2GG0A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 84
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg0A00
4IU6A 1YJ3A 3FMRA 4IDYA 4U76A 2BWVA 3IU8A 2P98A 3PKBA 4U70A 4FO7A 4IPAA 1KQ0A 1YW8A 3RORA 2NQ6A 3FM3A 1C22A 4FO8A 4U71A 1XGSA 1R5HA 2GG0A 3PKCA 3IU7A 4HXXA 2GG2A 2Q95A 1WN1A 2GU6A 4A6WA 4S2TP 1WL6A 4FLLA 4B28A 1KP0A 1WLRA 1W2MA 2BWSA 2Q92A 4FLKA 2P9AA 4IECA 3MATA 3Q6DA 4U6EA 3TB5A 2EA2A 1C21A 4PNCA 1JAWA 2BHCA 5CE6A 5JFRA 4S01A 1QXWA 2GU5A 1B6AA 1C27A 5JHUA 1BN5A 3CB6A 4IKUA 4ZNGA 1PV9A 2GA2A 1QXYA 2V3ZA 3BIPA 4S2RP 1YVMA 1BOAA 2P99A 1C24A 1R5GA 2Q94A 2ADUA 4ZWUA 4PV4A 2MATA 1A16A 2G6PA 5JI6A 2V3YA 2B3KA 4FKCA 4RZYA 3RVAA 1XGMA 1M35A 2GU4A 2GGCA 4KM3A 2Q93A 2GG9A 5CDVA 4FUKA 1Y1NA 1QZYA 3L7GA 3FMQA 1XGNA 2BWUA 3S6BA 1WL9A 5CIKA 3IG4A 2GU7A 2GG5A 4ZWOA 2GG8A 1XGOA 4ZWPA 2Q96A 2OAZA 2B3HA 1KQ9A 4IKRA 3MR1A 5D6FA 2GG7A 3BIQA 2EA4A 1XNZA 2EVOA 3CB5A 2BWWA 4R60A 4RGZ1 1W7VA 1YW9A 1N51A 2BWTA 5CDLA 4S00A 4JUQA 1O0XA 4U6WA 2BWYA 4FLJA 2GTXA 4IKTA 1MATA 2GZ5A 2Q8KA 4U6JA 2EVCA 1R58A 4IF7A 4U69A 5E5BA 4QR8A 2GGBA 1CHMA 4EGEA 2ZSGA 4U1BA 1WKMA 3CTZA 4U75A 2V6CA 4OOKA 4U6CA 5FCFA 3PKAA 1B59A 3PKDA 4MATA 2V3XA 4U73A 1WBQA 4RZZA 2BHDA 3BITA 2BHBA 5CNXA 4FLIA 2B3LA 3TAVA 2BN7A 2BH3A 2BB7A 4IKSA 1QXZA 5FCHA 2NQ7A 2IW2A 2HOWA 2DFIA 3IU9A 5CLSA 5CDEA 2EVMA 1WY2A 3MX6A 5D6EA 4Z7MA 1YW7A 2OKNA 4U6ZA 3PKEA 1C23A 2BHAA 2GG3A 4A6VA 3D27A 3L24A 2BWXA
chains in the Genus database with same CATH superfamily
4IU6A 1YJ3A 3FMRA 4IDYA 4U76A 2BWVA 3IU8A 2P98A 3PKBA 4U70A 4FO7A 4IPAA 1KQ0A 1YW8A 3RORA 2NQ6A 3FM3A 1C22A 4FO8A 4U71A 1XGSA 1R5HA 2GG0A 3PKCA 3IU7A 4HXXA 2GG2A 2Q95A 1WN1A 2GU6A 4A6WA 4S2TP 1WL6A 4FLLA 4B28A 1KP0A 1WLRA 1W2MA 2BWSA 2Q92A 4FLKA 2P9AA 4IECA 3MATA 3Q6DA 4U6EA 3TB5A 2EA2A 1C21A 4PNCA 1JAWA 2BHCA 5CE6A 5JFRA 4S01A 1QXWA 2GU5A 1B6AA 1C27A 5JHUA 1BN5A 3CB6A 4IKUA 4ZNGA 1PV9A 2GA2A 1QXYA 2V3ZA 3BIPA 4S2RP 1YVMA 1BOAA 2P99A 1C24A 1R5GA 2Q94A 2ADUA 4ZWUA 4PV4A 2MATA 1A16A 2G6PA 5JI6A 2V3YA 2B3KA 4FKCA 4RZYA 3RVAA 1XGMA 