2GG0A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg0A00
2EVMA 1WBQA 4RZZA 5CLSA 4IU6A 2EA2A 1R5HA 2EA4A 4S01A 5CDLA 3CB6A 4S2RP 4HXXA 3PKAA 1YW8A 5JI6A 2G6PA 1XGMA 3S6BA 1XNZA 2V3XA 5CE6A 2Q93A 1C22A 1WLRA 4FLKA 2BHCA 4IF7A 1C24A 5CDEA 2IW2A 2V6CA 1W2MA 4QR8A 3MATA 1BOAA 2V3ZA 1WL9A 3D27A 5D6EA 1C23A 4FO8A 2GU4A 2Q96A 3FMQA 2B3HA 1WY2A 3PKBA 2GGBA 1YVMA 1B6AA 2Q95A 1XGNA 4U71A 4IECA 4FUKA 4U70A 4JUQA 4FLLA 3RORA 1BN5A 2EVOA 2MATA 2ZSGA 2GGCA 4U73A 1YW7A 4A6WA 1C21A 2GG9A 2OAZA 3CB5A 3PKDA 2P9AA 3CTZA 1WN1A 1YJ3A 1JAWA 2NQ7A 2GA2A 2BHDA 4R60A 2BH3A 4U6EA 4U6WA 3RVAA 1QXYA 3Q6DA 2BWUA 4IDYA 2DFIA 2EVCA 3L7GA 3MR1A 5FCFA 2BWSA 4FLJA 5CDVA 4ZWPA 4ZWOA 2BWXA 4RZYA 4IKUA 2Q8KA 1B59A 2ADUA 2GG8A 1KP0A 4MATA 4U75A 4ZWUA 1CHMA 2GG0A 4FKCA 4OOKA 3PKEA 4U6JA 3BIPA 1YW9A 1M35A 1WKMA 2GU5A 2P99A 2GG5A 2GZ5A 2BWVA 3TB5A 2HOWA 1A16A 2NQ6A 2BWYA 4RGZ1 1QXZA 2BWTA 2BB7A 4S2TP 5JHUA 2BHBA 5CNXA 2B3KA 4IKRA 2GG7A 4PV4A 3BITA 1Y1NA 2BWWA 1O0XA 4S00A 1KQ9A 2Q92A 1QZYA 1W7VA 3MX6A 3FMRA 3IG4A 1QXWA 2OKNA 4ZNGA 2V3YA 5D6FA 4IPAA 3BIQA 2GG3A 4FLIA 5CIKA 4EGEA 2GU7A 4IKTA 1C27A 2GG2A 2Q94A 3IU8A 1WL6A 2BHAA 4IKSA 2GTXA 3IU9A 2B3LA 2BN7A 4Z7MA 3IU7A 4KM3A 2GU6A 1N51A 4U6ZA 1R5GA 3L24A 4U69A 5E5BA 4A6VA 5JFRA 1XGOA 3PKCA 4U6CA 3TAVA 4FO7A 4B28A 1XGSA 4U1BA 1KQ0A 4PNCA 4U76A 2P98A 5FCHA 1R58A 3FM3A 1PV9A 1MATA
chains in the Genus database with same CATH superfamily
2EVMA 1WBQA 4RZZA 5CLSA 4IU6A 2EA2A 1R5HA 2EA4A 4S01A 5CDLA 3CB6A 4S2RP 4HXXA 3PKAA 1YW8A 5JI6A 2G6PA 1XGMA 3S6BA 1XNZA 2V3XA 5CE6A 2Q93A 1C22A 1WLRA 4FLKA 2BHCA 4IF7A 1C24A 5CDEA 2IW2A 2V6CA 1W2MA 4QR8A 3MATA 1BOAA 2V3ZA 1WL9A 3D27A 5D6EA 1C23A 4FO8A 2GU4A 2Q96A 3FMQA 2B3HA 1WY2A 3PKBA 2GGBA 1YVMA 1B6AA 2Q95A 1XGNA 4U71A 4IECA 4FUKA 4U70A 4JUQA 4FLLA 3RORA 1BN5A 2EVOA 2MATA 2ZSGA 2GGCA 4U73A 1YW7A 4A6WA 1C21A 2GG9A 2OAZA 3CB5A 3PKDA 2P9AA 3CTZA 1WN1A 1YJ3A 1JAWA 2NQ7A 2GA2A 2BHDA 4R60A 2BH3A 4U6EA 4U6WA 3RVAA 1QXYA 3Q6DA 2BWUA 4IDYA 2DFIA 2EVCA 3L7GA 3MR1A 5FCFA 2BWSA 4FLJA 