1WN1A 4ZWPA 4S2TP 2BWUA 1MATA 2GU6A 2B3LA 2GG9A 4FLLA 2NQ6A 2BHBA 2GGBA 4IU6A 1BOAA 2BWWA 4RGZ1 5FCFA 4U1BA 3PKCA 4U70A 2B3HA 4FO7A 4FLKA 5CDLA 4U6CA 2EA4A 1XGSA 1QXZA 4IECA 2V3XA 1C23A 1QZYA 4FO8A 2P98A 1R58A 1R5HA 5JI6A 2BWYA 1YW8A 3D27A 3IU8A 1KQ9A 2GA2A 4IDYA 5D6FA 1YW7A 2P9AA 1M35A 1YJ3A 4EGEA 1XGMA 1CHMA 3BITA 4U71A 3BIQA 1XGOA 2EA2A 3FMQA 4PNCA 2G6PA 3BIPA 4U6WA 4U6ZA 1A16A 2MATA 2BHAA 1R5GA 3IG4A 2GG2A 2V3YA 1C27A 2GZ5A 1C22A 2Q95A 2Q94A 4IF7A 5CDVA 4IKSA 4U76A 3S6BA 5JHUA 1WKMA 2Q8KA 2BHDA 3RVAA 3MX6A 4KM3A 2GG5A 5CDEA 1Y1NA 2Q92A 2V3ZA 5CNXA 4QR8A 4B28A 5CLSA 1YW9A 1W7VA 4JUQA 2HOWA 3IU9A
chains in the Genus database with same CATH superfamily
2DFIA 1XGNA 2EVOA 3L24A 2BB7A 2BN7A 2GG8A 1PV9A 1KQ0A 1QXWA 2GTXA 2OKNA 4U73A 4S00A 2ZSGA 4ZWOA 2EVMA 2GG7A 2GU5A 1N51A 4FLJA 4U6EA 2B3KA 1WL9A 4FLIA 2EVCA 5CE6A 1KP0A 4RZYA 5FCHA 2BWXA 1QXYA 4ZNGA 5E5BA 4ZWUA 2OAZA 4U6JA 3MATA 1C21A 2BWVA 1JAWA 3FM3A 3RORA 2Q93A 1WL6A 2Q96A 1B6AA 2GU7A 4Z7MA 3PKEA 4A6VA 4A6WA 3IU7A 4U75A 1BN5A 4FUKA 1W2MA 2BWSA 1O0XA 1WLRA 3FMRA 4S01A 4U69A 4IKRA 4OOKA 4R60A 4S2RP 2P99A 2ADUA 2BWTA 1C24A 4MATA 4PV4A 5CIKA 3MR1A 4HXXA 2GU4A 5JFRA 2GG3A 2GG0A 2NQ7A 2GGCA 2BHCA 2V6CA 3PKBA 3PKAA 5D6EA 4RZZA 3TB5A 2BH3A 3TAVA 1XNZA 2IW2A 3PKDA 4IKUA 3L7GA 1WBQA 3CB6A 3Q6DA 1YVMA 4FKCA 1B59A 1WY2A 4IKTA 3CB5A 4IPAA 3CTZA 1WN1A 4ZWPA 4S2TP 2BWUA 1MATA 2GU6A 2B3LA 2GG9A 4FLLA 2NQ6A 2BHBA 2GGBA 4IU6A 1BOAA 2BWWA 4RGZ1 5FCFA 4U1BA 3PKCA 4U70A 2B3HA 4FO7A 4FLKA 5CDLA 4U6CA 2EA4A 1XGSA 1QXZA 4IECA 2V3XA 1C23A 1QZYA 4FO8A 2P98A 1R58A 1R5HA 5JI6A 2BWYA 1YW8A 3D27A 3IU8A 1KQ9A 2GA2A 4IDYA 5D6FA 1YW7A 2P9AA 1M35A 1YJ3A 4EGEA 1XGMA 1CHMA 3BITA 4U71A 3BIQA 1XGOA 2EA2A 3FMQA 4PNCA 2G6PA 3BIPA 4U6WA 4U6ZA 1A16A 2MATA 2BHAA 1R5GA 3IG4A 2GG2A 2V3YA 1C27A 2GZ5A 1C22A 2Q95A 2Q94A 4IF7A 5CDVA 4IKSA 4U76A 3S6BA 5JHUA 1WKMA 2Q8KA 2BHDA 3RVAA 3MX6A 4KM3A 2GG5A 5CDEA 1Y1NA 2Q92A 2V3ZA 5CNXA 4QR8A 4B28A 5CLSA 1YW9A 1W7VA 4JUQA 2HOWA 3IU9A