1M35A 2GU4A 2GGCA 4KM3A 2Q93A 2GG9A 5CDVA 4FUKA 1Y1NA 1QZYA 3L7GA 3FMQA 1XGNA 2BWUA 3S6BA 1WL9A 5CIKA 3IG4A 2GU7A 2GG5A 4ZWOA 2GG8A 1XGOA 4ZWPA 2Q96A 2OAZA 2B3HA 1KQ9A 4IKRA 3MR1A 5D6FA 2GG7A 3BIQA 2EA4A 1XNZA 2EVOA 3CB5A 2BWWA 4R60A 4RGZ1 1W7VA 1YW9A 1N51A 2BWTA 5CDLA 4S00A 4JUQA 1O0XA 4U6WA 2BWYA 4FLJA 2GTXA 4IKTA 1MATA 2GZ5A 2Q8KA 4U6JA 2EVCA 1R58A 4IF7A 4U69A 5E5BA 4QR8A 2GGBA 1CHMA 4EGEA 2ZSGA 4U1BA 1WKMA 3CTZA 4U75A 2V6CA 4OOKA 4U6CA 5FCFA 3PKAA 1B59A 3PKDA 4MATA 2V3XA 4U73A 1WBQA 4RZZA 2BHDA 3BITA 2BHBA 5CNXA 4FLIA 2B3LA 3TAVA 2BN7A 2BH3A 2BB7A 4IKSA 1QXZA 5FCHA 2NQ7A 2IW2A 2HOWA 2DFIA 3IU9A 5CLSA 5CDEA 2EVMA 1WY2A 3MX6A 5D6EA 4Z7MA 1YW7A 2OKNA 4U6ZA 3PKEA 1C23A 2BHAA 2GG3A 4A6VA 3D27A 3L24A 2BWXA
chains in the Genus database with same CATH topology
4IU6A 1YJ3A 3FMRA 4IDYA 4U76A 2BWVA 3IU8A 2P98A 3PKBA 4U70A 4FO7A 4IPAA 1KQ0A 1YW8A 3RORA 2NQ6A 3FM3A 1C22A 4FO8A 4U71A 1XGSA 1R5HA 2GG0A 3PKCA 3IU7A 4HXXA 2GG2A 2Q95A 1WN1A 2GU6A 4A6WA 4S2TP 1WL6A 4FLLA 4B28A 1KP0A 1WLRA 1W2MA 2BWSA 2Q92A 4FLKA 2P9AA 4IECA 3MATA 3Q6DA 4U6EA 3TB5A 2EA2A 1C21A 4PNCA 1JAWA 2BHCA 5CE6A 5JFRA 4S01A 1QXWA 2GU5A 1B6AA 1C27A 5JHUA 1BN5A 3CB6A 4IKUA 4ZNGA 1PV9A 2GA2A 1QXYA 2V3ZA 3BIPA 4S2RP 1YVMA 1BOAA 2P99A 1C24A 1R5GA 2Q94A 2ADUA 4ZWUA 4PV4A 2MATA 1A16A 2G6PA 5JI6A 2V3YA 2B3KA 4FKCA 4RZYA 3RVAA 1XGMA 1M35A 2GU4A 2GGCA 4KM3A 2Q93A 2GG9A 5CDVA 4FUKA 1Y1NA 1QZYA 3L7GA 3FMQA 1XGNA 2BWUA 3S6BA 1WL9A 5CIKA 3IG4A 2GU7A 2GG5A 4ZWOA 2GG8A 1XGOA 4ZWPA 2Q96A 2OAZA 2B3HA 1KQ9A 4IKRA 3MR1A 5D6FA 2GG7A 3BIQA 2EA4A 1XNZA 2EVOA 3CB5A 2BWWA 4R60A 4RGZ1 1W7VA 1YW9A 1N51A 2BWTA 5CDLA 4S00A 4JUQA 1O0XA 4U6WA 2BWYA 4FLJA 2GTXA 4IKTA 1MATA 2GZ5A 2Q8KA 4U6JA 2EVCA 1R58A 4IF7A 4U69A 5E5BA 4QR8A 2GGBA 1CHMA 4EGEA 2ZSGA 4U1BA 1WKMA 3CTZA 4U75A 2V6CA 4OOKA 4U6CA 5FCFA 3PKAA 1B59A 3PKDA 4MATA 2V3XA 4U73A 1WBQA 4RZZA 2BHDA 3BITA 2BHBA 5CNXA 4FLIA 2B3LA 3TAVA 2BN7A 2BH3A 2BB7A 4IKSA 1QXZA 5FCHA 2NQ7A 2IW2A 2HOWA 2DFIA 3IU9A 5CLSA 5CDEA 2EVMA 1WY2A 3MX6A 5D6EA 4Z7MA 1YW7A 2OKNA 