5CDVA 4ZWPA 4ZWOA 2BWXA 4RZYA 4IKUA 2Q8KA 1B59A 2ADUA 2GG8A 1KP0A 4MATA 4U75A 4ZWUA 1CHMA 2GG0A 4FKCA 4OOKA 3PKEA 4U6JA 3BIPA 1YW9A 1M35A 1WKMA 2GU5A 2P99A 2GG5A 2GZ5A 2BWVA 3TB5A 2HOWA 1A16A 2NQ6A 2BWYA 4RGZ1 1QXZA 2BWTA 2BB7A 4S2TP 5JHUA 2BHBA 5CNXA 2B3KA 4IKRA 2GG7A 4PV4A 3BITA 1Y1NA 2BWWA 1O0XA 4S00A 1KQ9A 2Q92A 1QZYA 1W7VA 3MX6A 3FMRA 3IG4A 1QXWA 2OKNA 4ZNGA 2V3YA 5D6FA 4IPAA 3BIQA 2GG3A 4FLIA 5CIKA 4EGEA 2GU7A 4IKTA 1C27A 2GG2A 2Q94A 3IU8A 1WL6A 2BHAA 4IKSA 2GTXA 3IU9A 2B3LA 2BN7A 4Z7MA 3IU7A 4KM3A 2GU6A 1N51A 4U6ZA 1R5GA 3L24A 4U69A 5E5BA 4A6VA 5JFRA 1XGOA 3PKCA 4U6CA 3TAVA 4FO7A 4B28A 1XGSA 4U1BA 1KQ0A 4PNCA 4U76A 2P98A 5FCHA 1R58A 3FM3A 1PV9A 1MATA
chains in the Genus database with same CATH topology
2EVMA 1WBQA 4RZZA 5CLSA 4IU6A 2EA2A 1R5HA 2EA4A 4S01A 5CDLA 3CB6A 4S2RP 4HXXA 3PKAA 1YW8A 5JI6A 2G6PA 1XGMA 3S6BA 1XNZA 2V3XA 5CE6A 2Q93A 1C22A 1WLRA 4FLKA 2BHCA 4IF7A 1C24A 5CDEA 2IW2A 2V6CA 1W2MA 4QR8A 3MATA 1BOAA 2V3ZA 1WL9A 3D27A 5D6EA 1C23A 4FO8A 2GU4A 2Q96A 3FMQA 2B3HA 1WY2A 3PKBA 2GGBA 1YVMA 1B6AA 2Q95A 1XGNA 4U71A 4IECA 4FUKA 4U70A 4JUQA 4FLLA 3RORA 1BN5A 2EVOA 2MATA 2ZSGA 2GGCA 4U73A 1YW7A 4A6WA 1C21A 2GG9A 2OAZA 3CB5A 3PKDA 2P9AA 3CTZA 1WN1A 1YJ3A 1JAWA 2NQ7A 2GA2A 2BHDA 4R60A 2BH3A 4U6EA 4U6WA 3RVAA 1QXYA 3Q6DA 2BWUA 4IDYA 2DFIA 2EVCA 3L7GA 3MR1A 5FCFA 2BWSA 4FLJA 5CDVA 4ZWPA 4ZWOA 2BWXA 4RZYA 4IKUA 2Q8KA 1B59A 2ADUA 2GG8A 1KP0A 4MATA 4U75A 4ZWUA 1CHMA 2GG0A 4FKCA 4OOKA 3PKEA 4U6JA 3BIPA 1YW9A 1M35A 1WKMA 2GU5A 2P99A 2GG5A 2GZ5A 2BWVA 3TB5A 2HOWA 1A16A 2NQ6A 2BWYA 4RGZ1 1QXZA 2BWTA 2BB7A 4S2TP 5JHUA 2BHBA 5CNXA 2B3KA 4IKRA 2GG7A 4PV4A 3BITA 1Y1NA 2BWWA 1O0XA 4S00A 1KQ9A 2Q92A 1QZYA 1W7VA 3MX6A 3FMRA 3IG4A 1QXWA 2OKNA 4ZNGA 2V3YA 5D6FA 4IPAA 3BIQA 2GG3A 4FLIA 5CIKA 4EGEA 2GU7A 4IKTA 1C27A 2GG2A 2Q94A 3IU8A 1WL6A 2BHAA 4IKSA 2GTXA 3IU9A 2B3LA 2BN7A 4Z7MA 3IU7A 4KM3A 2GU6A 1N51A 4U6ZA 1R5GA 3L24A 4U69A 5E5BA 4A6VA 5JFRA 1XGOA 3PKCA 4U6CA 3TAVA 4FO7A 4B28A 1XGSA 4U1BA 1KQ0A 4PNCA 4U76A 2P98A 5FCHA 