2GG0A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg0A00
3Q6DA 2BH3A 2GA2A 1C21A 2GU7A 4RZZA 4IECA 3IG4A 2Q96A 4HXXA 4IPAA 2GG3A 2P98A 2EA2A 1W7VA 2OKNA 1PV9A 1B6AA 1KQ9A 2V3XA 1XNZA 2Q8KA 1WL9A 2NQ7A 5FCFA 3RORA 2GU5A 2B3HA 1YW7A 2BWSA 2P99A 3IU9A 4PNCA 4QR8A 2B3LA 3FMQA 4R60A 1QXYA 4U73A 3MATA 1XGSA 2ADUA 3PKDA 1QXWA 2GG8A 2GU6A 2MATA 5CE6A 2BWXA 3D27A 1C23A 1XGNA 5JFRA 1C27A 2EVOA 4U6CA 2EVCA 1XGMA 2BWTA 1CHMA 1JAWA 3BITA 4U69A 4U6ZA 5CIKA 4ZWUA 4IKSA 2OAZA 4U76A 1WKMA 2HOWA 3CTZA 4S2TP 2BN7A 4IKUA 3PKBA 4IU6A 5JI6A 5E5BA 1YW9A 4IF7A 3FM3A 1YVMA 2B3KA 4FKCA 5CDEA 2Q95A 2V6CA 3TB5A 4IKRA 2GG7A 1YJ3A 4JUQA 3IU7A 4U70A 3PKCA 4FLKA 4Z7MA 1R58A 4S00A 3MX6A 3MR1A 4IKTA 3PKEA 3BIPA 5JHUA 3BIQA 1KP0A 4FLJA 4ZWPA 4ZNGA 2GGCA 4RGZ1 2BWUA 1C24A 2BHAA 4MATA 4KM3A 2P9AA 4B28A 1YW8A 1XGOA 5CDVA 4S2RP 2GGBA 2GU4A 5CDLA 2Q94A 2BB7A 1WL6A 3FMRA 4FUKA 1QXZA 3PKAA 2GG2A 2Q93A 4ZWOA 4U71A 2BHCA 3CB6A 5CNXA 4IDYA 4A6WA 2GG9A 2BWVA 3L24A 4U6JA 1KQ0A 1C22A 1WN1A 2EVMA 2Q92A 1Y1NA 4U6WA 1R5HA 4U75A 1B59A 3IU8A 4S01A 4RZYA 2NQ6A 3L7GA 3RVAA 2BHBA 2GZ5A 1BN5A 3TAVA 1WY2A 2GG0A 4OOKA 5CLSA 1N51A 3S6BA 1R5GA 2BHDA 2IW2A 4U1BA 4FO8A 2G6PA 4FO7A 1O0XA 2EA4A 4FLIA 2ZSGA 3CB5A 5D6FA 5FCHA 4EGEA 2BWYA 2DFIA 2GG5A 1A16A 4U6EA 2BWWA 1QZYA 2V3ZA 4A6VA 4FLLA 4PV4A 2V3YA 1WBQA 1BOAA 1WLRA 1MATA 5D6EA 2GTXA 1M35A 1W2MA
chains in the Genus database with same CATH superfamily
3Q6DA 2BH3A 2GA2A 1C21A 2GU7A 4RZZA 4IECA 3IG4A 2Q96A 4HXXA 4IPAA 2GG3A 2P98A 2EA2A 1W7VA 2OKNA 1PV9A 1B6AA 1KQ9A 2V3XA 1XNZA 2Q8KA 1WL9A 2NQ7A 5FCFA 3RORA 2GU5A 2B3HA 1YW7A 2BWSA 2P99A 3IU9A 4PNCA 4QR8A 2B3LA 3FMQA 4R60A 1QXYA 4U73A 3MATA 1XGSA 2ADUA 3PKDA 1QXWA 2GG8A 2GU6A 2MATA 5CE6A 2BWXA 3D27A 1C23A 1XGNA 5JFRA 1C27A 2EVOA 4U6CA 2EVCA 1XGMA 2BWTA 1CHMA 1JAWA 3BITA 4U69A 4U6ZA 5CIKA 4ZWUA 4IKSA 2OAZA 4U76A 1WKMA 2HOWA 3CTZA 4S2TP 2BN7A 4IKUA 3PKBA 4IU6A 5JI6A 5E5BA 1YW9A 4IF7A 3FM3A 1YVMA 2B3KA 4FKCA 5CDEA 2Q95A 2V6CA 3TB5A 4IKRA 2GG7A 1YJ3A 4JUQA 3IU7A 4U70A 3PKCA 4FLKA 