4U6ZA 3PKEA 1C23A 2BHAA 2GG3A 4A6VA 3D27A 3L24A 2BWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IU6 A;  1YJ3 A;  3FMR A;  4IDY A;  4U76 A;  2BWV A;  3IU8 A;  2P98 A;  3PKB A;  4U70 A;  4FO7 A;  4IPA A;  1KQ0 A;  1YW8 A;  3ROR A;  2NQ6 A;  3FM3 A;  1C22 A;  4FO8 A;  4U71 A;  1XGS A;  1R5H A;  2GG0 A;  3PKC A;  3IU7 A;  4HXX A;  2GG2 A;  2Q95 A;  1WN1 A;  2GU6 A;  4A6W A;  4S2T P;  1WL6 A;  4FLL A;  4B28 A;  1KP0 A;  1WLR A;  1W2M A;  2BWS A;  2Q92 A;  4FLK A;  2P9A A;  4IEC A;  3MAT A;  3Q6D A;  4U6E A;  3TB5 A;  2EA2 A;  1C21 A;  4PNC A;  1JAW A;  2BHC A;  5CE6 A;  5JFR A;  4S01 A;  1QXW A;  2GU5 A;  1B6A A;  1C27 A;  5JHU A;  1BN5 A;  3CB6 A;  4IKU A;  4ZNG A;  1PV9 A;  2GA2 A;  1QXY A;  2V3Z A;  3BIP A;  4S2R P;  1YVM A;  1BOA A;  2P99 A;  1C24 A;  1R5G A;  2Q94 A;  2ADU A;  4ZWU A;  4PV4 A;  2MAT A;  1A16 A;  2G6P A;  5JI6 A;  2V3Y A;  2B3K A;  4FKC A;  4RZY A;  3RVA A;  1XGM A;  1M35 A;  2GU4 A;  2GGC A;  4KM3 A;  2Q93 A;  2GG9 A;  5CDV A;  4FUK A;  1Y1N A;  1QZY A;  3L7G A;  3FMQ A;  1XGN A;  2BWU A;  3S6B A;  1WL9 A;  5CIK A;  3IG4 A;  2GU7 A;  2GG5 A;  4ZWO A;  2GG8 A;  1XGO A;  4ZWP A;  2Q96 A;  2OAZ A;  2B3H A;  1KQ9 A;  4IKR A;  3MR1 A;  5D6F A;  2GG7 A;  3BIQ A;  2EA4 A;  1XNZ A;  2EVO A;  3CB5 A;  2BWW A;  4R60 A;  4RGZ 1;  1W7V A;  1YW9 A;  1N51 A;  2BWT A;  5CDL A;  4S00 A;  4JUQ A;  1O0X A;  4U6W A;  2BWY A;  4FLJ A;  2GTX A;  4IKT A;  1MAT A;  2GZ5 A;  2Q8K A;  4U6J A;  2EVC A;  1R58 A;  4IF7 A;  4U69 A;  5E5B A;  4QR8 A;  2GGB A;  1CHM A;  4EGE A;  2ZSG A;  4U1B A;  1WKM A;  3CTZ A;  4U75 A;  2V6C A;  4OOK A;  4U6C A;  5FCF A;  3PKA A;  1B59 A;  3PKD A;  4MAT A;  2V3X A;  4U73 A;  1WBQ A;  4RZZ A;  2BHD A;  3BIT A;  2BHB A;  5CNX A;  4FLI A;  2B3L A;  3TAV A;  2BN7 A;  2BH3 A;  2BB7 A;  4IKS A;  1QXZ A;  5FCH A;  2NQ7 A;  2IW2 A;  2HOW A;  2DFI A;  3IU9 A;  5CLS A;  5CDE A;  2EVM A;  1WY2 A;  3MX6 A;  5D6E A;  4Z7M A;  1YW7 A;  2OKN A;  4U6Z A;  3PKE A;  1C23 A;  2BHA A;  2GG3 A;  4A6V A;  3D27 A;  3L24 A;  2BWX A; 
