2GTXA

Structural basis of catalysis by mononuclear methionine aminopeptidase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 86
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gtxA00
4U6WA 2BHCA 4IKSA 1B59A 1Y1NA 4U69A 2V3XA 5JFRA 3IU9A 3RVAA 3MX6A 4IKTA 4U71A 3BITA 4MATA 1C24A 2V3ZA 2BHBA 4JUQA 5CLSA 1W7VA 2Q95A 4IPAA 1PV9A 4U70A 3BIPA 4IF7A 2BH3A 4B28A 1KQ9A 1JAWA 1WL6A 5D6EA 5D6FA 2BWSA 2P98A 1XGNA 4S00A 2P99A 2BWVA 4A6VA 1YVMA 3PKCA 5CE6A 4U76A 2BB7A 2BHAA 3MATA 3CB5A 3IU7A 1M35A 2EVMA 2OAZA 2GG3A 2GG9A 2EVCA 4ZWOA 5FCHA 1O0XA 3PKBA 2EA2A 1N51A 1MATA 1R5GA 3TAVA 1XGSA 1WN1A 3PKEA 4U1BA 2B3KA 2NQ6A 4OOKA 3FMRA 4U6EA 3TB5A 3S6BA 2BWTA 2Q93A 2V6CA 4FLLA 1WBQA 3PKDA 2GU7A 2MATA 4R60A 4ZNGA 2GG7A 4PNCA 2GZ5A 4U75A 4ZWUA 4FUKA 3BIQA 4S01A 2ZSGA 1QXWA 2GG8A 2DFIA 1YW8A 2Q8KA 4IKUA 4U6ZA 5JI6A 1A16A 4S2TP 2GU5A 1BN5A 4S2RP 4FLKA 4QR8A 2GU4A 1B6AA 2IW2A 2GG0A 3D27A 3L24A 4Z7MA 2GA2A 3MR1A 1BOAA 4KM3A 4RGZ1 3IG4A 4FLJA 2HOWA 2EA4A 1WLRA 4HXXA 4PV4A 1QXZA 4FKCA 4IU6A 3RORA 2GU6A 3CTZA 2GGCA 4U6CA 2NQ7A 5CDLA 2EVOA 2Q94A 1W2MA 2G6PA 2GTXA 2P9AA 5CDVA 4ZWPA 2B3HA 2Q96A 1C27A 5FCFA 1WY2A 3IU8A 1R58A 2Q92A 2OKNA 4FLIA 5CIKA 4A6WA 1C21A 2ADUA 2GGBA 1C22A 3FMQA 4IKRA 5CDEA 1XGMA 2BWXA 3Q6DA 2B3LA 2BWYA 1R5HA 1CHMA 2GG5A 4U73A 4IECA 1YW9A 2V3YA 3L7GA 5E5BA 1C23A 1WL9A 4U6JA 3CB6A 1XGOA 1KP0A 4FO8A 4EGEA 1XNZA 2GG2A 2BWUA 3PKAA 1QXYA 1WKMA 4FO7A 5JHUA 2BWWA 1QZYA 4RZZA 2BN7A 1YW7A 1KQ0A 1YJ3A 4IDYA 2BHDA 4RZYA 3FM3A 5CNXA
chains in the Genus database with same CATH superfamily
4U6WA 2BHCA 4IKSA 1B59A 1Y1NA 4U69A 2V3XA 5JFRA 3IU9A 3RVAA 3MX6A 4IKTA 4U71A 3BITA 4MATA 1C24A 2V3ZA 2BHBA 4JUQA 5CLSA 1W7VA 2Q95A 4IPAA 1PV9A 4U70A 3BIPA 4IF7A 2BH3A 4B28A 1KQ9A 1JAWA 1WL6A 5D6EA 5D6FA 2BWSA 2P98A 1XGNA 4S00A 2P99A 2BWVA 4A6VA 1YVMA 3PKCA 5CE6A 4U76A 2BB7A 2BHAA 3MATA 3CB5A 3IU7A 1M35A 2EVMA 2OAZA 2GG3A 2GG9A 2EVCA 4ZWOA 5FCHA 1O0XA 3PKBA 2EA2A 1N51A 1MATA 1R5GA 3TAVA 1XGSA 1WN1A 3PKEA 4U1BA 2B3KA 2NQ6A 4OOKA 3FMRA 4U6EA 3TB5A 3S6BA 2BWTA 2Q93A 2V6CA 