2GG0A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
b'ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
molecule tags Hydrolase
source organism Escherichia coli k12
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg0A00
4IKRA 4S2RP 4U6CA 2BHCA 3MR1A 2BWWA 4HXXA 1YW8A 4FUKA 4RZYA 2Q95A 4QR8A 4U6ZA 2GG3A 2GA2A 5E5BA 2GG5A 1BOAA 4FO7A 5D6EA 5JI6A 2NQ6A 1QXYA 4FKCA 3D27A 3IU8A 3RVAA 2BWSA 2BHDA 3FM3A 4ZWOA 1PV9A 2GZ5A 3PKCA 1WN1A 2GGBA 3TAVA 4S00A 1WLRA 3PKEA 3BITA 4JUQA 3L7GA 3PKDA 4U70A 2EA4A 1O0XA 5CNXA 5FCHA 1WKMA 1QXZA 2V3YA 3RORA 2GG2A 2GU5A 2Q96A 4IF7A 2Q92A 4RZZA 2BWYA 1XGSA 2BN7A 1R58A 3IG4A 4U73A 2HOWA 3CTZA 2NQ7A 4PNCA 4U6EA 2Q8KA 4U75A 2GU6A 5JHUA 1QZYA 5CDEA 1B6AA 1MATA 1WL6A 2EVCA 4U6JA 3BIPA 1C21A 1C27A 3PKBA 4IKTA 2GG8A 5CIKA 2Q94A 4A6WA 2BB7A 1B59A 4IKSA 2MATA 2Q93A 4U6WA 5D6FA 4ZWUA 4IU6A 2OAZA 2BWVA 1BN5A 2ZSGA 2GGCA 2GG7A 4IECA 2GU7A 2EVMA 1YVMA 2BHAA 4MATA 2BWTA 2P9AA 5JFRA 2P99A 1WY2A 3TB5A 4R60A 1XGOA 1Y1NA 1R5GA 4FO8A 4IKUA 4A6VA 2B3LA 1YW7A 1KP0A 2P98A 3BIQA 2BWUA 2GG9A 1WBQA 4U76A 5CDVA 4KM3A 3S6BA 3L24A 1W2MA 2ADUA 2EA2A 4B28A 5FCFA 2B3KA 1CHMA 4ZNGA 4S2TP 4PV4A 4IDYA 1N51A 2DFIA 1C24A 2V3XA 1M35A 1KQ0A 3MATA 4OOKA 1WL9A 4EGEA 2EVOA 4U71A 1QXWA 1A16A 3CB5A 4S01A 2G6PA 2BHBA 3IU9A 4FLKA 1XGNA 1XGMA 1JAWA 3CB6A 3FMRA 1R5HA 1W7VA 4U1BA 1KQ9A 5CE6A 2OKNA 2BWXA 3PKAA 4ZWPA 2IW2A 4FLIA 1C23A 2V3ZA 5CDLA 2BH3A 4FLLA 4IPAA 4U69A 2GG0A 4Z7MA 3Q6DA 2GTXA 1XNZA 2GU4A 3MX6A 4RGZ1 3IU7A 1YW9A 2V6CA 3FMQA 2B3HA 4FLJA 1C22A 5CLSA 1YJ3A
chains in the Genus database with same CATH superfamily
4IKRA 4S2RP 4U6CA 2BHCA 3MR1A 2BWWA 4HXXA 1YW8A 4FUKA 4RZYA 2Q95A 4QR8A 4U6ZA 2GG3A 2GA2A 5E5BA 2GG5A 1BOAA 4FO7A 5D6EA 5JI6A 2NQ6A 1QXYA 4FKCA 3D27A 3IU8A 3RVAA 2BWSA 2BHDA 3FM3A 4ZWOA 1PV9A 2GZ5A 3PKCA 1WN1A 2GGBA 3TAVA 4S00A 1WLRA 3PKEA 3BITA 4JUQA 3L7GA 3PKDA 4U70A 2EA4A 1O0XA 5CNXA 5FCHA 1WKMA 1QXZA 2V3YA 3RORA 2GG2A 2GU5A 2Q96A 4IF7A 2Q92A 4RZZA 2BWYA 1XGSA 2BN7A 1R58A 3IG4A 4U73A 2HOWA 3CTZA 2NQ7A 4PNCA 4U6EA 2Q8KA 4U75A 2GU6A 5JHUA 