2GG0A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg0A00
2BHBA 5JHUA 3PKBA 1A16A 1C22A 2GTXA 3CB6A 4ZWPA 1R5HA 4FLJA 4FUKA 4U1BA 5CE6A 2DFIA 3Q6DA 4PV4A 5CDEA 2GA2A 2GG2A 2Q92A 4U76A 2GU7A 4ZWOA 2BWTA 4FKCA 3BIQA 3FMRA 1XGMA 1XNZA 2Q93A 2V3ZA 4HXXA 1C21A 3PKCA 4OOKA 4U70A 2B3KA 4KM3A 4FLIA 1WY2A 3FMQA 2V3XA 2GGCA 2GG0A 4S01A 1QXZA 4S2TP 5CIKA 4B28A 4A6WA 3TB5A 4S2RP 4U6ZA 4A6VA 3IU7A 5JFRA 2BB7A 4U6JA 4ZNGA 2Q95A 3PKDA 4IKRA 1XGOA 4IKUA 1B59A 2BH3A 4IPAA 1W2MA 2ADUA 2GZ5A 1YVMA 2GG7A 3TAVA 2GG5A 1B6AA 4Z7MA 1CHMA 1XGSA 2EA2A 2V6CA 2BWYA 3RVAA 2GG8A 1O0XA 3L24A 1WL9A 2EVMA 5JI6A 4RZYA 2BWSA 2GU6A 2B3HA 2OKNA 1WN1A 2Q96A 1C27A 2BWVA 3PKAA 5D6FA 4U6CA 1M35A 4IECA 5D6EA 1KQ9A 1XGNA 1JAWA 4RZZA 1QXWA 4FO7A 5CDVA 2EVOA 2BHAA 1YW8A 2EVCA 4U75A 2OAZA 2B3LA 3CTZA 2GG3A 2V3YA 4RGZ1 5CDLA 4MATA 2ZSGA 3S6BA 1N51A 1WKMA 2BHDA 4FLLA 4R60A 2P99A 5E5BA 5FCFA 3D27A 3IG4A 1W7VA 1KP0A 4U69A 2P98A 2GU5A 3MR1A 4FO8A 4IF7A 4ZWUA 1BN5A 2GG9A 2NQ7A 2G6PA 2HOWA 4IKSA 4FLKA 1R58A 1QZYA 1WLRA 2NQ6A 2BWXA 3CB5A 2GGBA 2P9AA 4U73A 1PV9A 1WBQA 1C24A 4IU6A 1KQ0A 2MATA 3RORA 2BWUA 4U6EA 2BWWA 3BITA 2BHCA 4PNCA 3MATA 1YW7A 3BIPA 1C23A 4QR8A 4EGEA 2EA4A 3IU9A 4S00A 2IW2A 1R5GA 2Q94A 3PKEA 5CNXA 2Q8KA 4JUQA 3FM3A 1BOAA 3L7GA 2BN7A 1YW9A 4U71A 1QXYA 1YJ3A 4IDYA 4IKTA 5CLSA 1MATA 1Y1NA 4U6WA 5FCHA 1WL6A 3IU8A 2GU4A 3MX6A
chains in the Genus database with same CATH superfamily
2BHBA 5JHUA 3PKBA 1A16A 1C22A 2GTXA 3CB6A 4ZWPA 1R5HA 4FLJA 4FUKA 4U1BA 5CE6A 2DFIA 3Q6DA 4PV4A 5CDEA 2GA2A 2GG2A 2Q92A 4U76A 2GU7A 4ZWOA 2BWTA 4FKCA 3BIQA 3FMRA 1XGMA 1XNZA 2Q93A 2V3ZA 4HXXA 1C21A 3PKCA 4OOKA 4U70A 2B3KA 4KM3A 4FLIA 1WY2A 3FMQA 2V3XA 2GGCA 2GG0A 4S01A 1QXZA 4S2TP 5CIKA 4B28A 4A6WA 3TB5A 4S2RP 4U6ZA 4A6VA 3IU7A 5JFRA 2BB7A 4U6JA 4ZNGA 2Q95A 3PKDA 4IKRA 1XGOA 4IKUA 1B59A 2BH3A 4IPAA 1W2MA 2ADUA 2GZ5A 1YVMA 2GG7A 3TAVA 2GG5A 1B6AA 4Z7MA 1CHMA 1XGSA 2EA2A 2V6CA 2BWYA 3RVAA 2GG8A 1O0XA 3L24A 1WL9A 2EVMA 5JI6A 4RZYA 2BWSA 2GU6A 2B3HA 2OKNA 1WN1A 2Q96A 1C27A 2BWVA 