4FLLA 1WBQA 3PKDA 2GU7A 2MATA 4R60A 4ZNGA 2GG7A 4PNCA 2GZ5A 4U75A 4ZWUA 4FUKA 3BIQA 4S01A 2ZSGA 1QXWA 2GG8A 2DFIA 1YW8A 2Q8KA 4IKUA 4U6ZA 5JI6A 1A16A 4S2TP 2GU5A 1BN5A 4S2RP 4FLKA 4QR8A 2GU4A 1B6AA 2IW2A 2GG0A 3D27A 3L24A 4Z7MA 2GA2A 3MR1A 1BOAA 4KM3A 4RGZ1 3IG4A 4FLJA 2HOWA 2EA4A 1WLRA 4HXXA 4PV4A 1QXZA 4FKCA 4IU6A 3RORA 2GU6A 3CTZA 2GGCA 4U6CA 2NQ7A 5CDLA 2EVOA 2Q94A 1W2MA 2G6PA 2GTXA 2P9AA 5CDVA 4ZWPA 2B3HA 2Q96A 1C27A 5FCFA 1WY2A 3IU8A 1R58A 2Q92A 2OKNA 4FLIA 5CIKA 4A6WA 1C21A 2ADUA 2GGBA 1C22A 3FMQA 4IKRA 5CDEA 1XGMA 2BWXA 3Q6DA 2B3LA 2BWYA 1R5HA 1CHMA 2GG5A 4U73A 4IECA 1YW9A 2V3YA 3L7GA 5E5BA 1C23A 1WL9A 4U6JA 3CB6A 1XGOA 1KP0A 4FO8A 4EGEA 1XNZA 2GG2A 2BWUA 3PKAA 1QXYA 1WKMA 4FO7A 5JHUA 2BWWA 1QZYA 4RZZA 2BN7A 1YW7A 1KQ0A 1YJ3A 4IDYA 2BHDA 4RZYA 3FM3A 5CNXA
chains in the Genus database with same CATH topology
4U6WA 2BHCA 4IKSA 1B59A 1Y1NA 4U69A 2V3XA 5JFRA 3IU9A 3RVAA 3MX6A 4IKTA 4U71A 3BITA 4MATA 1C24A 2V3ZA 2BHBA 4JUQA 5CLSA 1W7VA 2Q95A 4IPAA 1PV9A 4U70A 3BIPA 4IF7A 2BH3A 4B28A 1KQ9A 1JAWA 1WL6A 5D6EA 5D6FA 2BWSA 2P98A 1XGNA 4S00A 2P99A 2BWVA 4A6VA 1YVMA 3PKCA 5CE6A 4U76A 2BB7A 2BHAA 3MATA 3CB5A 3IU7A 1M35A 2EVMA 2OAZA 2GG3A 2GG9A 2EVCA 4ZWOA 5FCHA 1O0XA 3PKBA 2EA2A 1N51A 1MATA 1R5GA 3TAVA 1XGSA 1WN1A 3PKEA 4U1BA 2B3KA 2NQ6A 4OOKA 3FMRA 4U6EA 3TB5A 3S6BA 2BWTA 2Q93A 2V6CA 4FLLA 1WBQA 3PKDA 2GU7A 2MATA 4R60A 4ZNGA 2GG7A 4PNCA 2GZ5A 4U75A 4ZWUA 4FUKA 3BIQA 4S01A 2ZSGA 1QXWA 2GG8A 2DFIA 1YW8A 2Q8KA 4IKUA 4U6ZA 5JI6A 1A16A 4S2TP 2GU5A 1BN5A 4S2RP 4FLKA 4QR8A 2GU4A 1B6AA 2IW2A 2GG0A 3D27A 3L24A 4Z7MA 2GA2A 3MR1A 1BOAA 4KM3A 4RGZ1 3IG4A 4FLJA 2HOWA 2EA4A 1WLRA 4HXXA 4PV4A 1QXZA 4FKCA 4IU6A 3RORA 2GU6A 3CTZA 2GGCA 4U6CA 2NQ7A 5CDLA 2EVOA 2Q94A 1W2MA 2G6PA 2GTXA 2P9AA 5CDVA 4ZWPA 2B3HA 2Q96A 1C27A 5FCFA 1WY2A 3IU8A 1R58A 2Q92A 2OKNA 4FLIA 5CIKA 4A6WA 1C21A 2ADUA 2GGBA 1C22A 3FMQA 4IKRA 5CDEA 1XGMA 2BWXA 3Q6DA 2B3LA 2BWYA 1R5HA 1CHMA 2GG5A 4U73A 4IECA 1YW9A 2V3YA 3L7GA 5E5BA 1C23A 1WL9A 4U6JA 3CB6A 1XGOA 1KP0A 4FO8A 4EGEA 1XNZA 2GG2A 2BWUA 3PKAA 