4Z7MA 1R58A 4S00A 3MX6A 3MR1A 4IKTA 3PKEA 3BIPA 5JHUA 3BIQA 1KP0A 4FLJA 4ZWPA 4ZNGA 2GGCA 4RGZ1 2BWUA 1C24A 2BHAA 4MATA 4KM3A 2P9AA 4B28A 1YW8A 1XGOA 5CDVA 4S2RP 2GGBA 2GU4A 5CDLA 2Q94A 2BB7A 1WL6A 3FMRA 4FUKA 1QXZA 3PKAA 2GG2A 2Q93A 4ZWOA 4U71A 2BHCA 3CB6A 5CNXA 4IDYA 4A6WA 2GG9A 2BWVA 3L24A 4U6JA 1KQ0A 1C22A 1WN1A 2EVMA 2Q92A 1Y1NA 4U6WA 1R5HA 4U75A 1B59A 3IU8A 4S01A 4RZYA 2NQ6A 3L7GA 3RVAA 2BHBA 2GZ5A 1BN5A 3TAVA 1WY2A 2GG0A 4OOKA 5CLSA 1N51A 3S6BA 1R5GA 2BHDA 2IW2A 4U1BA 4FO8A 2G6PA 4FO7A 1O0XA 2EA4A 4FLIA 2ZSGA 3CB5A 5D6FA 5FCHA 4EGEA 2BWYA 2DFIA 2GG5A 1A16A 4U6EA 2BWWA 1QZYA 2V3ZA 4A6VA 4FLLA 4PV4A 2V3YA 1WBQA 1BOAA 1WLRA 1MATA 5D6EA 2GTXA 1M35A 1W2MA
chains in the Genus database with same CATH topology
3Q6DA 2BH3A 2GA2A 1C21A 2GU7A 4RZZA 4IECA 3IG4A 2Q96A 4HXXA 4IPAA 2GG3A 2P98A 2EA2A 1W7VA 2OKNA 1PV9A 1B6AA 1KQ9A 2V3XA 1XNZA 2Q8KA 1WL9A 2NQ7A 5FCFA 3RORA 2GU5A 2B3HA 1YW7A 2BWSA 2P99A 3IU9A 4PNCA 4QR8A 2B3LA 3FMQA 4R60A 1QXYA 4U73A 3MATA 1XGSA 2ADUA 3PKDA 1QXWA 2GG8A 2GU6A 2MATA 5CE6A 2BWXA 3D27A 1C23A 1XGNA 5JFRA 1C27A 2EVOA 4U6CA 2EVCA 1XGMA 2BWTA 1CHMA 1JAWA 3BITA 4U69A 4U6ZA 5CIKA 4ZWUA 4IKSA 2OAZA 4U76A 1WKMA 2HOWA 3CTZA 4S2TP 2BN7A 4IKUA 3PKBA 4IU6A 5JI6A 5E5BA 1YW9A 4IF7A 3FM3A 1YVMA 2B3KA 4FKCA 5CDEA 2Q95A 2V6CA 3TB5A 4IKRA 2GG7A 1YJ3A 4JUQA 3IU7A 4U70A 3PKCA 4FLKA 4Z7MA 1R58A 4S00A 3MX6A 3MR1A 4IKTA 3PKEA 3BIPA 5JHUA 3BIQA 1KP0A 4FLJA 4ZWPA 4ZNGA 2GGCA 4RGZ1 2BWUA 1C24A 2BHAA 4MATA 4KM3A 2P9AA 4B28A 1YW8A 1XGOA 5CDVA 4S2RP 2GGBA 2GU4A 5CDLA 2Q94A 2BB7A 1WL6A 3FMRA 4FUKA 1QXZA 3PKAA 2GG2A 2Q93A 4ZWOA 4U71A 2BHCA 3CB6A 5CNXA 4IDYA 4A6WA 2GG9A 2BWVA 3L24A 4U6JA 1KQ0A 1C22A 1WN1A 2EVMA 2Q92A 1Y1NA 4U6WA 1R5HA 4U75A 1B59A 3IU8A 4S01A 4RZYA 2NQ6A 3L7GA 3RVAA 2BHBA 2GZ5A 1BN5A 3TAVA 1WY2A 2GG0A 4OOKA 5CLSA 1N51A 3S6BA 1R5GA 2BHDA 2IW2A 4U1BA 4FO8A 2G6PA 4FO7A 1O0XA 2EA4A 4FLIA 2ZSGA 3CB5A 5D6FA 5FCHA 4EGEA 2BWYA 2DFIA 2GG5A 1A16A 4U6EA 2BWWA 1QZYA 2V3ZA 4A6VA 4FLLA 4PV4A 2V3YA 1WBQA 1BOAA 1WLRA 1MATA 5D6EA 