2GU4A

E. coli methionine aminopeptidase in complex with nlep, 1: 0.5, di-metalated
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
total genus 91
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu4A00
4IU6A 3CB5A 1YW9A 2ZSGA 2B3HA 2EVCA 2GG0A 1QZYA 2NQ6A 3IU8A 4IECA 3IG4A 2BHDA 2GA2A 4HXXA 5CDEA 3FMRA 1MATA 2BH3A 1KQ0A 4ZNGA 1KQ9A 1A16A 1C23A 1QXYA 1WN1A 3BIQA 3D27A 4ZWPA 2GG8A 4A6WA 4IF7A 1WL9A 2Q93A 2NQ7A 3PKDA 1QXZA 1W7VA 4FO7A 5CNXA 5CDVA 2MATA 5JI6A 4IPAA 5CLSA 2GGCA 1YW8A 2P99A 4EGEA 1XGNA 1CHMA 2BB7A 2GTXA 2GG3A 5E5BA 3CB6A 4R60A 1WKMA 2B3KA 1WY2A 1YVMA 4FLIA 3PKBA 4U69A 3PKEA 3PKCA 1C22A 4U6EA 1XNZA 2GU6A 4OOKA 1BOAA 2EA2A 4U6ZA 3BIPA 4RZZA 2P9AA 2V3ZA 3FMQA 3PKAA 4FLKA 4FLJA 2OAZA 2EVOA 1WBQA 2Q92A 4IKTA 2V3XA 4U6CA 2V6CA 4PV4A 3BITA 2B3LA 4U6JA 2GG7A 3IU9A 4U76A 1R5HA 5CIKA 4IKUA 4Z7MA 4KM3A 4RZYA 2IW2A 4FLLA 3S6BA 4IDYA 4MATA 4U75A 2GG2A 4FO8A 4U1BA 2Q95A 1WL6A 4S2RP 1YJ3A 4FKCA 3MATA 2HOWA 2BWSA 3MX6A 1C21A 4RGZ1 3CTZA 3RVAA 2OKNA 2Q8KA 4IKSA 1JAWA 4QR8A 1PV9A 1WLRA 2Q94A 1KP0A 2BWTA 4U70A 4PNCA 2BWWA 2BWYA 4U73A 1N51A 4JUQA 2GU5A 1R58A 5D6FA 2ADUA 1YW7A 3FM3A 1XGSA 2BHCA 3MR1A 2G6PA 2BWUA 1C27A 3TAVA 3TB5A 5JFRA 2V3YA 5FCFA 4ZWUA 4FUKA 1C24A 1XGOA 2P98A 3RORA 5JHUA 1XGMA 2Q96A 2BHAA 1R5GA 1BN5A 5FCHA 2GG9A 1W2MA 4IKRA 4A6VA 5D6EA 1QXWA 5CE6A 2EVMA 2DFIA 3L24A 5CDLA 2EA4A 2GGBA 2GU4A 1Y1NA 2GZ5A 2BWVA 1B6AA 1O0XA 2BWXA 3Q6DA 4S2TP 2GG5A 1M35A 2BHBA 4S00A 1B59A 4S01A 2GU7A 4ZWOA 4U71A 2BN7A 4U6WA 3IU7A 3L7GA 4B28A
chains in the Genus database with same CATH superfamily
4IU6A 3CB5A 1YW9A 2ZSGA 2B3HA 2EVCA 2GG0A 1QZYA 2NQ6A 3IU8A 4IECA 3IG4A 2BHDA 2GA2A 4HXXA 5CDEA 3FMRA 1MATA 2BH3A 1KQ0A 4ZNGA 1KQ9A 1A16A 1C23A 1QXYA 1WN1A 3BIQA 3D27A 4ZWPA 2GG8A 4A6WA 4IF7A 1WL9A 2Q93A 2NQ7A 3PKDA 1QXZA 1W7VA 4FO7A 5CNXA 5CDVA 2MATA 5JI6A 4IPAA 5CLSA 2GGCA 1YW8A 2P99A 