3PKAA 5D6FA 4U6CA 1M35A 4IECA 5D6EA 1KQ9A 1XGNA 1JAWA 4RZZA 1QXWA 4FO7A 5CDVA 2EVOA 2BHAA 1YW8A 2EVCA 4U75A 2OAZA 2B3LA 3CTZA 2GG3A 2V3YA 4RGZ1 5CDLA 4MATA 2ZSGA 3S6BA 1N51A 1WKMA 2BHDA 4FLLA 4R60A 2P99A 5E5BA 5FCFA 3D27A 3IG4A 1W7VA 1KP0A 4U69A 2P98A 2GU5A 3MR1A 4FO8A 4IF7A 4ZWUA 1BN5A 2GG9A 2NQ7A 2G6PA 2HOWA 4IKSA 4FLKA 1R58A 1QZYA 1WLRA 2NQ6A 2BWXA 3CB5A 2GGBA 2P9AA 4U73A 1PV9A 1WBQA 1C24A 4IU6A 1KQ0A 2MATA 3RORA 2BWUA 4U6EA 2BWWA 3BITA 2BHCA 4PNCA 3MATA 1YW7A 3BIPA 1C23A 4QR8A 4EGEA 2EA4A 3IU9A 4S00A 2IW2A 1R5GA 2Q94A 3PKEA 5CNXA 2Q8KA 4JUQA 3FM3A 1BOAA 3L7GA 2BN7A 1YW9A 4U71A 1QXYA 1YJ3A 4IDYA 4IKTA 5CLSA 1MATA 1Y1NA 4U6WA 5FCHA 1WL6A 3IU8A 2GU4A 3MX6A
chains in the Genus database with same CATH topology
2BHBA 5JHUA 3PKBA 1A16A 1C22A 2GTXA 3CB6A 4ZWPA 1R5HA 4FLJA 4FUKA 4U1BA 5CE6A 2DFIA 3Q6DA 4PV4A 5CDEA 2GA2A 2GG2A 2Q92A 4U76A 2GU7A 4ZWOA 2BWTA 4FKCA 3BIQA 3FMRA 1XGMA 1XNZA 2Q93A 2V3ZA 4HXXA 1C21A 3PKCA 4OOKA 4U70A 2B3KA 4KM3A 4FLIA 1WY2A 3FMQA 2V3XA 2GGCA 2GG0A 4S01A 1QXZA 4S2TP 5CIKA 4B28A 4A6WA 3TB5A 4S2RP 4U6ZA 4A6VA 3IU7A 5JFRA 2BB7A 4U6JA 4ZNGA 2Q95A 3PKDA 4IKRA 1XGOA 4IKUA 1B59A 2BH3A 4IPAA 1W2MA 2ADUA 2GZ5A 1YVMA 2GG7A 3TAVA 2GG5A 1B6AA 4Z7MA 1CHMA 1XGSA 2EA2A 2V6CA 2BWYA 3RVAA 2GG8A 1O0XA 3L24A 1WL9A 2EVMA 5JI6A 4RZYA 2BWSA 2GU6A 2B3HA 2OKNA 1WN1A 2Q96A 1C27A 2BWVA 3PKAA 5D6FA 4U6CA 1M35A 4IECA 5D6EA 1KQ9A 1XGNA 1JAWA 4RZZA 1QXWA 4FO7A 5CDVA 2EVOA 2BHAA 1YW8A 2EVCA 4U75A 2OAZA 2B3LA 3CTZA 2GG3A 2V3YA 4RGZ1 5CDLA 4MATA 2ZSGA 3S6BA 1N51A 1WKMA 2BHDA 4FLLA 4R60A 2P99A 5E5BA 5FCFA 3D27A 3IG4A 1W7VA 1KP0A 4U69A 2P98A 2GU5A 3MR1A 4FO8A 4IF7A 4ZWUA 1BN5A 2GG9A 2NQ7A 2G6PA 2HOWA 4IKSA 4FLKA 1R58A 1QZYA 1WLRA 2NQ6A 2BWXA 3CB5A 2GGBA 2P9AA 4U73A 1PV9A 1WBQA 1C24A 4IU6A 1KQ0A 2MATA 3RORA 2BWUA 4U6EA 2BWWA 3BITA 2BHCA 4PNCA 3MATA 1YW7A 3BIPA 1C23A 4QR8A 4EGEA 2EA4A 3IU9A 4S00A 2IW2A 1R5GA 2Q94A 3PKEA 5CNXA 2Q8KA 4JUQA 3FM3A 1BOAA 3L7GA 2BN7A 1YW9A 4U71A 1QXYA 1YJ3A 4IDYA 4IKTA 5CLSA 1MATA 1Y1NA 4U6WA 5FCHA 1WL6A 