2GTXA 1M35A 1W2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6D A;  2BH3 A;  2GA2 A;  1C21 A;  2GU7 A;  4RZZ A;  4IEC A;  3IG4 A;  2Q96 A;  4HXX A;  4IPA A;  2GG3 A;  2P98 A;  2EA2 A;  1W7V A;  2OKN A;  1PV9 A;  1B6A A;  1KQ9 A;  2V3X A;  1XNZ A;  2Q8K A;  1WL9 A;  2NQ7 A;  5FCF A;  3ROR A;  2GU5 A;  2B3H A;  1YW7 A;  2BWS A;  2P99 A;  3IU9 A;  4PNC A;  4QR8 A;  2B3L A;  3FMQ A;  4R60 A;  1QXY A;  4U73 A;  3MAT A;  1XGS A;  2ADU A;  3PKD A;  1QXW A;  2GG8 A;  2GU6 A;  2MAT A;  5CE6 A;  2BWX A;  3D27 A;  1C23 A;  1XGN A;  5JFR A;  1C27 A;  2EVO A;  4U6C A;  2EVC A;  1XGM A;  2BWT A;  1CHM A;  1JAW A;  3BIT A;  4U69 A;  4U6Z A;  5CIK A;  4ZWU A;  4IKS A;  2OAZ A;  4U76 A;  1WKM A;  2HOW A;  3CTZ A;  4S2T P;  2BN7 A;  4IKU A;  3PKB A;  4IU6 A;  5JI6 A;  5E5B A;  1YW9 A;  4IF7 A;  3FM3 A;  1YVM A;  2B3K A;  4FKC A;  5CDE A;  2Q95 A;  2V6C A;  3TB5 A;  4IKR A;  2GG7 A;  1YJ3 A;  4JUQ A;  3IU7 A;  4U70 A;  3PKC A;  4FLK A;  4Z7M A;  1R58 A;  4S00 A;  3MX6 A;  3MR1 A;  4IKT A;  3PKE A;  3BIP A;  5JHU A;  3BIQ A;  1KP0 A;  4FLJ A;  4ZWP A;  4ZNG A;  2GGC A;  4RGZ 1;  2BWU A;  1C24 A;  2BHA A;  4MAT A;  4KM3 A;  2P9A A;  4B28 A;  1YW8 A;  1XGO A;  5CDV A;  4S2R P;  2GGB A;  2GU4 A;  5CDL A;  2Q94 A;  2BB7 A;  1WL6 A;  3FMR A;  4FUK A;  1QXZ A;  3PKA A;  2GG2 A;  2Q93 A;  4ZWO A;  4U71 A;  2BHC A;  3CB6 A;  5CNX A;  4IDY A;  4A6W A;  2GG9 A;  2BWV A;  3L24 A;  4U6J A;  1KQ0 A;  1C22 A;  1WN1 A;  2EVM A;  2Q92 A;  1Y1N A;  4U6W A;  1R5H A;  4U75 A;  1B59 A;  3IU8 A;  4S01 A;  4RZY A;  2NQ6 A;  3L7G A;  3RVA A;  2BHB A;  2GZ5 A;  1BN5 A;  3TAV A;  1WY2 A;  2GG0 A;  4OOK A;  5CLS A;  1N51 A;  3S6B A;  1R5G A;  2BHD A;  2IW2 A;  4U1B A;  4FO8 A;  2G6P A;  4FO7 A;  1O0X A;  2EA4 A;  4FLI A;  2ZSG A;  3CB5 A;  5D6F A;  5FCH A;  4EGE A;  2BWY A;  2DFI A;  2GG5 A;  1A16 A;  4U6E A;  2BWW A;  1QZY A;  2V3Z A;  4A6V A;  4FLL A;  4PV4 A;  2V3Y A;  1WBQ A;  1BOA A;  1WLR A;  1MAT A;  5D6E A;  2GTX A;  1M35 A;  1W2M A; 