4EGEA 1XGNA 1CHMA 2BB7A 2GTXA 2GG3A 5E5BA 3CB6A 4R60A 1WKMA 2B3KA 1WY2A 1YVMA 4FLIA 3PKBA 4U69A 3PKEA 3PKCA 1C22A 4U6EA 1XNZA 2GU6A 4OOKA 1BOAA 2EA2A 4U6ZA 3BIPA 4RZZA 2P9AA 2V3ZA 3FMQA 3PKAA 4FLKA 4FLJA 2OAZA 2EVOA 1WBQA 2Q92A 4IKTA 2V3XA 4U6CA 2V6CA 4PV4A 3BITA 2B3LA 4U6JA 2GG7A 3IU9A 4U76A 1R5HA 5CIKA 4IKUA 4Z7MA 4KM3A 4RZYA 2IW2A 4FLLA 3S6BA 4IDYA 4MATA 4U75A 2GG2A 4FO8A 4U1BA 2Q95A 1WL6A 4S2RP 1YJ3A 4FKCA 3MATA 2HOWA 2BWSA 3MX6A 1C21A 4RGZ1 3CTZA 3RVAA 2OKNA 2Q8KA 4IKSA 1JAWA 4QR8A 1PV9A 1WLRA 2Q94A 1KP0A 2BWTA 4U70A 4PNCA 2BWWA 2BWYA 4U73A 1N51A 4JUQA 2GU5A 1R58A 5D6FA 2ADUA 1YW7A 3FM3A 1XGSA 2BHCA 3MR1A 2G6PA 2BWUA 1C27A 3TAVA 3TB5A 5JFRA 2V3YA 5FCFA 4ZWUA 4FUKA 1C24A 1XGOA 2P98A 3RORA 5JHUA 1XGMA 2Q96A 2BHAA 1R5GA 1BN5A 5FCHA 2GG9A 1W2MA 4IKRA 4A6VA 5D6EA 1QXWA 5CE6A 2EVMA 2DFIA 3L24A 5CDLA 2EA4A 2GGBA 2GU4A 1Y1NA 2GZ5A 2BWVA 1B6AA 1O0XA 2BWXA 3Q6DA 4S2TP 2GG5A 1M35A 2BHBA 4S00A 1B59A 4S01A 2GU7A 4ZWOA 4U71A 2BN7A 4U6WA 3IU7A 3L7GA 4B28A
chains in the Genus database with same CATH topology
4IU6A 3CB5A 1YW9A 2ZSGA 2B3HA 2EVCA 2GG0A 1QZYA 2NQ6A 3IU8A 4IECA 3IG4A 2BHDA 2GA2A 4HXXA 5CDEA 3FMRA 1MATA 2BH3A 1KQ0A 4ZNGA 1KQ9A 1A16A 1C23A 1QXYA 1WN1A 3BIQA 3D27A 4ZWPA 2GG8A 4A6WA 4IF7A 1WL9A 2Q93A 2NQ7A 3PKDA 1QXZA 1W7VA 4FO7A 5CNXA 5CDVA 2MATA 5JI6A 4IPAA 5CLSA 2GGCA 1YW8A 2P99A 4EGEA 1XGNA 1CHMA 2BB7A 2GTXA 2GG3A 5E5BA 3CB6A 4R60A 1WKMA 2B3KA 1WY2A 1YVMA 4FLIA 3PKBA 4U69A 3PKEA 3PKCA 1C22A 4U6EA 1XNZA 2GU6A 4OOKA 1BOAA 2EA2A 4U6ZA 3BIPA 4RZZA 2P9AA 2V3ZA 3FMQA 3PKAA 4FLKA 4FLJA 2OAZA 2EVOA 1WBQA 2Q92A 4IKTA 2V3XA 4U6CA 2V6CA 4PV4A 3BITA 2B3LA 4U6JA 2GG7A 3IU9A 4U76A 1R5HA 5CIKA 4IKUA 4Z7MA 4KM3A 4RZYA 2IW2A 4FLLA 3S6BA 4IDYA 4MATA 4U75A 2GG2A 4FO8A 4U1BA 2Q95A 1WL6A 4S2RP 1YJ3A 4FKCA 3MATA 2HOWA 2BWSA 3MX6A 1C21A 4RGZ1 3CTZA 3RVAA 2OKNA 2Q8KA 4IKSA 1JAWA 4QR8A 1PV9A 