3IU8A 2GU4A 3MX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHB A;  5JHU A;  3PKB A;  1A16 A;  1C22 A;  2GTX A;  3CB6 A;  4ZWP A;  1R5H A;  4FLJ A;  4FUK A;  4U1B A;  5CE6 A;  2DFI A;  3Q6D A;  4PV4 A;  5CDE A;  2GA2 A;  2GG2 A;  2Q92 A;  4U76 A;  2GU7 A;  4ZWO A;  2BWT A;  4FKC A;  3BIQ A;  3FMR A;  1XGM A;  1XNZ A;  2Q93 A;  2V3Z A;  4HXX A;  1C21 A;  3PKC A;  4OOK A;  4U70 A;  2B3K A;  4KM3 A;  4FLI A;  1WY2 A;  3FMQ A;  2V3X A;  2GGC A;  2GG0 A;  4S01 A;  1QXZ A;  4S2T P;  5CIK A;  4B28 A;  4A6W A;  3TB5 A;  4S2R P;  4U6Z A;  4A6V A;  3IU7 A;  5JFR A;  2BB7 A;  4U6J A;  4ZNG A;  2Q95 A;  3PKD A;  4IKR A;  1XGO A;  4IKU A;  1B59 A;  2BH3 A;  4IPA A;  1W2M A;  2ADU A;  2GZ5 A;  1YVM A;  2GG7 A;  3TAV A;  2GG5 A;  1B6A A;  4Z7M A;  1CHM A;  1XGS A;  2EA2 A;  2V6C A;  2BWY A;  3RVA A;  2GG8 A;  1O0X A;  3L24 A;  1WL9 A;  2EVM A;  5JI6 A;  4RZY A;  2BWS A;  2GU6 A;  2B3H A;  2OKN A;  1WN1 A;  2Q96 A;  1C27 A;  2BWV A;  3PKA A;  5D6F A;  4U6C A;  1M35 A;  4IEC A;  5D6E A;  1KQ9 A;  1XGN A;  1JAW A;  4RZZ A;  1QXW A;  4FO7 A;  5CDV A;  2EVO A;  2BHA A;  1YW8 A;  2EVC A;  4U75 A;  2OAZ A;  2B3L A;  3CTZ A;  2GG3 A;  2V3Y A;  4RGZ 1;  5CDL A;  4MAT A;  2ZSG A;  3S6B A;  1N51 A;  1WKM A;  2BHD A;  4FLL A;  4R60 A;  2P99 A;  5E5B A;  5FCF A;  3D27 A;  3IG4 A;  1W7V A;  1KP0 A;  4U69 A;  2P98 A;  2GU5 A;  3MR1 A;  4FO8 A;  4IF7 A;  4ZWU A;  1BN5 A;  2GG9 A;  2NQ7 A;  2G6P A;  2HOW A;  4IKS A;  4FLK A;  1R58 A;  1QZY A;  1WLR A;  2NQ6 A;  2BWX A;  3CB5 A;  2GGB A;  2P9A A;  4U73 A;  1PV9 A;  1WBQ A;  1C24 A;  4IU6 A;  1KQ0 A;  2MAT A;  3ROR A;  2BWU A;  4U6E A;  2BWW A;  3BIT A;  2BHC A;  4PNC A;  3MAT A;  1YW7 A;  3BIP A;  1C23 A;  4QR8 A;  4EGE A;  2EA4 A;  3IU9 A;  4S00 A;  2IW2 A;  1R5G A;  2Q94 A;  3PKE A;  5CNX A;  2Q8K A;  4JUQ A;  3FM3 A;  1BOA A;  3L7G A;  2BN7 A;  1YW9 A;  4U71 A;  1QXY A;  1YJ3 A;  4IDY A;  4IKT A;  5CLS A;  1MAT A;  1Y1N A;  4U6W A;  5FCH A;  1WL6 A;  3IU8 A;  2GU4 A;  3MX6 A; 
