2GG0A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg0A00
2HOWA 1QXZA 1R5HA 2ZSGA 4U6JA 4U70A 5CDVA 2MATA 1YW8A 4U6CA 5JHUA 1XGSA 2GU5A 1C22A 2EVCA 4U71A 4IU6A 4ZWPA 5CDEA 4OOKA 5JFRA 2B3LA 3IU8A 1R58A 1KQ9A 4IPAA 2V6CA 4U76A 4ZWOA 1KQ0A 4FLJA 4IKUA 4Z7MA 2IW2A 2GU4A 4U73A 1YVMA 4FUKA 4IDYA 1WY2A 2BWTA 3PKCA 3RORA 2BWWA 2GGCA 1C23A 2EVMA 3D27A 3IG4A 3MX6A 5FCFA 2BB7A 1WBQA 2V3XA 2GG7A 1WL9A 1YJ3A 2P98A 3BITA 3BIPA 3PKBA 5CNXA 2GG9A 1C24A 2Q96A 2EVOA 3CB6A 3TAVA 3PKDA 1WL6A 3FM3A 4A6VA 2GU7A 4IKRA 3BIQA 4IKTA 2BHAA 1MATA 1O0XA 4FO7A 2GU6A 3FMQA 4PNCA 4A6WA 2BHCA 3MATA 4U6WA 2Q95A 2BH3A 5JI6A 4U6EA 4ZNGA 1YW9A 4HXXA 3CTZA 1XGMA 4R60A 3IU9A 4FLKA 5D6FA 1QXWA 2BWYA 2V3YA 1XGOA 2GG2A 4JUQA 5D6EA 2V3ZA 4RZYA 2P9AA 1WLRA 4FLIA 5CIKA 1B6AA 4IECA 1XGNA 2BN7A 2GG3A 4B28A 3RVAA 4S01A 1PV9A 2EA4A 2GG0A 2Q93A 1Y1NA 2OKNA 2GTXA 4ZWUA 1KP0A 4QR8A 1R5GA 5E5BA 1A16A 4FKCA 2Q92A 4MATA 5FCHA 3PKAA 2B3HA 2Q94A 4EGEA 2GA2A 2BHBA 2BWSA 4U1BA 3Q6DA 2BWXA 4IKSA 4PV4A 3L7GA 5CDLA 1QXYA 2GG8A 1BN5A 1C21A 1CHMA 2G6PA 4RGZ1 4S00A 4S2RP 3IU7A 4RZZA 4U69A 5CLSA 2BWUA 3TB5A 2GZ5A 3L24A 1N51A 2EA2A 5CE6A 1WKMA 1YW7A 2GGBA 3MR1A 4FO8A 2B3KA 1JAWA 3FMRA 4FLLA 1W2MA 2BWVA 2BHDA 1XNZA 1C27A 1QZYA 2NQ7A 3CB5A 1B59A 3PKEA 1WN1A 2OAZA 1BOAA 2DFIA 2NQ6A 1M35A 2Q8KA 2GG5A 2ADUA 4KM3A 4IF7A 3S6BA 4U6ZA 1W7VA 4U75A 4S2TP 2P99A
chains in the Genus database with same CATH superfamily
2HOWA 1QXZA 1R5HA 2ZSGA 4U6JA 4U70A 5CDVA 2MATA 1YW8A 4U6CA 5JHUA 1XGSA 2GU5A 1C22A 2EVCA 4U71A 4IU6A 4ZWPA 5CDEA 4OOKA 5JFRA 2B3LA 3IU8A 1R58A 1KQ9A 4IPAA 2V6CA 4U76A 4ZWOA 1KQ0A 4FLJA 4IKUA 4Z7MA 2IW2A 2GU4A 4U73A 1YVMA 4FUKA 4IDYA 1WY2A 2BWTA 3PKCA 3RORA 2BWWA 2GGCA 1C23A 2EVMA 3D27A 3IG4A 3MX6A 5FCFA 2BB7A 1WBQA 2V3XA 2GG7A 1WL9A 1YJ3A 2P98A 3BITA 3BIPA 3PKBA 5CNXA 2GG9A 1C24A 2Q96A 2EVOA 3CB6A 3TAVA 3PKDA 1WL6A 3FM3A 4A6VA 2GU7A 4IKRA 3BIQA 4IKTA 2BHAA 1MATA 1O0XA 4FO7A 2GU6A 3FMQA 4PNCA 4A6WA 2BHCA 3MATA 4U6WA 2Q95A 2BH3A 5JI6A 4U6EA 4ZNGA 1YW9A 4HXXA 3CTZA 1XGMA 4R60A 