1QZYA 5CDEA 1B6AA 1MATA 1WL6A 2EVCA 4U6JA 3BIPA 1C21A 1C27A 3PKBA 4IKTA 2GG8A 5CIKA 2Q94A 4A6WA 2BB7A 1B59A 4IKSA 2MATA 2Q93A 4U6WA 5D6FA 4ZWUA 4IU6A 2OAZA 2BWVA 1BN5A 2ZSGA 2GGCA 2GG7A 4IECA 2GU7A 2EVMA 1YVMA 2BHAA 4MATA 2BWTA 2P9AA 5JFRA 2P99A 1WY2A 3TB5A 4R60A 1XGOA 1Y1NA 1R5GA 4FO8A 4IKUA 4A6VA 2B3LA 1YW7A 1KP0A 2P98A 3BIQA 2BWUA 2GG9A 1WBQA 4U76A 5CDVA 4KM3A 3S6BA 3L24A 1W2MA 2ADUA 2EA2A 4B28A 5FCFA 2B3KA 1CHMA 4ZNGA 4S2TP 4PV4A 4IDYA 1N51A 2DFIA 1C24A 2V3XA 1M35A 1KQ0A 3MATA 4OOKA 1WL9A 4EGEA 2EVOA 4U71A 1QXWA 1A16A 3CB5A 4S01A 2G6PA 2BHBA 3IU9A 4FLKA 1XGNA 1XGMA 1JAWA 3CB6A 3FMRA 1R5HA 1W7VA 4U1BA 1KQ9A 5CE6A 2OKNA 2BWXA 3PKAA 4ZWPA 2IW2A 4FLIA 1C23A 2V3ZA 5CDLA 2BH3A 4FLLA 4IPAA 4U69A 2GG0A 4Z7MA 3Q6DA 2GTXA 1XNZA 2GU4A 3MX6A 4RGZ1 3IU7A 1YW9A 2V6CA 3FMQA 2B3HA 4FLJA 1C22A 5CLSA 1YJ3A
chains in the Genus database with same CATH topology
4IKRA 4S2RP 4U6CA 2BHCA 3MR1A 2BWWA 4HXXA 1YW8A 4FUKA 4RZYA 2Q95A 4QR8A 4U6ZA 2GG3A 2GA2A 5E5BA 2GG5A 1BOAA 4FO7A 5D6EA 5JI6A 2NQ6A 1QXYA 4FKCA 3D27A 3IU8A 3RVAA 2BWSA 2BHDA 3FM3A 4ZWOA 1PV9A 2GZ5A 3PKCA 1WN1A 2GGBA 3TAVA 4S00A 1WLRA 3PKEA 3BITA 4JUQA 3L7GA 3PKDA 4U70A 2EA4A 1O0XA 5CNXA 5FCHA 1WKMA 1QXZA 2V3YA 3RORA 2GG2A 2GU5A 2Q96A 4IF7A 2Q92A 4RZZA 2BWYA 1XGSA 2BN7A 1R58A 3IG4A 4U73A 2HOWA 3CTZA 2NQ7A 4PNCA 4U6EA 2Q8KA 4U75A 2GU6A 5JHUA 1QZYA 5CDEA 1B6AA 1MATA 1WL6A 2EVCA 4U6JA 3BIPA 1C21A 1C27A 3PKBA 4IKTA 2GG8A 5CIKA 2Q94A 4A6WA 2BB7A 1B59A 4IKSA 2MATA 2Q93A 4U6WA 5D6FA 4ZWUA 4IU6A 2OAZA 2BWVA 1BN5A 2ZSGA 2GGCA 2GG7A 4IECA 2GU7A 2EVMA 1YVMA 2BHAA 4MATA 2BWTA 2P9AA 5JFRA 2P99A 1WY2A 3TB5A 4R60A 1XGOA 1Y1NA 1R5GA 4FO8A 4IKUA 4A6VA 2B3LA 1YW7A 1KP0A 2P98A 3BIQA 2BWUA 2GG9A 1WBQA 4U76A 5CDVA 4KM3A 3S6BA 3L24A 1W2MA 2ADUA 2EA2A 4B28A 5FCFA 2B3KA 1CHMA 4ZNGA 4S2TP 4PV4A 4IDYA 1N51A 2DFIA 1C24A 2V3XA 1M35A 1KQ0A 3MATA 4OOKA 1WL9A 4EGEA 2EVOA 4U71A 1QXWA 1A16A 3CB5A 4S01A 2G6PA 2BHBA 3IU9A 4FLKA 1XGNA 1XGMA 1JAWA 3CB6A 3FMRA 1R5HA 1W7VA 4U1BA 1KQ9A 5CE6A 2OKNA 2BWXA 3PKAA 4ZWPA 2IW2A 4FLIA 1C23A 2V3ZA 5CDLA 