1QXYA 1WKMA 4FO7A 5JHUA 2BWWA 1QZYA 4RZZA 2BN7A 1YW7A 1KQ0A 1YJ3A 4IDYA 2BHDA 4RZYA 3FM3A 5CNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6W A;  2BHC A;  4IKS A;  1B59 A;  1Y1N A;  4U69 A;  2V3X A;  5JFR A;  3IU9 A;  3RVA A;  3MX6 A;  4IKT A;  4U71 A;  3BIT A;  4MAT A;  1C24 A;  2V3Z A;  2BHB A;  4JUQ A;  5CLS A;  1W7V A;  2Q95 A;  4IPA A;  1PV9 A;  4U70 A;  3BIP A;  4IF7 A;  2BH3 A;  4B28 A;  1KQ9 A;  1JAW A;  1WL6 A;  5D6E A;  5D6F A;  2BWS A;  2P98 A;  1XGN A;  4S00 A;  2P99 A;  2BWV A;  4A6V A;  1YVM A;  3PKC A;  5CE6 A;  4U76 A;  2BB7 A;  2BHA A;  3MAT A;  3CB5 A;  3IU7 A;  1M35 A;  2EVM A;  2OAZ A;  2GG3 A;  2GG9 A;  2EVC A;  4ZWO A;  5FCH A;  1O0X A;  3PKB A;  2EA2 A;  1N51 A;  1MAT A;  1R5G A;  3TAV A;  1XGS A;  1WN1 A;  3PKE A;  4U1B A;  2B3K A;  2NQ6 A;  4OOK A;  3FMR A;  4U6E A;  3TB5 A;  3S6B A;  2BWT A;  2Q93 A;  2V6C A;  4FLL A;  1WBQ A;  3PKD A;  2GU7 A;  2MAT A;  4R60 A;  4ZNG A;  2GG7 A;  4PNC A;  2GZ5 A;  4U75 A;  4ZWU A;  4FUK A;  3BIQ A;  4S01 A;  2ZSG A;  1QXW A;  2GG8 A;  2DFI A;  1YW8 A;  2Q8K A;  4IKU A;  4U6Z A;  5JI6 A;  1A16 A;  4S2T P;  2GU5 A;  1BN5 A;  4S2R P;  4FLK A;  4QR8 A;  2GU4 A;  1B6A A;  2IW2 A;  2GG0 A;  3D27 A;  3L24 A;  4Z7M A;  2GA2 A;  3MR1 A;  1BOA A;  4KM3 A;  4RGZ 1;  3IG4 A;  4FLJ A;  2HOW A;  2EA4 A;  1WLR A;  4HXX A;  4PV4 A;  1QXZ A;  4FKC A;  4IU6 A;  3ROR A;  2GU6 A;  3CTZ A;  2GGC A;  4U6C A;  2NQ7 A;  5CDL A;  2EVO A;  2Q94 A;  1W2M A;  2G6P A;  2GTX A;  2P9A A;  5CDV A;  4ZWP A;  2B3H A;  2Q96 A;  1C27 A;  5FCF A;  1WY2 A;  3IU8 A;  1R58 A;  2Q92 A;  2OKN A;  4FLI A;  5CIK A;  4A6W A;  1C21 A;  2ADU A;  2GGB A;  1C22 A;  3FMQ A;  4IKR A;  5CDE A;  1XGM A;  2BWX A;  3Q6D A;  2B3L A;  2BWY A;  1R5H A;  1CHM A;  2GG5 A;  4U73 A;  4IEC A;  1YW9 A;  2V3Y A;  3L7G A;  5E5B A;  1C23 A;  1WL9 A;  4U6J A;  3CB6 A;  1XGO A;  1KP0 A;  4FO8 A;  4EGE A;  1XNZ A;  2GG2 A;  2BWU A;  3PKA A;  1QXY A;  1WKM A;  4FO7 A;  5JHU A;  2BWW A;  1QZY A;  4RZZ A;  2BN7 A;  1YW7 A;  1KQ0 A;  1YJ3 A;  4IDY A;  2BHD A;  4RZY A;  3FM3 A;  5CNX A; 