3IU9A 4FLKA 5D6FA 1QXWA 2BWYA 2V3YA 1XGOA 2GG2A 4JUQA 5D6EA 2V3ZA 4RZYA 2P9AA 1WLRA 4FLIA 5CIKA 1B6AA 4IECA 1XGNA 2BN7A 2GG3A 4B28A 3RVAA 4S01A 1PV9A 2EA4A 2GG0A 2Q93A 1Y1NA 2OKNA 2GTXA 4ZWUA 1KP0A 4QR8A 1R5GA 5E5BA 1A16A 4FKCA 2Q92A 4MATA 5FCHA 3PKAA 2B3HA 2Q94A 4EGEA 2GA2A 2BHBA 2BWSA 4U1BA 3Q6DA 2BWXA 4IKSA 4PV4A 3L7GA 5CDLA 1QXYA 2GG8A 1BN5A 1C21A 1CHMA 2G6PA 4RGZ1 4S00A 4S2RP 3IU7A 4RZZA 4U69A 5CLSA 2BWUA 3TB5A 2GZ5A 3L24A 1N51A 2EA2A 5CE6A 1WKMA 1YW7A 2GGBA 3MR1A 4FO8A 2B3KA 1JAWA 3FMRA 4FLLA 1W2MA 2BWVA 2BHDA 1XNZA 1C27A 1QZYA 2NQ7A 3CB5A 1B59A 3PKEA 1WN1A 2OAZA 1BOAA 2DFIA 2NQ6A 1M35A 2Q8KA 2GG5A 2ADUA 4KM3A 4IF7A 3S6BA 4U6ZA 1W7VA 4U75A 4S2TP 2P99A
chains in the Genus database with same CATH topology
2HOWA 1QXZA 1R5HA 2ZSGA 4U6JA 4U70A 5CDVA 2MATA 1YW8A 4U6CA 5JHUA 1XGSA 2GU5A 1C22A 2EVCA 4U71A 4IU6A 4ZWPA 5CDEA 4OOKA 5JFRA 2B3LA 3IU8A 1R58A 1KQ9A 4IPAA 2V6CA 4U76A 4ZWOA 1KQ0A 4FLJA 4IKUA 4Z7MA 2IW2A 2GU4A 4U73A 1YVMA 4FUKA 4IDYA 1WY2A 2BWTA 3PKCA 3RORA 2BWWA 2GGCA 1C23A 2EVMA 3D27A 3IG4A 3MX6A 5FCFA 2BB7A 1WBQA 2V3XA 2GG7A 1WL9A 1YJ3A 2P98A 3BITA 3BIPA 3PKBA 5CNXA 2GG9A 1C24A 2Q96A 2EVOA 3CB6A 3TAVA 3PKDA 1WL6A 3FM3A 4A6VA 2GU7A 4IKRA 3BIQA 4IKTA 2BHAA 1MATA 1O0XA 4FO7A 2GU6A 3FMQA 4PNCA 4A6WA 2BHCA 3MATA 4U6WA 2Q95A 2BH3A 5JI6A 4U6EA 4ZNGA 1YW9A 4HXXA 3CTZA 1XGMA 4R60A 3IU9A 4FLKA 5D6FA 1QXWA 2BWYA 2V3YA 1XGOA 2GG2A 4JUQA 5D6EA 2V3ZA 4RZYA 2P9AA 1WLRA 4FLIA 5CIKA 1B6AA 4IECA 1XGNA 2BN7A 2GG3A 4B28A 3RVAA 4S01A 1PV9A 2EA4A 2GG0A 2Q93A 1Y1NA 2OKNA 2GTXA 4ZWUA 1KP0A 4QR8A 1R5GA 5E5BA 1A16A 4FKCA 2Q92A 4MATA 5FCHA 3PKAA 2B3HA 2Q94A 4EGEA 2GA2A 2BHBA 2BWSA 4U1BA 3Q6DA 2BWXA 4IKSA 4PV4A 3L7GA 5CDLA 1QXYA 2GG8A 1BN5A 1C21A 1CHMA 2G6PA 4RGZ1 4S00A 4S2RP 3IU7A 4RZZA 4U69A 5CLSA 2BWUA 3TB5A 2GZ5A 3L24A 1N51A 2EA2A 5CE6A 1WKMA 1YW7A 2GGBA 3MR1A 4FO8A 2B3KA 1JAWA 3FMRA 4FLLA 1W2MA 2BWVA 2BHDA 1XNZA 1C27A 1QZYA 2NQ7A 3CB5A 1B59A 3PKEA 1WN1A 2OAZA 1BOAA 2DFIA 2NQ6A 1M35A 2Q8KA 2GG5A 2ADUA 4KM3A 4IF7A 3S6BA 4U6ZA 1W7VA 