2BH3A 4FLLA 4IPAA 4U69A 2GG0A 4Z7MA 3Q6DA 2GTXA 1XNZA 2GU4A 3MX6A 4RGZ1 3IU7A 1YW9A 2V6CA 3FMQA 2B3HA 4FLJA 1C22A 5CLSA 1YJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKR A;  4S2R P;  4U6C A;  2BHC A;  3MR1 A;  2BWW A;  4HXX A;  1YW8 A;  4FUK A;  4RZY A;  2Q95 A;  4QR8 A;  4U6Z A;  2GG3 A;  2GA2 A;  5E5B A;  2GG5 A;  1BOA A;  4FO7 A;  5D6E A;  5JI6 A;  2NQ6 A;  1QXY A;  4FKC A;  3D27 A;  3IU8 A;  3RVA A;  2BWS A;  2BHD A;  3FM3 A;  4ZWO A;  1PV9 A;  2GZ5 A;  3PKC A;  1WN1 A;  2GGB A;  3TAV A;  4S00 A;  1WLR A;  3PKE A;  3BIT A;  4JUQ A;  3L7G A;  3PKD A;  4U70 A;  2EA4 A;  1O0X A;  5CNX A;  5FCH A;  1WKM A;  1QXZ A;  2V3Y A;  3ROR A;  2GG2 A;  2GU5 A;  2Q96 A;  4IF7 A;  2Q92 A;  4RZZ A;  2BWY A;  1XGS A;  2BN7 A;  1R58 A;  3IG4 A;  4U73 A;  2HOW A;  3CTZ A;  2NQ7 A;  4PNC A;  4U6E A;  2Q8K A;  4U75 A;  2GU6 A;  5JHU A;  1QZY A;  5CDE A;  1B6A A;  1MAT A;  1WL6 A;  2EVC A;  4U6J A;  3BIP A;  1C21 A;  1C27 A;  3PKB A;  4IKT A;  2GG8 A;  5CIK A;  2Q94 A;  4A6W A;  2BB7 A;  1B59 A;  4IKS A;  2MAT A;  2Q93 A;  4U6W A;  5D6F A;  4ZWU A;  4IU6 A;  2OAZ A;  2BWV A;  1BN5 A;  2ZSG A;  2GGC A;  2GG7 A;  4IEC A;  2GU7 A;  2EVM A;  1YVM A;  2BHA A;  4MAT A;  2BWT A;  2P9A A;  5JFR A;  2P99 A;  1WY2 A;  3TB5 A;  4R60 A;  1XGO A;  1Y1N A;  1R5G A;  4FO8 A;  4IKU A;  4A6V A;  2B3L A;  1YW7 A;  1KP0 A;  2P98 A;  3BIQ A;  2BWU A;  2GG9 A;  1WBQ A;  4U76 A;  5CDV A;  4KM3 A;  3S6B A;  3L24 A;  1W2M A;  2ADU A;  2EA2 A;  4B28 A;  5FCF A;  2B3K A;  1CHM A;  4ZNG A;  4S2T P;  4PV4 A;  4IDY A;  1N51 A;  2DFI A;  1C24 A;  2V3X A;  1M35 A;  1KQ0 A;  3MAT A;  4OOK A;  1WL9 A;  4EGE A;  2EVO A;  4U71 A;  1QXW A;  1A16 A;  3CB5 A;  4S01 A;  2G6P A;  2BHB A;  3IU9 A;  4FLK A;  1XGN A;  1XGM A;  1JAW A;  3CB6 A;  3FMR A;  1R5H A;  1W7V A;  4U1B A;  1KQ9 A;  5CE6 A;  2OKN A;  2BWX A;  3PKA A;  4ZWP A;  2IW2 A;  4FLI A;  1C23 A;  2V3Z A;  5CDL A;  2BH3 A;  4FLL A;  4IPA A;  4U69 A;  2GG0 A;  4Z7M A;  3Q6D A;  2GTX A;  1XNZ A;  2GU4 A;  3MX6 A;  4RGZ 1;  3IU7 A;  1YW9 A;  2V6C A;  3FMQ A;  2B3H A;  4FLJ A;  1C22 A;  5CLS A;  1YJ3 A; 