chains in the Genus database with same CATH topology
2DFIA 1XGNA 2EVOA 3L24A 2BB7A 2BN7A 2GG8A 1PV9A 1KQ0A 1QXWA 2GTXA 2OKNA 4U73A 4S00A 2ZSGA 4ZWOA 2EVMA 2GG7A 2GU5A 1N51A 4FLJA 4U6EA 2B3KA 1WL9A 4FLIA 2EVCA 5CE6A 1KP0A 4RZYA 5FCHA 2BWXA 1QXYA 4ZNGA 5E5BA 4ZWUA 2OAZA 4U6JA 3MATA 1C21A 2BWVA 1JAWA 3FM3A 3RORA 2Q93A 1WL6A 2Q96A 1B6AA 2GU7A 4Z7MA 3PKEA 4A6VA 4A6WA 3IU7A 4U75A 1BN5A 4FUKA 1W2MA 2BWSA 1O0XA 1WLRA 3FMRA 4S01A 4U69A 4IKRA 4OOKA 4R60A 4S2RP 2P99A 2ADUA 2BWTA 1C24A 4MATA 4PV4A 5CIKA 3MR1A 4HXXA 2GU4A 5JFRA 2GG3A 2GG0A 2NQ7A 2GGCA 2BHCA 2V6CA 3PKBA 3PKAA 5D6EA 4RZZA 3TB5A 2BH3A 3TAVA 1XNZA 2IW2A 3PKDA 4IKUA 3L7GA 1WBQA 3CB6A 3Q6DA 1YVMA 4FKCA 1B59A 1WY2A 4IKTA 3CB5A 4IPAA 3CTZA 1WN1A 4ZWPA 4S2TP 2BWUA 1MATA 2GU6A 2B3LA 2GG9A 4FLLA 2NQ6A 2BHBA 2GGBA 4IU6A 1BOAA 2BWWA 4RGZ1 5FCFA 4U1BA 3PKCA 4U70A 2B3HA 4FO7A 4FLKA 5CDLA 4U6CA 2EA4A 1XGSA 1QXZA 4IECA 2V3XA 1C23A 1QZYA 4FO8A 2P98A 1R58A 1R5HA 5JI6A 2BWYA 1YW8A 3D27A 3IU8A 1KQ9A 2GA2A 4IDYA 5D6FA 1YW7A 2P9AA 1M35A 1YJ3A 4EGEA 1XGMA 1CHMA 3BITA 4U71A 3BIQA 1XGOA 2EA2A 3FMQA 4PNCA 2G6PA 3BIPA 4U6WA 4U6ZA 1A16A 2MATA 2BHAA 1R5GA 3IG4A 2GG2A 2V3YA 1C27A 2GZ5A 1C22A 2Q95A 2Q94A 4IF7A 5CDVA 4IKSA 4U76A 3S6BA 5JHUA 1WKMA 2Q8KA 2BHDA 3RVAA 3MX6A 4KM3A 2GG5A 5CDEA 1Y1NA 2Q92A 2V3ZA 5CNXA 4QR8A 4B28A 5CLSA 1YW9A 1W7VA 4JUQA 2HOWA 3IU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFI A;  1XGN A;  2EVO A;  3L24 A;  2BB7 A;  2BN7 A;  2GG8 A;  1PV9 A;  1KQ0 A;  1QXW A;  2GTX A;  2OKN A;  4U73 A;  4S00 A;  2ZSG A;  4ZWO A;  2EVM A;  2GG7 A;  2GU5 A;  1N51 A;  4FLJ A;  4U6E A;  2B3K A;  1WL9 A;  4FLI A;  2EVC A;  5CE6 A;  1KP0 A;  4RZY A;  5FCH A;  2BWX A;  1QXY A;  4ZNG A;  5E5B A;  4ZWU A;  2OAZ A;  4U6J A;  3MAT A;  1C21 A;  2BWV