#chains in the Genus database with same CATH topology
 4U6W A;  2BHC A;  4IKS A;  1B59 A;  1Y1N A;  4U69 A;  2V3X A;  5JFR A;  3IU9 A;  3RVA A;  3MX6 A;  4IKT A;  4U71 A;  3BIT A;  4MAT A;  1C24 A;  2V3Z A;  2BHB A;  4JUQ A;  5CLS A;  1W7V A;  2Q95 A;  4IPA A;  1PV9 A;  4U70 A;  3BIP A;  4IF7 A;  2BH3 A;  4B28 A;  1KQ9 A;  1JAW A;  1WL6 A;  5D6E A;  5D6F A;  2BWS A;  2P98 A;  1XGN A;  4S00 A;  2P99 A;  2BWV A;  4A6V A;  1YVM A;  3PKC A;  5CE6 A;  4U76 A;  2BB7 A;  2BHA A;  3MAT A;  3CB5 A;  3IU7 A;  1M35 A;  2EVM A;  2OAZ A;  2GG3 A;  2GG9 A;  2EVC A;  4ZWO A;  5FCH A;  1O0X A;  3PKB A;  2EA2 A;  1N51 A;  1MAT A;  1R5G A;  3TAV A;  1XGS A;  1WN1 A;  3PKE A;  4U1B A;  2B3K A;  2NQ6 A;  4OOK A;  3FMR A;  4U6E A;  3TB5 A;  3S6B A;  2BWT A;  2Q93 A;  2V6C A;  4FLL A;  1WBQ A;  3PKD A;  2GU7 A;  2MAT A;  4R60 A;  4ZNG A;  2GG7 A;  4PNC A;  2GZ5 A;  4U75 A;  4ZWU A;  4FUK A;  3BIQ A;  4S01 A;  2ZSG A;  1QXW A;  2GG8 A;  2DFI A;  1YW8 A;  2Q8K A;  4IKU A;  4U6Z A;  5JI6 A;  1A16 A;  4S2T P;  2GU5 A;  1BN5 A;  4S2R P;  4FLK A;  4QR8 A;  2GU4 A;  1B6A A;  2IW2 A;  2GG0 A;  3D27 A;  3L24 A;  4Z7M A;  2GA2 A;  3MR1 A;  1BOA A;  4KM3 A;  4RGZ 1;  3IG4 A;  4FLJ A;  2HOW A;  2EA4 A;  1WLR A;  4HXX A;  4PV4 A;  1QXZ A;  4FKC A;  4IU6 A;  3ROR A;  2GU6 A;  3CTZ A;  2GGC A;  4U6C A;  2NQ7 A;  5CDL A;  2EVO A;  2Q94 A;  1W2M A;  2G6P A;  2GTX A;  2P9A A;  5CDV A;  4ZWP A;  2B3H A;  2Q96 A;  1C27 A;  5FCF A;  1WY2 A;  3IU8 A;  1R58 A;  2Q92 A;  2OKN A;  4FLI A;  5CIK A;  4A6W A;  1C21 A;  2ADU A;  2GGB A;  1C22 A;  3FMQ A;  4IKR A;  5CDE A;  1XGM A;  2BWX A;  3Q6D A;  2B3L A;  2BWY A;  1R5H A;  1CHM A;  2GG5 A;  4U73 A;  4IEC A;  1YW9 A;  2V3Y A;  3L7G A;  5E5B A;  1C23 A;  1WL9 A;  4U6J A;  3CB6 A;  1XGO A;  1KP0 A;  4FO8 A;  4EGE A;  1XNZ A;  2GG2 A;  2BWU A;  3PKA A;  1QXY A;  1WKM A;  4FO7 A;  5JHU A;  2BWW A;  1QZY A;  4RZZ A;  2BN7 A;  1YW7 A;  1KQ0 A;  1YJ3 A;  4IDY A;  2BHD A;  4RZY A;  3FM3 A;  5CNX A; 