#chains in the Genus database with same CATH topology
 4IKR A;  4S2R P;  4U6C A;  2BHC A;  3MR1 A;  2BWW A;  4HXX A;  1YW8 A;  4FUK A;  4RZY A;  2Q95 A;  4QR8 A;  4U6Z A;  2GG3 A;  2GA2 A;  5E5B A;  2GG5 A;  1BOA A;  4FO7 A;  5D6E A;  5JI6 A;  2NQ6 A;  1QXY A;  4FKC A;  3D27 A;  3IU8 A;  3RVA A;  2BWS A;  2BHD A;  3FM3 A;  4ZWO A;  1PV9 A;  2GZ5 A;  3PKC A;  1WN1 A;  2GGB A;  3TAV A;  4S00 A;  1WLR A;  3PKE A;  3BIT A;  4JUQ A;  3L7G A;  3PKD A;  4U70 A;  2EA4 A;  1O0X A;  5CNX A;  5FCH A;  1WKM A;  1QXZ A;  2V3Y A;  3ROR A;  2GG2 A;  2GU5 A;  2Q96 A;  4IF7 A;  2Q92 A;  4RZZ A;  2BWY A;  1XGS A;  2BN7 A;  1R58 A;  3IG4 A;  4U73 A;  2HOW A;  3CTZ A;  2NQ7 A;  4PNC A;  4U6E A;  2Q8K A;  4U75 A;  2GU6 A;  5JHU A;  1QZY A;  5CDE A;  1B6A A;  1MAT A;  1WL6 A;  2EVC A;  4U6J A;  3BIP A;  1C21 A;  1C27 A;  3PKB A;  4IKT A;  2GG8 A;  5CIK A;  2Q94 A;  4A6W A;  2BB7 A;  1B59 A;  4IKS A;  2MAT A;  2Q93 A;  4U6W A;  5D6F A;  4ZWU A;  4IU6 A;  2OAZ A;  2BWV A;  1BN5 A;  2ZSG A;  2GGC A;  2GG7 A;  4IEC A;  2GU7 A;  2EVM A;  1YVM A;  2BHA A;  4MAT A;  2BWT A;  2P9A A;  5JFR A;  2P99 A;  1WY2 A;  3TB5 A;  4R60 A;  1XGO A;  1Y1N A;  1R5G A;  4FO8 A;  4IKU A;  4A6V A;  2B3L A;  1YW7 A;  1KP0 A;  2P98 A;  3BIQ A;  2BWU A;  2GG9 A;  1WBQ A;  4U76 A;  5CDV A;  4KM3 A;  3S6B A;  3L24 A;  1W2M A;  2ADU A;  2EA2 A;  4B28 A;  5FCF A;  2B3K A;  1CHM A;  4ZNG A;  4S2T P;  4PV4 A;  4IDY A;  1N51 A;  2DFI A;  1C24 A;  2V3X A;  1M35 A;  1KQ0 A;  3MAT A;  4OOK A;  1WL9 A;  4EGE A;  2EVO A;  4U71 A;  1QXW A;  1A16 A;  3CB5 A;  4S01 A;  2G6P A;  2BHB A;  3IU9 A;  4FLK A;  1XGN A;  1XGM A;  1JAW A;  3CB6 A;  3FMR A;  1R5H A;  1W7V A;  4U1B A;  1KQ9 A;  5CE6 A;  2OKN A;  2BWX A;  3PKA A;  4ZWP A;  2IW2 A;  4FLI A;  1C23 A;  2V3Z A;  5CDL A;  2BH3 A;  4FLL A;  4IPA A;  4U69 A;  2GG0 A;  4Z7M A;  3Q6D A;  2GTX A;  1XNZ A;  2GU4 A;  3MX6 A;  4RGZ 1;  3IU7 A;  1YW9 A;  2V6C A;  3FMQ A;  2B3H A;  4FLJ A;  1C22 A;  5CLS A;  1YJ3 A; 