#chains in the Genus database with same CATH topology
 3Q6D A;  2BH3 A;  2GA2 A;  1C21 A;  2GU7 A;  4RZZ A;  4IEC A;  3IG4 A;  2Q96 A;  4HXX A;  4IPA A;  2GG3 A;  2P98 A;  2EA2 A;  1W7V A;  2OKN A;  1PV9 A;  1B6A A;  1KQ9 A;  2V3X A;  1XNZ A;  2Q8K A;  1WL9 A;  2NQ7 A;  5FCF A;  3ROR A;  2GU5 A;  2B3H A;  1YW7 A;  2BWS A;  2P99 A;  3IU9 A;  4PNC A;  4QR8 A;  2B3L A;  3FMQ A;  4R60 A;  1QXY A;  4U73 A;  3MAT A;  1XGS A;  2ADU A;  3PKD A;  1QXW A;  2GG8 A;  2GU6 A;  2MAT A;  5CE6 A;  2BWX A;  3D27 A;  1C23 A;  1XGN A;  5JFR A;  1C27 A;  2EVO A;  4U6C A;  2EVC A;  1XGM A;  2BWT A;  1CHM A;  1JAW A;  3BIT A;  4U69 A;  4U6Z A;  5CIK A;  4ZWU A;  4IKS A;  2OAZ A;  4U76 A;  1WKM A;  2HOW A;  3CTZ A;  4S2T P;  2BN7 A;  4IKU A;  3PKB A;  4IU6 A;  5JI6 A;  5E5B A;  1YW9 A;  4IF7 A;  3FM3 A;  1YVM A;  2B3K A;  4FKC A;  5CDE A;  2Q95 A;  2V6C A;  3TB5 A;  4IKR A;  2GG7 A;  1YJ3 A;  4JUQ A;  3IU7 A;  4U70 A;  3PKC A;  4FLK A;  4Z7M A;  1R58 A;  4S00 A;  3MX6 A;  3MR1 A;  4IKT A;  3PKE A;  3BIP A;  5JHU A;  3BIQ A;  1KP0 A;  4FLJ A;  4ZWP A;  4ZNG A;  2GGC A;  4RGZ 1;  2BWU A;  1C24 A;  2BHA A;  4MAT A;  4KM3 A;  2P9A A;  4B28 A;  1YW8 A;  1XGO A;  5CDV A;  4S2R P;  2GGB A;  2GU4 A;  5CDL A;  2Q94 A;  2BB7 A;  1WL6 A;  3FMR A;  4FUK A;  1QXZ A;  3PKA A;  2GG2 A;  2Q93 A;  4ZWO A;  4U71 A;  2BHC A;  3CB6 A;  5CNX A;  4IDY A;  4A6W A;  2GG9 A;  2BWV A;  3L24 A;  4U6J A;  1KQ0 A;  1C22 A;  1WN1 A;  2EVM A;  2Q92 A;  1Y1N A;  4U6W A;  1R5H A;  4U75 A;  1B59 A;  3IU8 A;  4S01 A;  4RZY A;  2NQ6 A;  3L7G A;  3RVA A;  2BHB A;  2GZ5 A;  1BN5 A;  3TAV A;  1WY2 A;  2GG0 A;  4OOK A;  5CLS A;  1N51 A;  3S6B A;  1R5G A;  2BHD A;  2IW2 A;  4U1B A;  4FO8 A;  2G6P A;  4FO7 A;  1O0X A;  2EA4 A;  4FLI A;  2ZSG A;  3CB5 A;  5D6F A;  5FCH A;  4EGE A;  2BWY A;  2DFI A;  2GG5 A;  1A16 A;  4U6E A;  2BWW A;  1QZY A;  2V3Z A;  4A6V A;  4FLL A;  4PV4 A;  2V3Y A;  1WBQ A;  1BOA A;  1WLR A;  1MAT A;  5D6E A;  2GTX A;  1M35 A;  1W2M A; 
#chains in the Genus database with same CATH homology