1R58A 3FM3A 1PV9A 1MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVM A;  1WBQ A;  4RZZ A;  5CLS A;  4IU6 A;  2EA2 A;  1R5H A;  2EA4 A;  4S01 A;  5CDL A;  3CB6 A;  4S2R P;  4HXX A;  3PKA A;  1YW8 A;  5JI6 A;  2G6P A;  1XGM A;  3S6B A;  1XNZ A;  2V3X A;  5CE6 A;  2Q93 A;  1C22 A;  1WLR A;  4FLK A;  2BHC A;  4IF7 A;  1C24 A;  5CDE A;  2IW2 A;  2V6C A;  1W2M A;  4QR8 A;  3MAT A;  1BOA A;  2V3Z A;  1WL9 A;  3D27 A;  5D6E A;  1C23 A;  4FO8 A;  2GU4 A;  2Q96 A;  3FMQ A;  2B3H A;  1WY2 A;  3PKB A;  2GGB A;  1YVM A;  1B6A A;  2Q95 A;  1XGN A;  4U71 A;  4IEC A;  4FUK A;  4U70 A;  4JUQ A;  4FLL A;  3ROR A;  1BN5 A;  2EVO A;  2MAT A;  2ZSG A;  2GGC A;  4U73 A;  1YW7 A;  4A6W A;  1C21 A;  2GG9 A;  2OAZ A;  3CB5 A;  3PKD A;  2P9A A;  3CTZ A;  1WN1 A;  1YJ3 A;  1JAW A;  2NQ7 A;  2GA2 A;  2BHD A;  4R60 A;  2BH3 A;  4U6E A;  4U6W A;  3RVA A;  1QXY A;  3Q6D A;  2BWU A;  4IDY A;  2DFI A;  2EVC A;  3L7G A;  3MR1 A;  5FCF A;  2BWS A;  4FLJ A;  5CDV A;  4ZWP A;  4ZWO A;  2BWX A;  4RZY A;  4IKU A;  2Q8K A;  1B59 A;  2ADU A;  2GG8 A;  1KP0 A;  4MAT A;  4U75 A;  4ZWU A;  1CHM A;  2GG0 A;  4FKC A;  4OOK A;  3PKE A;  4U6J A;  3BIP A;  1YW9 A;  1M35 A;  1WKM A;  2GU5 A;  2P99 A;  2GG5 A;  2GZ5 A;  2BWV A;  3TB5 A;  2HOW A;  1A16 A;  2NQ6 A;  2BWY A;  4RGZ 1;  1QXZ A;  2BWT A;  2BB7 A;  4S2T P;  5JHU A;  2BHB A;  5CNX A;  2B3K A;  4IKR A;  2GG7 A;  4PV4 A;  3BIT A;  1Y1N A;  2BWW A;  1O0X A;  4S00 A;  1KQ9 A;  2Q92 A;  1QZY A;  1W7V A;  3MX6 A;  3FMR A;  3IG4 A;  1QXW A;  2OKN A;  4ZNG A;  2V3Y A;  5D6F A;  4IPA A;  3BIQ A;  2GG3 A;  4FLI A;  5CIK A;  4EGE A;  2GU7 A;  4IKT A;  1C27 A;  2GG2 A;  2Q94 A;  3IU8 A;  1WL6 A;  2BHA A;  4IKS A;  2GTX A;  3IU9 A;  2B3L A;  2BN7 A;  4Z7M A;  3IU7 A;  4KM3 A;  2GU6 A;  1N51 A;  4U6Z A;  1R5G A;  3L24 A;  4U69 A;  5E5B A;  4A6V A;  5JFR A;  1XGO A;  3PKC A;  4U6C A;  3TAV A;  4FO7 A;  4B28 A;  1XGS A;  4U1B A;  1KQ0 A;  4PNC A;  4U76 A;  2P98 A;  5FCH A;  1R58 A;  3FM3 A;  1PV9 A;  1MAT A; 