A;  1JAW A;  3FM3 A;  3ROR A;  2Q93 A;  1WL6 A;  2Q96 A;  1B6A A;  2GU7 A;  4Z7M A;  3PKE A;  4A6V A;  4A6W A;  3IU7 A;  4U75 A;  1BN5 A;  4FUK A;  1W2M A;  2BWS A;  1O0X A;  1WLR A;  3FMR A;  4S01 A;  4U69 A;  4IKR A;  4OOK A;  4R60 A;  4S2R P;  2P99 A;  2ADU A;  2BWT A;  1C24 A;  4MAT A;  4PV4 A;  5CIK A;  3MR1 A;  4HXX A;  2GU4 A;  5JFR A;  2GG3 A;  2GG0 A;  2NQ7 A;  2GGC A;  2BHC A;  2V6C A;  3PKB A;  3PKA A;  5D6E A;  4RZZ A;  3TB5 A;  2BH3 A;  3TAV A;  1XNZ A;  2IW2 A;  3PKD A;  4IKU A;  3L7G A;  1WBQ A;  3CB6 A;  3Q6D A;  1YVM A;  4FKC A;  1B59 A;  1WY2 A;  4IKT A;  3CB5 A;  4IPA A;  3CTZ A;  1WN1 A;  4ZWP A;  4S2T P;  2BWU A;  1MAT A;  2GU6 A;  2B3L A;  2GG9 A;  4FLL A;  2NQ6 A;  2BHB A;  2GGB A;  4IU6 A;  1BOA A;  2BWW A;  4RGZ 1;  5FCF A;  4U1B A;  3PKC A;  4U70 A;  2B3H A;  4FO7 A;  4FLK A;  5CDL A;  4U6C A;  2EA4 A;  1XGS A;  1QXZ A;  4IEC A;  2V3X A;  1C23 A;  1QZY A;  4FO8 A;  2P98 A;  1R58 A;  1R5H A;  5JI6 A;  2BWY A;  1YW8 A;  3D27 A;  3IU8 A;  1KQ9 A;  2GA2 A;  4IDY A;  5D6F A;  1YW7 A;  2P9A A;  1M35 A;  1YJ3 A;  4EGE A;  1XGM A;  1CHM A;  3BIT A;  4U71 A;  3BIQ A;  1XGO A;  2EA2 A;  3FMQ A;  4PNC A;  2G6P A;  3BIP A;  4U6W A;  4U6Z A;  1A16 A;  2MAT A;  2BHA A;  1R5G A;  3IG4 A;  2GG2 A;  2V3Y A;  1C27 A;  2GZ5 A;  1C22 A;  2Q95 A;  2Q94 A;  4IF7 A;  5CDV A;  4IKS A;  4U76 A;  3S6B A;  5JHU A;  1WKM A;  2Q8K A;  2BHD A;  3RVA A;  3MX6 A;  4KM3 A;  2GG5 A;  5CDE A;  1Y1N A;  2Q92 A;  2V3Z A;  5CNX A;  4QR8 A;  4B28 A;  5CLS A;  1YW9 A;  1W7V A;  4JUQ A;  2HOW A;  3IU9 A; 
#chains in the Genus database with same CATH topology