4U75A 4S2TP 2P99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOW A;  1QXZ A;  1R5H A;  2ZSG A;  4U6J A;  4U70 A;  5CDV A;  2MAT A;  1YW8 A;  4U6C A;  5JHU A;  1XGS A;  2GU5 A;  1C22 A;  2EVC A;  4U71 A;  4IU6 A;  4ZWP A;  5CDE A;  4OOK A;  5JFR A;  2B3L A;  3IU8 A;  1R58 A;  1KQ9 A;  4IPA A;  2V6C A;  4U76 A;  4ZWO A;  1KQ0 A;  4FLJ A;  4IKU A;  4Z7M A;  2IW2 A;  2GU4 A;  4U73 A;  1YVM A;  4FUK A;  4IDY A;  1WY2 A;  2BWT A;  3PKC A;  3ROR A;  2BWW A;  2GGC A;  1C23 A;  2EVM A;  3D27 A;  3IG4 A;  3MX6 A;  5FCF A;  2BB7 A;  1WBQ A;  2V3X A;  2GG7 A;  1WL9 A;  1YJ3 A;  2P98 A;  3BIT A;  3BIP A;  3PKB A;  5CNX A;  2GG9 A;  1C24 A;  2Q96 A;  2EVO A;  3CB6 A;  3TAV A;  3PKD A;  1WL6 A;  3FM3 A;  4A6V A;  2GU7 A;  4IKR A;  3BIQ A;  4IKT A;  2BHA A;  1MAT A;  1O0X A;  4FO7 A;  2GU6 A;  3FMQ A;  4PNC A;  4A6W A;  2BHC A;  3MAT A;  4U6W A;  2Q95 A;  2BH3 A;  5JI6 A;  4U6E A;  4ZNG A;  1YW9 A;  4HXX A;  3CTZ A;  1XGM A;  4R60 A;  3IU9 A;  4FLK A;  5D6F A;  1QXW A;  2BWY A;  2V3Y A;  1XGO A;  2GG2 A;  4JUQ A;  5D6E A;  2V3Z A;  4RZY A;  2P9A A;  1WLR A;  4FLI A;  5CIK A;  1B6A A;  4IEC A;  1XGN A;  2BN7 A;  2GG3 A;  4B28 A;  3RVA A;  4S01 A;  1PV9 A;  2EA4 A;  2GG0 A;  2Q93 A;  1Y1N A;  2OKN A;  2GTX A;  4ZWU A;  1KP0 A;  4QR8 A;  1R5G A;  5E5B A;  1A16 A;  4FKC A;  2Q92 A;  4MAT A;  5FCH A;  3PKA A;  2B3H A;  2Q94 A;  4EGE A;  2GA2 A;  2BHB A;  2BWS A;  4U1B A;  3Q6D A;  2BWX A;  4IKS A;  4PV4 A;  3L7G A;  5CDL A;  1QXY A;  2GG8 A;  1BN5 A;  1C21 A;  1CHM A;  2G6P A;  4RGZ 1;  4S00 A;  4S2R P;  3IU7 A;  4RZZ A;  4U69 A;  5CLS A;  2BWU A;  3TB5 A;  2GZ5 A;  3L24 A;  1N51 A;  2EA2 A;  5CE6 A;  1WKM A;  1YW7 A;  2GGB A;  3MR1 A;  4FO8 A;  2B3K A;  1JAW A;  3FMR A;  4FLL A;  1W2M A;  2BWV A;  2BHD A;  1XNZ A;  1C27 A;  1QZY A;  2NQ7 A;  3CB5 A;  1B59 A;  3PKE A;  1WN1 A;  2OAZ A;  1BOA A;  2DFI A;  2NQ6 A;  1M35 A;  2Q8K A;  2GG5 A;  2ADU A;  4KM3 A;  4IF7 A;  3S6B A;  4U6Z A;  1W7V A;  4U75 A;  4S2T P;  2P99 A; 