#chains in the Genus database with same CATH topology
 2EVM A;  1WBQ A;  4RZZ A;  5CLS A;  4IU6 A;  2EA2 A;  1R5H A;  2EA4 A;  4S01 A;  5CDL A;  3CB6 A;  4S2R P;  4HXX A;  3PKA A;  1YW8 A;  5JI6 A;  2G6P A;  1XGM A;  3S6B A;  1XNZ A;  2V3X A;  5CE6 A;  2Q93 A;  1C22 A;  1WLR A;  4FLK A;  2BHC A;  4IF7 A;  1C24 A;  5CDE A;  2IW2 A;  2V6C A;  1W2M A;  4QR8 A;  3MAT A;  1BOA A;  2V3Z A;  1WL9 A;  3D27 A;  5D6E A;  1C23 A;  4FO8 A;  2GU4 A;  2Q96 A;  3FMQ A;  2B3H A;  1WY2 A;  3PKB A;  2GGB A;  1YVM A;  1B6A A;  2Q95 A;  1XGN A;  4U71 A;  4IEC A;  4FUK A;  4U70 A;  4JUQ A;  4FLL A;  3ROR A;  1BN5 A;  2EVO A;  2MAT A;  2ZSG A;  2GGC A;  4U73 A;  1YW7 A;  4A6W A;  1C21 A;  2GG9 A;  2OAZ A;  3CB5 A;  3PKD A;  2P9A A;  3CTZ A;  1WN1 A;  1YJ3 A;  1JAW A;  2NQ7 A;  2GA2 A;  2BHD A;  4R60 A;  2BH3 A;  4U6E A;  4U6W A;  3RVA A;  1QXY A;  3Q6D A;  2BWU A;  4IDY A;  2DFI A;  2EVC A;  3L7G A;  3MR1 A;  5FCF A;  2BWS A;  4FLJ A;  5CDV A;  4ZWP A;  4ZWO A;  2BWX A;  4RZY A;  4IKU A;  2Q8K A;  1B59 A;  2ADU A;  2GG8 A;  1KP0 A;  4MAT A;  4U75 A;  4ZWU A;  1CHM A;  2GG0 A;  4FKC A;  4OOK A;  3PKE A;  4U6J A;  3BIP A;  1YW9 A;  1M35 A;  1WKM A;  2GU5 A;  2P99 A;  2GG5 A;  2GZ5 A;  2BWV A;  3TB5 A;  2HOW A;  1A16 A;  2NQ6 A;  2BWY A;  4RGZ 1;  1QXZ A;  2BWT A;  2BB7 A;  4S2T P;  5JHU A;  2BHB A;  5CNX A;  2B3K A;  4IKR A;  2GG7 A;  4PV4 A;  3BIT A;  1Y1N A;  2BWW A;  1O0X A;  4S00 A;  1KQ9 A;  2Q92 A;  1QZY A;  1W7V A;  3MX6 A;  3FMR A;  3IG4 A;  1QXW A;  2OKN A;  4ZNG A;  2V3Y A;  5D6F A;  4IPA A;  3BIQ A;  2GG3 A;  4FLI A;  5CIK A;  4EGE A;  2GU7 A;  4IKT A;  1C27 A;  2GG2 A;  2Q94 A;  3IU8 A;  1WL6 A;  2BHA A;  4IKS A;  2GTX A;  3IU9 A;  2B3L A;  2BN7 A;  4Z7M A;  3IU7 A;  4KM3 A;  2GU6 A;  1N51 A;  4U6Z A;  1R5G A;  3L24 A;  4U69 A;  5E5B A;  4A6V A;  5JFR A;  1XGO A;  3PKC A;  4U6C A;  3TAV A;  4FO7 A;  4B28 A;  1XGS A;  4U1B A;  1KQ0 A;  4PNC A;  4U76 A;  2P98 A;  5FCH A;  1R58 A;  3FM3 A;  1PV9 A;  1MAT A; 
#chains in the Genus database with same CATH homology