1WLRA 2Q94A 1KP0A 2BWTA 4U70A 4PNCA 2BWWA 2BWYA 4U73A 1N51A 4JUQA 2GU5A 1R58A 5D6FA 2ADUA 1YW7A 3FM3A 1XGSA 2BHCA 3MR1A 2G6PA 2BWUA 1C27A 3TAVA 3TB5A 5JFRA 2V3YA 5FCFA 4ZWUA 4FUKA 1C24A 1XGOA 2P98A 3RORA 5JHUA 1XGMA 2Q96A 2BHAA 1R5GA 1BN5A 5FCHA 2GG9A 1W2MA 4IKRA 4A6VA 5D6EA 1QXWA 5CE6A 2EVMA 2DFIA 3L24A 5CDLA 2EA4A 2GGBA 2GU4A 1Y1NA 2GZ5A 2BWVA 1B6AA 1O0XA 2BWXA 3Q6DA 4S2TP 2GG5A 1M35A 2BHBA 4S00A 1B59A 4S01A 2GU7A 4ZWOA 4U71A 2BN7A 4U6WA 3IU7A 3L7GA 4B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IU6 A;  3CB5 A;  1YW9 A;  2ZSG A;  2B3H A;  2EVC A;  2GG0 A;  1QZY A;  2NQ6 A;  3IU8 A;  4IEC A;  3IG4 A;  2BHD A;  2GA2 A;  4HXX A;  5CDE A;  3FMR A;  1MAT A;  2BH3 A;  1KQ0 A;  4ZNG A;  1KQ9 A;  1A16 A;  1C23 A;  1QXY A;  1WN1 A;  3BIQ A;  3D27 A;  4ZWP A;  2GG8 A;  4A6W A;  4IF7 A;  1WL9 A;  2Q93 A;  2NQ7 A;  3PKD A;  1QXZ A;  1W7V A;  4FO7 A;  5CNX A;  5CDV A;  2MAT A;  5JI6 A;  4IPA A;  5CLS A;  2GGC A;  1YW8 A;  2P99 A;  4EGE A;  1XGN A;  1CHM A;  2BB7 A;  2GTX A;  2GG3 A;  5E5B A;  3CB6 A;  4R60 A;  1WKM A;  2B3K A;  1WY2 A;  1YVM A;  4FLI A;  3PKB A;  4U69 A;  3PKE A;  3PKC A;  1C22 A;  4U6E A;  1XNZ A;  2GU6 A;  4OOK A;  1BOA A;  2EA2 A;  4U6Z A;  3BIP A;  4RZZ A;  2P9A A;  2V3Z A;  3FMQ A;  3PKA A;  4FLK A;  4FLJ A;  2OAZ A;  2EVO A;  1WBQ A;  2Q92 A;  4IKT A;  2V3X A;  4U6C A;  2V6C A;  4PV4 A;  3BIT A;  2B3L A;  4U6J A;  2GG7 A;  3IU9 A;  4U76 A;  1R5H A;  5CIK A;  4IKU A;  4Z7M A;  4KM3 A;  4RZY A;  2IW2 A;  4FLL A;  3S6B A;  4IDY A;  4MAT A;  4U75 A;  2GG2 A;  4FO8 A;  4U1B A;  2Q95 A;  1WL6 A;  4S2R P;  1YJ3 A;  4FKC A;  3MAT A;  2HOW A;  2BWS A;  3MX6 A;  1C21 A;  4RGZ 1;  3CTZ A;  3RVA A;  2OKN A;  2Q8K A;  4IKS A;  1JAW A;  4QR8 A;  1PV9 A;  1WLR A;  2Q94 A;  1KP0 A;  2BWT A;  4U70 A;  4PNC A;  2BWW A;  2BWY A;  4U73 A;  1N51 A;  4JUQ A;  2GU5 A;  1R58 