#chains in the Genus database with same CATH homology
 4U6W A;  2BHC A;  4IKS A;  1B59 A;  1Y1N A;  4U69 A;  2V3X A;  5JFR A;  3IU9 A;  3RVA A;  3MX6 A;  4IKT A;  4U71 A;  3BIT A;  4MAT A;  1C24 A;  2V3Z A;  2BHB A;  4JUQ A;  5CLS A;  1W7V A;  2Q95 A;  4IPA A;  1PV9 A;  4U70 A;  3BIP A;  4IF7 A;  2BH3 A;  4B28 A;  1KQ9 A;  1JAW A;  1WL6 A;  5D6E A;  5D6F A;  2BWS A;  2P98 A;  1XGN A;  4S00 A;  2P99 A;  2BWV A;  4A6V A;  1YVM A;  3PKC A;  5CE6 A;  4U76 A;  2BB7 A;  2BHA A;  3MAT A;  3CB5 A;  3IU7 A;  1M35 A;  2EVM A;  2OAZ A;  2GG3 A;  2GG9 A;  2EVC A;  4ZWO A;  5FCH A;  1O0X A;  3PKB A;  2EA2 A;  1N51 A;  1MAT A;  1R5G A;  3TAV A;  1XGS A;  1WN1 A;  3PKE A;  4U1B A;  2B3K A;  2NQ6 A;  4OOK A;  3FMR A;  4U6E A;  3TB5 A;  3S6B A;  2BWT A;  2Q93 A;  2V6C A;  4FLL A;  1WBQ A;  3PKD A;  2GU7 A;  2MAT A;  4R60 A;  4ZNG A;  2GG7 A;  4PNC A;  2GZ5 A;  4U75 A;  4ZWU A;  4FUK A;  3BIQ A;  4S01 A;  2ZSG A;  1QXW A;  2GG8 A;  2DFI A;  1YW8 A;  2Q8K A;  4IKU A;  4U6Z A;  5JI6 A;  1A16 A;  4S2T P;  2GU5 A;  1BN5 A;  4S2R P;  4FLK A;  4QR8 A;  2GU4 A;  1B6A A;  2IW2 A;  2GG0 A;  3D27 A;  3L24 A;  4Z7M A;  2GA2 A;  3MR1 A;  1BOA A;  4KM3 A;  4RGZ 1;  3IG4 A;  4FLJ A;  2HOW A;  2EA4 A;  1WLR A;  4HXX A;  4PV4 A;  1QXZ A;  4FKC A;  4IU6 A;  3ROR A;  2GU6 A;  3CTZ A;  2GGC A;  4U6C A;  2NQ7 A;  5CDL A;  2EVO A;  2Q94 A;  1W2M A;  2G6P A;  2GTX A;  2P9A A;  5CDV A;  4ZWP A;  2B3H A;  2Q96 A;  1C27 A;  5FCF A;  1WY2 A;  3IU8 A;  1R58 A;  2Q92 A;  2OKN A;  4FLI A;  5CIK A;  4A6W A;  1C21 A;  2ADU A;  2GGB A;  1C22 A;  3FMQ A;  4IKR A;  5CDE A;  1XGM A;  2BWX A;  3Q6D A;  2B3L A;  2BWY A;  1R5H A;  1CHM A;  2GG5 A;  4U73 A;  4IEC A;  1YW9 A;  2V3Y A;  3L7G A;  5E5B A;  1C23 A;  1WL9 A;  4U6J A;  3CB6 A;  1XGO A;  1KP0 A;  4FO8 A;  4EGE A;  1XNZ A;  2GG2 A;  2BWU A;  3PKA A;  1QXY A;  1WKM A;  4FO7 A;  5JHU A;  2BWW A;  1QZY A;  4RZZ A;  2BN7 A;  1YW7 A;  1KQ0 A;  1YJ3 A;  4IDY A;  2BHD A;  4RZY A;  3FM3 A;  5CNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...