 3Q6D A;  2BH3 A;  2GA2 A;  1C21 A;  2GU7 A;  4RZZ A;  4IEC A;  3IG4 A;  2Q96 A;  4HXX A;  4IPA A;  2GG3 A;  2P98 A;  2EA2 A;  1W7V A;  2OKN A;  1PV9 A;  1B6A A;  1KQ9 A;  2V3X A;  1XNZ A;  2Q8K A;  1WL9 A;  2NQ7 A;  5FCF A;  3ROR A;  2GU5 A;  2B3H A;  1YW7 A;  2BWS A;  2P99 A;  3IU9 A;  4PNC A;  4QR8 A;  2B3L A;  3FMQ A;  4R60 A;  1QXY A;  4U73 A;  3MAT A;  1XGS A;  2ADU A;  3PKD A;  1QXW A;  2GG8 A;  2GU6 A;  2MAT A;  5CE6 A;  2BWX A;  3D27 A;  1C23 A;  1XGN A;  5JFR A;  1C27 A;  2EVO A;  4U6C A;  2EVC A;  1XGM A;  2BWT A;  1CHM A;  1JAW A;  3BIT A;  4U69 A;  4U6Z A;  5CIK A;  4ZWU A;  4IKS A;  2OAZ A;  4U76 A;  1WKM A;  2HOW A;  3CTZ A;  4S2T P;  2BN7 A;  4IKU A;  3PKB A;  4IU6 A;  5JI6 A;  5E5B A;  1YW9 A;  4IF7 A;  3FM3 A;  1YVM A;  2B3K A;  4FKC A;  5CDE A;  2Q95 A;  2V6C A;  3TB5 A;  4IKR A;  2GG7 A;  1YJ3 A;  4JUQ A;  3IU7 A;  4U70 A;  3PKC A;  4FLK A;  4Z7M A;  1R58 A;  4S00 A;  3MX6 A;  3MR1 A;  4IKT A;  3PKE A;  3BIP A;  5JHU A;  3BIQ A;  1KP0 A;  4FLJ A;  4ZWP A;  4ZNG A;  2GGC A;  4RGZ 1;  2BWU A;  1C24 A;  2BHA A;  4MAT A;  4KM3 A;  2P9A A;  4B28 A;  1YW8 A;  1XGO A;  5CDV A;  4S2R P;  2GGB A;  2GU4 A;  5CDL A;  2Q94 A;  2BB7 A;  1WL6 A;  3FMR A;  4FUK A;  1QXZ A;  3PKA A;  2GG2 A;  2Q93 A;  4ZWO A;  4U71 A;  2BHC A;  3CB6 A;  5CNX A;  4IDY A;  4A6W A;  2GG9 A;  2BWV A;  3L24 A;  4U6J A;  1KQ0 A;  1C22 A;  1WN1 A;  2EVM A;  2Q92 A;  1Y1N A;  4U6W A;  1R5H A;  4U75 A;  1B59 A;  3IU8 A;  4S01 A;  4RZY A;  2NQ6 A;  3L7G A;  3RVA A;  2BHB A;  2GZ5 A;  1BN5 A;  3TAV A;  1WY2 A;  2GG0 A;  4OOK A;  5CLS A;  1N51 A;  3S6B A;  1R5G A;  2BHD A;  2IW2 A;  4U1B A;  4FO8 A;  2G6P A;  4FO7 A;  1O0X A;  2EA4 A;  4FLI A;  2ZSG A;  3CB5 A;  5D6F A;  5FCH A;  4EGE A;  2BWY A;  2DFI A;  2GG5 A;  1A16 A;  4U6E A;  2BWW A;  1QZY A;  2V3Z A;  4A6V A;  4FLL A;  4PV4 A;  2V3Y A;  1WBQ A;  1BOA A;  1WLR A;  1MAT A;  5D6E A;  2GTX A;  1M35 A;  1W2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...