 2EVM A;  1WBQ A;  4RZZ A;  5CLS A;  4IU6 A;  2EA2 A;  1R5H A;  2EA4 A;  4S01 A;  5CDL A;  3CB6 A;  4S2R P;  4HXX A;  3PKA A;  1YW8 A;  5JI6 A;  2G6P A;  1XGM A;  3S6B A;  1XNZ A;  2V3X A;  5CE6 A;  2Q93 A;  1C22 A;  1WLR A;  4FLK A;  2BHC A;  4IF7 A;  1C24 A;  5CDE A;  2IW2 A;  2V6C A;  1W2M A;  4QR8 A;  3MAT A;  1BOA A;  2V3Z A;  1WL9 A;  3D27 A;  5D6E A;  1C23 A;  4FO8 A;  2GU4 A;  2Q96 A;  3FMQ A;  2B3H A;  1WY2 A;  3PKB A;  2GGB A;  1YVM A;  1B6A A;  2Q95 A;  1XGN A;  4U71 A;  4IEC A;  4FUK A;  4U70 A;  4JUQ A;  4FLL A;  3ROR A;  1BN5 A;  2EVO A;  2MAT A;  2ZSG A;  2GGC A;  4U73 A;  1YW7 A;  4A6W A;  1C21 A;  2GG9 A;  2OAZ A;  3CB5 A;  3PKD A;  2P9A A;  3CTZ A;  1WN1 A;  1YJ3 A;  1JAW A;  2NQ7 A;  2GA2 A;  2BHD A;  4R60 A;  2BH3 A;  4U6E A;  4U6W A;  3RVA A;  1QXY A;  3Q6D A;  2BWU A;  4IDY A;  2DFI A;  2EVC A;  3L7G A;  3MR1 A;  5FCF A;  2BWS A;  4FLJ A;  5CDV A;  4ZWP A;  4ZWO A;  2BWX A;  4RZY A;  4IKU A;  2Q8K A;  1B59 A;  2ADU A;  2GG8 A;  1KP0 A;  4MAT A;  4U75 A;  4ZWU A;  1CHM A;  2GG0 A;  4FKC A;  4OOK A;  3PKE A;  4U6J A;  3BIP A;  1YW9 A;  1M35 A;  1WKM A;  2GU5 A;  2P99 A;  2GG5 A;  2GZ5 A;  2BWV A;  3TB5 A;  2HOW A;  1A16 A;  2NQ6 A;  2BWY A;  4RGZ 1;  1QXZ A;  2BWT A;  2BB7 A;  4S2T P;  5JHU A;  2BHB A;  5CNX A;  2B3K A;  4IKR A;  2GG7 A;  4PV4 A;  3BIT A;  1Y1N A;  2BWW A;  1O0X A;  4S00 A;  1KQ9 A;  2Q92 A;  1QZY A;  1W7V A;  3MX6 A;  3FMR A;  3IG4 A;  1QXW A;  2OKN A;  4ZNG A;  2V3Y A;  5D6F A;  4IPA A;  3BIQ A;  2GG3 A;  4FLI A;  5CIK A;  4EGE A;  2GU7 A;  4IKT A;  1C27 A;  2GG2 A;  2Q94 A;  3IU8 A;  1WL6 A;  2BHA A;  4IKS A;  2GTX A;  3IU9 A;  2B3L A;  2BN7 A;  4Z7M A;  3IU7 A;  4KM3 A;  2GU6 A;  1N51 A;  4U6Z A;  1R5G A;  3L24 A;  4U69 A;  5E5B A;  4A6V A;  5JFR A;  1XGO A;  3PKC A;  4U6C A;  3TAV A;  4FO7 A;  4B28 A;  1XGS A;  4U1B A;  1KQ0 A;  4PNC A;  4U76 A;  2P98 A;  5FCH A;  1R58 A;  3FM3 A;  1PV9 A;  1MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...