#chains in the Genus database with same CATH topology
 4IU6 A;  1YJ3 A;  3FMR A;  4IDY A;  4U76 A;  2BWV A;  3IU8 A;  2P98 A;  3PKB A;  4U70 A;  4FO7 A;  4IPA A;  1KQ0 A;  1YW8 A;  3ROR A;  2NQ6 A;  3FM3 A;  1C22 A;  4FO8 A;  4U71 A;  1XGS A;  1R5H A;  2GG0 A;  3PKC A;  3IU7 A;  4HXX A;  2GG2 A;  2Q95 A;  1WN1 A;  2GU6 A;  4A6W A;  4S2T P;  1WL6 A;  4FLL A;  4B28 A;  1KP0 A;  1WLR A;  1W2M A;  2BWS A;  2Q92 A;  4FLK A;  2P9A A;  4IEC A;  3MAT A;  3Q6D A;  4U6E A;  3TB5 A;  2EA2 A;  1C21 A;  4PNC A;  1JAW A;  2BHC A;  5CE6 A;  5JFR A;  4S01 A;  1QXW A;  2GU5 A;  1B6A A;  1C27 A;  5JHU A;  1BN5 A;  3CB6 A;  4IKU A;  4ZNG A;  1PV9 A;  2GA2 A;  1QXY A;  2V3Z A;  3BIP A;  4S2R P;  1YVM A;  1BOA A;  2P99 A;  1C24 A;  1R5G A;  2Q94 A;  2ADU A;  4ZWU A;  4PV4 A;  2MAT A;  1A16 A;  2G6P A;  5JI6 A;  2V3Y A;  2B3K A;  4FKC A;  4RZY A;  3RVA A;  1XGM A;  1M35 A;  2GU4 A;  2GGC A;  4KM3 A;  2Q93 A;  2GG9 A;  5CDV A;  4FUK A;  1Y1N A;  1QZY A;  3L7G A;  3FMQ A;  1XGN A;  2BWU A;  3S6B A;  1WL9 A;  5CIK A;  3IG4 A;  2GU7 A;  2GG5 A;  4ZWO A;  2GG8 A;  1XGO A;  4ZWP A;  2Q96 A;  2OAZ A;  2B3H A;  1KQ9 A;  4IKR A;  3MR1 A;  5D6F A;  2GG7 A;  3BIQ A;  2EA4 A;  1XNZ A;  2EVO A;  3CB5 A;  2BWW A;  4R60 A;  4RGZ 1;  1W7V A;  1YW9 A;  1N51 A;  2BWT A;  5CDL A;  4S00 A;  4JUQ A;  1O0X A;  4U6W A;  2BWY A;  4FLJ A;  2GTX A;  4IKT A;  1MAT A;  2GZ5 A;  2Q8K A;  4U6J A;  2EVC A;  1R58 A;  4IF7 A;  4U69 A;  5E5B A;  4QR8 A;  2GGB A;  1CHM A;  4EGE A;  2ZSG A;  4U1B A;  1WKM A;  3CTZ A;  4U75 A;  2V6C A;  4OOK A;  4U6C A;  5FCF A;  3PKA A;  1B59 A;  3PKD A;  4MAT A;  2V3X A;  4U73 A;  1WBQ A;  4RZZ A;  2BHD A;  3BIT A;  2BHB A;  5CNX A;  4FLI A;  2B3L A;  3TAV A;  2BN7 A;  2BH3 A;  2BB7 A;  4IKS A;  1QXZ A;  5FCH A;  2NQ7 A;  2IW2 A;  2HOW A;  2DFI A;  3IU9 A;  5CLS A;  5CDE A;  2EVM A;  1WY2 A;  3MX6 A;  5D6E A;  4Z7M A;  1YW7 A;  2OKN A;  4U6Z A;  3PKE A;  1C23 A;  2BHA A;  2GG3 A;  4A6V A;  3D27 A;  3L24 A;  2BWX A; 