#chains in the Genus database with same CATH topology
 2BHB A;  5JHU A;  3PKB A;  1A16 A;  1C22 A;  2GTX A;  3CB6 A;  4ZWP A;  1R5H A;  4FLJ A;  4FUK A;  4U1B A;  5CE6 A;  2DFI A;  3Q6D A;  4PV4 A;  5CDE A;  2GA2 A;  2GG2 A;  2Q92 A;  4U76 A;  2GU7 A;  4ZWO A;  2BWT A;  4FKC A;  3BIQ A;  3FMR A;  1XGM A;  1XNZ A;  2Q93 A;  2V3Z A;  4HXX A;  1C21 A;  3PKC A;  4OOK A;  4U70 A;  2B3K A;  4KM3 A;  4FLI A;  1WY2 A;  3FMQ A;  2V3X A;  2GGC A;  2GG0 A;  4S01 A;  1QXZ A;  4S2T P;  5CIK A;  4B28 A;  4A6W A;  3TB5 A;  4S2R P;  4U6Z A;  4A6V A;  3IU7 A;  5JFR A;  2BB7 A;  4U6J A;  4ZNG A;  2Q95 A;  3PKD A;  4IKR A;  1XGO A;  4IKU A;  1B59 A;  2BH3 A;  4IPA A;  1W2M A;  2ADU A;  2GZ5 A;  1YVM A;  2GG7 A;  3TAV A;  2GG5 A;  1B6A A;  4Z7M A;  1CHM A;  1XGS A;  2EA2 A;  2V6C A;  2BWY A;  3RVA A;  2GG8 A;  1O0X A;  3L24 A;  1WL9 A;  2EVM A;  5JI6 A;  4RZY A;  2BWS A;  2GU6 A;  2B3H A;  2OKN A;  1WN1 A;  2Q96 A;  1C27 A;  2BWV A;  3PKA A;  5D6F A;  4U6C A;  1M35 A;  4IEC A;  5D6E A;  1KQ9 A;  1XGN A;  1JAW A;  4RZZ A;  1QXW A;  4FO7 A;  5CDV A;  2EVO A;  2BHA A;  1YW8 A;  2EVC A;  4U75 A;  2OAZ A;  2B3L A;  3CTZ A;  2GG3 A;  2V3Y A;  4RGZ 1;  5CDL A;  4MAT A;  2ZSG A;  3S6B A;  1N51 A;  1WKM A;  2BHD A;  4FLL A;  4R60 A;  2P99 A;  5E5B A;  5FCF A;  3D27 A;  3IG4 A;  1W7V A;  1KP0 A;  4U69 A;  2P98 A;  2GU5 A;  3MR1 A;  4FO8 A;  4IF7 A;  4ZWU A;  1BN5 A;  2GG9 A;  2NQ7 A;  2G6P A;  2HOW A;  4IKS A;  4FLK A;  1R58 A;  1QZY A;  1WLR A;  2NQ6 A;  2BWX A;  3CB5 A;  2GGB A;  2P9A A;  4U73 A;  1PV9 A;  1WBQ A;  1C24 A;  4IU6 A;  1KQ0 A;  2MAT A;  3ROR A;  2BWU A;  4U6E A;  2BWW A;  3BIT A;  2BHC A;  4PNC A;  3MAT A;  1YW7 A;  3BIP A;  1C23 A;  4QR8 A;  4EGE A;  2EA4 A;  3IU9 A;  4S00 A;  2IW2 A;  1R5G A;  2Q94 A;  3PKE A;  5CNX A;  2Q8K A;  4JUQ A;  3FM3 A;  1BOA A;  3L7G A;  2BN7 A;  1YW9 A;  4U71 A;  1QXY A;  1YJ3 A;  4IDY A;  4IKT A;  5CLS A;  1MAT A;  1Y1N A;  4U6W A;  5FCH A;  1WL6 A;  3IU8 A;  2GU4 A;  3MX6 A; 
#chains in the Genus database with same CATH homology