#chains in the Genus database with same CATH topology
 2HOW A;  1QXZ A;  1R5H A;  2ZSG A;  4U6J A;  4U70 A;  5CDV A;  2MAT A;  1YW8 A;  4U6C A;  5JHU A;  1XGS A;  2GU5 A;  1C22 A;  2EVC A;  4U71 A;  4IU6 A;  4ZWP A;  5CDE A;  4OOK A;  5JFR A;  2B3L A;  3IU8 A;  1R58 A;  1KQ9 A;  4IPA A;  2V6C A;  4U76 A;  4ZWO A;  1KQ0 A;  4FLJ A;  4IKU A;  4Z7M A;  2IW2 A;  2GU4 A;  4U73 A;  1YVM A;  4FUK A;  4IDY A;  1WY2 A;  2BWT A;  3PKC A;  3ROR A;  2BWW A;  2GGC A;  1C23 A;  2EVM A;  3D27 A;  3IG4 A;  3MX6 A;  5FCF A;  2BB7 A;  1WBQ A;  2V3X A;  2GG7 A;  1WL9 A;  1YJ3 A;  2P98 A;  3BIT A;  3BIP A;  3PKB A;  5CNX A;  2GG9 A;  1C24 A;  2Q96 A;  2EVO A;  3CB6 A;  3TAV A;  3PKD A;  1WL6 A;  3FM3 A;  4A6V A;  2GU7 A;  4IKR A;  3BIQ A;  4IKT A;  2BHA A;  1MAT A;  1O0X A;  4FO7 A;  2GU6 A;  3FMQ A;  4PNC A;  4A6W A;  2BHC A;  3MAT A;  4U6W A;  2Q95 A;  2BH3 A;  5JI6 A;  4U6E A;  4ZNG A;  1YW9 A;  4HXX A;  3CTZ A;  1XGM A;  4R60 A;  3IU9 A;  4FLK A;  5D6F A;  1QXW A;  2BWY A;  2V3Y A;  1XGO A;  2GG2 A;  4JUQ A;  5D6E A;  2V3Z A;  4RZY A;  2P9A A;  1WLR A;  4FLI A;  5CIK A;  1B6A A;  4IEC A;  1XGN A;  2BN7 A;  2GG3 A;  4B28 A;  3RVA A;  4S01 A;  1PV9 A;  2EA4 A;  2GG0 A;  2Q93 A;  1Y1N A;  2OKN A;  2GTX A;  4ZWU A;  1KP0 A;  4QR8 A;  1R5G A;  5E5B A;  1A16 A;  4FKC A;  2Q92 A;  4MAT A;  5FCH A;  3PKA A;  2B3H A;  2Q94 A;  4EGE A;  2GA2 A;  2BHB A;  2BWS A;  4U1B A;  3Q6D A;  2BWX A;  4IKS A;  4PV4 A;  3L7G A;  5CDL A;  1QXY A;  2GG8 A;  1BN5 A;  1C21 A;  1CHM A;  2G6P A;  4RGZ 1;  4S00 A;  4S2R P;  3IU7 A;  4RZZ A;  4U69 A;  5CLS A;  2BWU A;  3TB5 A;  2GZ5 A;  3L24 A;  1N51 A;  2EA2 A;  5CE6 A;  1WKM A;  1YW7 A;  2GGB A;  3MR1 A;  4FO8 A;  2B3K A;  1JAW A;  3FMR A;  4FLL A;  1W2M A;  2BWV A;  2BHD A;  1XNZ A;  1C27 A;  1QZY A;  2NQ7 A;  3CB5 A;  1B59 A;  3PKE A;  1WN1 A;  2OAZ A;  1BOA A;  2DFI A;  2NQ6 A;  1M35 A;  2Q8K A;  2GG5 A;  2ADU A;  4KM3 A;  4IF7 A;  3S6B A;  4U6Z A;  1W7V A;  4U75 A;  4S2T P;  2P99 A; 
#chains in the Genus database with same CATH homology