#chains in the Genus database with same CATH homology
 4IU6 A;  1YJ3 A;  3FMR A;  4IDY A;  4U76 A;  2BWV A;  3IU8 A;  2P98 A;  3PKB A;  4U70 A;  4FO7 A;  4IPA A;  1KQ0 A;  1YW8 A;  3ROR A;  2NQ6 A;  3FM3 A;  1C22 A;  4FO8 A;  4U71 A;  1XGS A;  1R5H A;  2GG0 A;  3PKC A;  3IU7 A;  4HXX A;  2GG2 A;  2Q95 A;  1WN1 A;  2GU6 A;  4A6W A;  4S2T P;  1WL6 A;  4FLL A;  4B28 A;  1KP0 A;  1WLR A;  1W2M A;  2BWS A;  2Q92 A;  4FLK A;  2P9A A;  4IEC A;  3MAT A;  3Q6D A;  4U6E A;  3TB5 A;  2EA2 A;  1C21 A;  4PNC A;  1JAW A;  2BHC A;  5CE6 A;  5JFR A;  4S01 A;  1QXW A;  2GU5 A;  1B6A A;  1C27 A;  5JHU A;  1BN5 A;  3CB6 A;  4IKU A;  4ZNG A;  1PV9 A;  2GA2 A;  1QXY A;  2V3Z A;  3BIP A;  4S2R P;  1YVM A;  1BOA A;  2P99 A;  1C24 A;  1R5G A;  2Q94 A;  2ADU A;  4ZWU A;  4PV4 A;  2MAT A;  1A16 A;  2G6P A;  5JI6 A;  2V3Y A;  2B3K A;  4FKC A;  4RZY A;  3RVA A;  1XGM A;  1M35 A;  2GU4 A;  2GGC A;  4KM3 A;  2Q93 A;  2GG9 A;  5CDV A;  4FUK A;  1Y1N A;  1QZY A;  3L7G A;  3FMQ A;  1XGN A;  2BWU A;  3S6B A;  1WL9 A;  5CIK A;  3IG4 A;  2GU7 A;  2GG5 A;  4ZWO A;  2GG8 A;  1XGO A;  4ZWP A;  2Q96 A;  2OAZ A;  2B3H A;  1KQ9 A;  4IKR A;  3MR1 A;  5D6F A;  2GG7 A;  3BIQ A;  2EA4 A;  1XNZ A;  2EVO A;  3CB5 A;  2BWW A;  4R60 A;  4RGZ 1;  1W7V A;  1YW9 A;  1N51 A;  2BWT A;  5CDL A;  4S00 A;  4JUQ A;  1O0X A;  4U6W A;  2BWY A;  4FLJ A;  2GTX A;  4IKT A;  1MAT A;  2GZ5 A;  2Q8K A;  4U6J A;  2EVC A;  1R58 A;  4IF7 A;  4U69 A;  5E5B A;  4QR8 A;  2GGB A;  1CHM A;  4EGE A;  2ZSG A;  4U1B A;  1WKM A;  3CTZ A;  4U75 A;  2V6C A;  4OOK A;  4U6C A;  5FCF A;  3PKA A;  1B59 A;  3PKD A;  4MAT A;  2V3X A;  4U73 A;  1WBQ A;  4RZZ A;  2BHD A;  3BIT A;  2BHB A;  5CNX A;  4FLI A;  2B3L A;  3TAV A;  2BN7 A;  2BH3 A;  2BB7 A;  4IKS A;  1QXZ A;  5FCH A;  2NQ7 A;  2IW2 A;  2HOW A;  2DFI A;  3IU9 A;  5CLS A;  5CDE A;  2EVM A;  1WY2 A;  3MX6 A;  5D6E A;  4Z7M A;  1YW7 A;  2OKN A;  4U6Z A;  3PKE A;  1C23 A;  2BHA A;  2GG3 A;  4A6V A;  3D27 A;  3L24 A;  2BWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...