A;  5D6F A;  2ADU A;  1YW7 A;  3FM3 A;  1XGS A;  2BHC A;  3MR1 A;  2G6P A;  2BWU A;  1C27 A;  3TAV A;  3TB5 A;  5JFR A;  2V3Y A;  5FCF A;  4ZWU A;  4FUK A;  1C24 A;  1XGO A;  2P98 A;  3ROR A;  5JHU A;  1XGM A;  2Q96 A;  2BHA A;  1R5G A;  1BN5 A;  5FCH A;  2GG9 A;  1W2M A;  4IKR A;  4A6V A;  5D6E A;  1QXW A;  5CE6 A;  2EVM A;  2DFI A;  3L24 A;  5CDL A;  2EA4 A;  2GGB A;  2GU4 A;  1Y1N A;  2GZ5 A;  2BWV A;  1B6A A;  1O0X A;  2BWX A;  3Q6D A;  4S2T P;  2GG5 A;  1M35 A;  2BHB A;  4S00 A;  1B59 A;  4S01 A;  2GU7 A;  4ZWO A;  4U71 A;  2BN7 A;  4U6W A;  3IU7 A;  3L7G A;  4B28 A; 
#chains in the Genus database with same CATH topology
 4IU6 A;  3CB5 A;  1YW9 A;  2ZSG A;  2B3H A;  2EVC A;  2GG0 A;  1QZY A;  2NQ6 A;  3IU8 A;  4IEC A;  3IG4 A;  2BHD A;  2GA2 A;  4HXX A;  5CDE A;  3FMR A;  1MAT A;  2BH3 A;  1KQ0 A;  4ZNG A;  1KQ9 A;  1A16 A;  1C23 A;  1QXY A;  1WN1 A;  3BIQ A;  3D27 A;  4ZWP A;  2GG8 A;  4A6W A;  4IF7 A;  1WL9 A;  2Q93 A;  2NQ7 A;  3PKD A;  1QXZ A;  1W7V A;  4FO7 A;  5CNX A;  5CDV A;  2MAT A;  5JI6 A;  4IPA A;  5CLS A;  2GGC A;  1YW8 A;  2P99 A;  4EGE A;  1XGN A;  1CHM A;  2BB7 A;  2GTX A;  2GG3 A;  5E5B A;  3CB6 A;  4R60 A;  1WKM A;  2B3K A;  1WY2 A;  1YVM A;  4FLI A;  3PKB A;  4U69 A;  3PKE A;  3PKC A;  1C22 A;  4U6E A;  1XNZ A;  2GU6 A;  4OOK A;  1BOA A;  2EA2 A;  4U6Z A;  3BIP A;  4RZZ A;  2P9A A;  2V3Z A;  3FMQ A;  3PKA A;  4FLK A;  4FLJ A;  2OAZ A;  2EVO A;  1WBQ A;  2Q92 A;  4IKT A;  2V3X A;  4U6C A;  2V6C A;  4PV4 A;  3BIT A;  2B3L A;  4U6J A;  2GG7 A;  3IU9 A;  4U76 A;  1R5H A;  5CIK A;  4IKU A;  4Z7M A;  4KM3 A;  4RZY A;  2IW2 A;  4FLL A;  3S6B A;  4IDY A;  4MAT A;  4U75 A;  2GG2 A;  4FO8 A;  4U1B A;  2Q95 A;  1WL6 A;  4S2R P;  1YJ3 A;  4FKC A;  3MAT A;  2HOW A;  2BWS A;  3MX6 A;  1C21 A;  4RGZ 1;  3CTZ A;  3RVA A;  2OKN A;  2Q8K A;  4IKS A;  1JAW A;  4QR8 