 2DFI A;  1XGN A;  2EVO A;  3L24 A;  2BB7 A;  2BN7 A;  2GG8 A;  1PV9 A;  1KQ0 A;  1QXW A;  2GTX A;  2OKN A;  4U73 A;  4S00 A;  2ZSG A;  4ZWO A;  2EVM A;  2GG7 A;  2GU5 A;  1N51 A;  4FLJ A;  4U6E A;  2B3K A;  1WL9 A;  4FLI A;  2EVC A;  5CE6 A;  1KP0 A;  4RZY A;  5FCH A;  2BWX A;  1QXY A;  4ZNG A;  5E5B A;  4ZWU A;  2OAZ A;  4U6J A;  3MAT A;  1C21 A;  2BWV A;  1JAW A;  3FM3 A;  3ROR A;  2Q93 A;  1WL6 A;  2Q96 A;  1B6A A;  2GU7 A;  4Z7M A;  3PKE A;  4A6V A;  4A6W A;  3IU7 A;  4U75 A;  1BN5 A;  4FUK A;  1W2M A;  2BWS A;  1O0X A;  1WLR A;  3FMR A;  4S01 A;  4U69 A;  4IKR A;  4OOK A;  4R60 A;  4S2R P;  2P99 A;  2ADU A;  2BWT A;  1C24 A;  4MAT A;  4PV4 A;  5CIK A;  3MR1 A;  4HXX A;  2GU4 A;  5JFR A;  2GG3 A;  2GG0 A;  2NQ7 A;  2GGC A;  2BHC A;  2V6C A;  3PKB A;  3PKA A;  5D6E A;  4RZZ A;  3TB5 A;  2BH3 A;  3TAV A;  1XNZ A;  2IW2 A;  3PKD A;  4IKU A;  3L7G A;  1WBQ A;  3CB6 A;  3Q6D A;  1YVM A;  4FKC A;  1B59 A;  1WY2 A;  4IKT A;  3CB5 A;  4IPA A;  3CTZ A;  1WN1 A;  4ZWP A;  4S2T P;  2BWU A;  1MAT A;  2GU6 A;  2B3L A;  2GG9 A;  4FLL A;  2NQ6 A;  2BHB A;  2GGB A;  4IU6 A;  1BOA A;  2BWW A;  4RGZ 1;  5FCF A;  4U1B A;  3PKC A;  4U70 A;  2B3H A;  4FO7 A;  4FLK A;  5CDL A;  4U6C A;  2EA4 A;  1XGS A;  1QXZ A;  4IEC A;  2V3X A;  1C23 A;  1QZY A;  4FO8 A;  2P98 A;  1R58 A;  1R5H A;  5JI6 A;  2BWY A;  1YW8 A;  3D27 A;  3IU8 A;  1KQ9 A;  2GA2 A;  4IDY A;  5D6F A;  1YW7 A;  2P9A A;  1M35 A;  1YJ3 A;  4EGE A;  1XGM A;  1CHM A;  3BIT A;  4U71 A;  3BIQ A;  1XGO A;  2EA2 A;  3FMQ A;  4PNC A;  2G6P A;  3BIP A;  4U6W A;  4U6Z A;  1A16 A;  2MAT A;  2BHA A;  1R5G A;  3IG4 A;  2GG2 A;  2V3Y A;  1C27 A;  2GZ5 A;  1C22 A;  2Q95 A;  2Q94 A;  4IF7 A;  5CDV A;  4IKS A;  4U76 A;  3S6B A;  5JHU A;  1WKM A;  2Q8K A;  2BHD A;  3RVA A;  3MX6 A;  4KM3 A;  2GG5 A;  5CDE A;  1Y1N A;  2Q92 A;  2V3Z A;  5CNX A;  4QR8 A;  4B28 A;  5CLS A;  1YW9 A;  1W7V A;  4JUQ A;  2HOW A;  3IU9 A; 
#chains in the Genus database with same CATH homology