 2BHB A;  5JHU A;  3PKB A;  1A16 A;  1C22 A;  2GTX A;  3CB6 A;  4ZWP A;  1R5H A;  4FLJ A;  4FUK A;  4U1B A;  5CE6 A;  2DFI A;  3Q6D A;  4PV4 A;  5CDE A;  2GA2 A;  2GG2 A;  2Q92 A;  4U76 A;  2GU7 A;  4ZWO A;  2BWT A;  4FKC A;  3BIQ A;  3FMR A;  1XGM A;  1XNZ A;  2Q93 A;  2V3Z A;  4HXX A;  1C21 A;  3PKC A;  4OOK A;  4U70 A;  2B3K A;  4KM3 A;  4FLI A;  1WY2 A;  3FMQ A;  2V3X A;  2GGC A;  2GG0 A;  4S01 A;  1QXZ A;  4S2T P;  5CIK A;  4B28 A;  4A6W A;  3TB5 A;  4S2R P;  4U6Z A;  4A6V A;  3IU7 A;  5JFR A;  2BB7 A;  4U6J A;  4ZNG A;  2Q95 A;  3PKD A;  4IKR A;  1XGO A;  4IKU A;  1B59 A;  2BH3 A;  4IPA A;  1W2M A;  2ADU A;  2GZ5 A;  1YVM A;  2GG7 A;  3TAV A;  2GG5 A;  1B6A A;  4Z7M A;  1CHM A;  1XGS A;  2EA2 A;  2V6C A;  2BWY A;  3RVA A;  2GG8 A;  1O0X A;  3L24 A;  1WL9 A;  2EVM A;  5JI6 A;  4RZY A;  2BWS A;  2GU6 A;  2B3H A;  2OKN A;  1WN1 A;  2Q96 A;  1C27 A;  2BWV A;  3PKA A;  5D6F A;  4U6C A;  1M35 A;  4IEC A;  5D6E A;  1KQ9 A;  1XGN A;  1JAW A;  4RZZ A;  1QXW A;  4FO7 A;  5CDV A;  2EVO A;  2BHA A;  1YW8 A;  2EVC A;  4U75 A;  2OAZ A;  2B3L A;  3CTZ A;  2GG3 A;  2V3Y A;  4RGZ 1;  5CDL A;  4MAT A;  2ZSG A;  3S6B A;  1N51 A;  1WKM A;  2BHD A;  4FLL A;  4R60 A;  2P99 A;  5E5B A;  5FCF A;  3D27 A;  3IG4 A;  1W7V A;  1KP0 A;  4U69 A;  2P98 A;  2GU5 A;  3MR1 A;  4FO8 A;  4IF7 A;  4ZWU A;  1BN5 A;  2GG9 A;  2NQ7 A;  2G6P A;  2HOW A;  4IKS A;  4FLK A;  1R58 A;  1QZY A;  1WLR A;  2NQ6 A;  2BWX A;  3CB5 A;  2GGB A;  2P9A A;  4U73 A;  1PV9 A;  1WBQ A;  1C24 A;  4IU6 A;  1KQ0 A;  2MAT A;  3ROR A;  2BWU A;  4U6E A;  2BWW A;  3BIT A;  2BHC A;  4PNC A;  3MAT A;  1YW7 A;  3BIP A;  1C23 A;  4QR8 A;  4EGE A;  2EA4 A;  3IU9 A;  4S00 A;  2IW2 A;  1R5G A;  2Q94 A;  3PKE A;  5CNX A;  2Q8K A;  4JUQ A;  3FM3 A;  1BOA A;  3L7G A;  2BN7 A;  1YW9 A;  4U71 A;  1QXY A;  1YJ3 A;  4IDY A;  4IKT A;  5CLS A;  1MAT A;  1Y1N A;  4U6W A;  5FCH A;  1WL6 A;  3IU8 A;  2GU4 A;  3MX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...