 2HOW A;  1QXZ A;  1R5H A;  2ZSG A;  4U6J A;  4U70 A;  5CDV A;  2MAT A;  1YW8 A;  4U6C A;  5JHU A;  1XGS A;  2GU5 A;  1C22 A;  2EVC A;  4U71 A;  4IU6 A;  4ZWP A;  5CDE A;  4OOK A;  5JFR A;  2B3L A;  3IU8 A;  1R58 A;  1KQ9 A;  4IPA A;  2V6C A;  4U76 A;  4ZWO A;  1KQ0 A;  4FLJ A;  4IKU A;  4Z7M A;  2IW2 A;  2GU4 A;  4U73 A;  1YVM A;  4FUK A;  4IDY A;  1WY2 A;  2BWT A;  3PKC A;  3ROR A;  2BWW A;  2GGC A;  1C23 A;  2EVM A;  3D27 A;  3IG4 A;  3MX6 A;  5FCF A;  2BB7 A;  1WBQ A;  2V3X A;  2GG7 A;  1WL9 A;  1YJ3 A;  2P98 A;  3BIT A;  3BIP A;  3PKB A;  5CNX A;  2GG9 A;  1C24 A;  2Q96 A;  2EVO A;  3CB6 A;  3TAV A;  3PKD A;  1WL6 A;  3FM3 A;  4A6V A;  2GU7 A;  4IKR A;  3BIQ A;  4IKT A;  2BHA A;  1MAT A;  1O0X A;  4FO7 A;  2GU6 A;  3FMQ A;  4PNC A;  4A6W A;  2BHC A;  3MAT A;  4U6W A;  2Q95 A;  2BH3 A;  5JI6 A;  4U6E A;  4ZNG A;  1YW9 A;  4HXX A;  3CTZ A;  1XGM A;  4R60 A;  3IU9 A;  4FLK A;  5D6F A;  1QXW A;  2BWY A;  2V3Y A;  1XGO A;  2GG2 A;  4JUQ A;  5D6E A;  2V3Z A;  4RZY A;  2P9A A;  1WLR A;  4FLI A;  5CIK A;  1B6A A;  4IEC A;  1XGN A;  2BN7 A;  2GG3 A;  4B28 A;  3RVA A;  4S01 A;  1PV9 A;  2EA4 A;  2GG0 A;  2Q93 A;  1Y1N A;  2OKN A;  2GTX A;  4ZWU A;  1KP0 A;  4QR8 A;  1R5G A;  5E5B A;  1A16 A;  4FKC A;  2Q92 A;  4MAT A;  5FCH A;  3PKA A;  2B3H A;  2Q94 A;  4EGE A;  2GA2 A;  2BHB A;  2BWS A;  4U1B A;  3Q6D A;  2BWX A;  4IKS A;  4PV4 A;  3L7G A;  5CDL A;  1QXY A;  2GG8 A;  1BN5 A;  1C21 A;  1CHM A;  2G6P A;  4RGZ 1;  4S00 A;  4S2R P;  3IU7 A;  4RZZ A;  4U69 A;  5CLS A;  2BWU A;  3TB5 A;  2GZ5 A;  3L24 A;  1N51 A;  2EA2 A;  5CE6 A;  1WKM A;  1YW7 A;  2GGB A;  3MR1 A;  4FO8 A;  2B3K A;  1JAW A;  3FMR A;  4FLL A;  1W2M A;  2BWV A;  2BHD A;  1XNZ A;  1C27 A;  1QZY A;  2NQ7 A;  3CB5 A;  1B59 A;  3PKE A;  1WN1 A;  2OAZ A;  1BOA A;  2DFI A;  2NQ6 A;  1M35 A;  2Q8K A;  2GG5 A;  2ADU A;  4KM3 A;  4IF7 A;  3S6B A;  4U6Z A;  1W7V A;  4U75 A;  4S2T P;  2P99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...