 2DFI A;  1XGN A;  2EVO A;  3L24 A;  2BB7 A;  2BN7 A;  2GG8 A;  1PV9 A;  1KQ0 A;  1QXW A;  2GTX A;  2OKN A;  4U73 A;  4S00 A;  2ZSG A;  4ZWO A;  2EVM A;  2GG7 A;  2GU5 A;  1N51 A;  4FLJ A;  4U6E A;  2B3K A;  1WL9 A;  4FLI A;  2EVC A;  5CE6 A;  1KP0 A;  4RZY A;  5FCH A;  2BWX A;  1QXY A;  4ZNG A;  5E5B A;  4ZWU A;  2OAZ A;  4U6J A;  3MAT A;  1C21 A;  2BWV A;  1JAW A;  3FM3 A;  3ROR A;  2Q93 A;  1WL6 A;  2Q96 A;  1B6A A;  2GU7 A;  4Z7M A;  3PKE A;  4A6V A;  4A6W A;  3IU7 A;  4U75 A;  1BN5 A;  4FUK A;  1W2M A;  2BWS A;  1O0X A;  1WLR A;  3FMR A;  4S01 A;  4U69 A;  4IKR A;  4OOK A;  4R60 A;  4S2R P;  2P99 A;  2ADU A;  2BWT A;  1C24 A;  4MAT A;  4PV4 A;  5CIK A;  3MR1 A;  4HXX A;  2GU4 A;  5JFR A;  2GG3 A;  2GG0 A;  2NQ7 A;  2GGC A;  2BHC A;  2V6C A;  3PKB A;  3PKA A;  5D6E A;  4RZZ A;  3TB5 A;  2BH3 A;  3TAV A;  1XNZ A;  2IW2 A;  3PKD A;  4IKU A;  3L7G A;  1WBQ A;  3CB6 A;  3Q6D A;  1YVM A;  4FKC A;  1B59 A;  1WY2 A;  4IKT A;  3CB5 A;  4IPA A;  3CTZ A;  1WN1 A;  4ZWP A;  4S2T P;  2BWU A;  1MAT A;  2GU6 A;  2B3L A;  2GG9 A;  4FLL A;  2NQ6 A;  2BHB A;  2GGB A;  4IU6 A;  1BOA A;  2BWW A;  4RGZ 1;  5FCF A;  4U1B A;  3PKC A;  4U70 A;  2B3H A;  4FO7 A;  4FLK A;  5CDL A;  4U6C A;  2EA4 A;  1XGS A;  1QXZ A;  4IEC A;  2V3X A;  1C23 A;  1QZY A;  4FO8 A;  2P98 A;  1R58 A;  1R5H A;  5JI6 A;  2BWY A;  1YW8 A;  3D27 A;  3IU8 A;  1KQ9 A;  2GA2 A;  4IDY A;  5D6F A;  1YW7 A;  2P9A A;  1M35 A;  1YJ3 A;  4EGE A;  1XGM A;  1CHM A;  3BIT A;  4U71 A;  3BIQ A;  1XGO A;  2EA2 A;  3FMQ A;  4PNC A;  2G6P A;  3BIP A;  4U6W A;  4U6Z A;  1A16 A;  2MAT A;  2BHA A;  1R5G A;  3IG4 A;  2GG2 A;  2V3Y A;  1C27 A;  2GZ5 A;  1C22 A;  2Q95 A;  2Q94 A;  4IF7 A;  5CDV A;  4IKS A;  4U76 A;  3S6B A;  5JHU A;  1WKM A;  2Q8K A;  2BHD A;  3RVA A;  3MX6 A;  4KM3 A;  2GG5 A;  5CDE A;  1Y1N A;  2Q92 A;  2V3Z A;  5CNX A;  4QR8 A;  4B28 A;  5CLS A;  1YW9 A;  1W7V A;  4JUQ A;  2HOW A;  3IU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...