#chains in the Genus database with same CATH homology
 4IKR A;  4S2R P;  4U6C A;  2BHC A;  3MR1 A;  2BWW A;  4HXX A;  1YW8 A;  4FUK A;  4RZY A;  2Q95 A;  4QR8 A;  4U6Z A;  2GG3 A;  2GA2 A;  5E5B A;  2GG5 A;  1BOA A;  4FO7 A;  5D6E A;  5JI6 A;  2NQ6 A;  1QXY A;  4FKC A;  3D27 A;  3IU8 A;  3RVA A;  2BWS A;  2BHD A;  3FM3 A;  4ZWO A;  1PV9 A;  2GZ5 A;  3PKC A;  1WN1 A;  2GGB A;  3TAV A;  4S00 A;  1WLR A;  3PKE A;  3BIT A;  4JUQ A;  3L7G A;  3PKD A;  4U70 A;  2EA4 A;  1O0X A;  5CNX A;  5FCH A;  1WKM A;  1QXZ A;  2V3Y A;  3ROR A;  2GG2 A;  2GU5 A;  2Q96 A;  4IF7 A;  2Q92 A;  4RZZ A;  2BWY A;  1XGS A;  2BN7 A;  1R58 A;  3IG4 A;  4U73 A;  2HOW A;  3CTZ A;  2NQ7 A;  4PNC A;  4U6E A;  2Q8K A;  4U75 A;  2GU6 A;  5JHU A;  1QZY A;  5CDE A;  1B6A A;  1MAT A;  1WL6 A;  2EVC A;  4U6J A;  3BIP A;  1C21 A;  1C27 A;  3PKB A;  4IKT A;  2GG8 A;  5CIK A;  2Q94 A;  4A6W A;  2BB7 A;  1B59 A;  4IKS A;  2MAT A;  2Q93 A;  4U6W A;  5D6F A;  4ZWU A;  4IU6 A;  2OAZ A;  2BWV A;  1BN5 A;  2ZSG A;  2GGC A;  2GG7 A;  4IEC A;  2GU7 A;  2EVM A;  1YVM A;  2BHA A;  4MAT A;  2BWT A;  2P9A A;  5JFR A;  2P99 A;  1WY2 A;  3TB5 A;  4R60 A;  1XGO A;  1Y1N A;  1R5G A;  4FO8 A;  4IKU A;  4A6V A;  2B3L A;  1YW7 A;  1KP0 A;  2P98 A;  3BIQ A;  2BWU A;  2GG9 A;  1WBQ A;  4U76 A;  5CDV A;  4KM3 A;  3S6B A;  3L24 A;  1W2M A;  2ADU A;  2EA2 A;  4B28 A;  5FCF A;  2B3K A;  1CHM A;  4ZNG A;  4S2T P;  4PV4 A;  4IDY A;  1N51 A;  2DFI A;  1C24 A;  2V3X A;  1M35 A;  1KQ0 A;  3MAT A;  4OOK A;  1WL9 A;  4EGE A;  2EVO A;  4U71 A;  1QXW A;  1A16 A;  3CB5 A;  4S01 A;  2G6P A;  2BHB A;  3IU9 A;  4FLK A;  1XGN A;  1XGM A;  1JAW A;  3CB6 A;  3FMR A;  1R5H A;  1W7V A;  4U1B A;  1KQ9 A;  5CE6 A;  2OKN A;  2BWX A;  3PKA A;  4ZWP A;  2IW2 A;  4FLI A;  1C23 A;  2V3Z A;  5CDL A;  2BH3 A;  4FLL A;  4IPA A;  4U69 A;  2GG0 A;  4Z7M A;  3Q6D A;  2GTX A;  1XNZ A;  2GU4 A;  3MX6 A;  4RGZ 1;  3IU7 A;  1YW9 A;  2V6C A;  3FMQ A;  2B3H A;  4FLJ A;  1C22 A;  5CLS A;  1YJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...