A;  1PV9 A;  1WLR A;  2Q94 A;  1KP0 A;  2BWT A;  4U70 A;  4PNC A;  2BWW A;  2BWY A;  4U73 A;  1N51 A;  4JUQ A;  2GU5 A;  1R58 A;  5D6F A;  2ADU A;  1YW7 A;  3FM3 A;  1XGS A;  2BHC A;  3MR1 A;  2G6P A;  2BWU A;  1C27 A;  3TAV A;  3TB5 A;  5JFR A;  2V3Y A;  5FCF A;  4ZWU A;  4FUK A;  1C24 A;  1XGO A;  2P98 A;  3ROR A;  5JHU A;  1XGM A;  2Q96 A;  2BHA A;  1R5G A;  1BN5 A;  5FCH A;  2GG9 A;  1W2M A;  4IKR A;  4A6V A;  5D6E A;  1QXW A;  5CE6 A;  2EVM A;  2DFI A;  3L24 A;  5CDL A;  2EA4 A;  2GGB A;  2GU4 A;  1Y1N A;  2GZ5 A;  2BWV A;  1B6A A;  1O0X A;  2BWX A;  3Q6D A;  4S2T P;  2GG5 A;  1M35 A;  2BHB A;  4S00 A;  1B59 A;  4S01 A;  2GU7 A;  4ZWO A;  4U71 A;  2BN7 A;  4U6W A;  3IU7 A;  3L7G A;  4B28 A; 
#chains in the Genus database with same CATH homology
 4IU6 A;  3CB5 A;  1YW9 A;  2ZSG A;  2B3H A;  2EVC A;  2GG0 A;  1QZY A;  2NQ6 A;  3IU8 A;  4IEC A;  3IG4 A;  2BHD A;  2GA2 A;  4HXX A;  5CDE A;  3FMR A;  1MAT A;  2BH3 A;  1KQ0 A;  4ZNG A;  1KQ9 A;  1A16 A;  1C23 A;  1QXY A;  1WN1 A;  3BIQ A;  3D27 A;  4ZWP A;  2GG8 A;  4A6W A;  4IF7 A;  1WL9 A;  2Q93 A;  2NQ7 A;  3PKD A;  1QXZ A;  1W7V A;  4FO7 A;  5CNX A;  5CDV A;  2MAT A;  5JI6 A;  4IPA A;  5CLS A;  2GGC A;  1YW8 A;  2P99 A;  4EGE A;  1XGN A;  1CHM A;  2BB7 A;  2GTX A;  2GG3 A;  5E5B A;  3CB6 A;  4R60 A;  1WKM A;  2B3K A;  1WY2 A;  1YVM A;  4FLI A;  3PKB A;  4U69 A;  3PKE A;  3PKC A;  1C22 A;  4U6E A;  1XNZ A;  2GU6 A;  4OOK A;  1BOA A;  2EA2 A;  4U6Z A;  3BIP A;  4RZZ A;  2P9A A;  2V3Z A;  3FMQ A;  3PKA A;  4FLK A;  4FLJ A;  2OAZ A;  2EVO A;  1WBQ A;  2Q92 A;  4IKT A;  2V3X A;  4U6C A;  2V6C A;  4PV4 A;  3BIT A;  2B3L A;  4U6J A;  2GG7 A;  3IU9 A;  4U76 A;  1R5H A;  5CIK A;  4IKU A;  4Z7M A;  4KM3 A;  4RZY A;  2IW2 A;  4FLL A;  3S6B A;  4IDY A;  4MAT A;  4U75 A;  2GG2 A;  4FO8 A;  4U1B A;  2Q95 A;  1WL6 A;  4S2R P;  1YJ3 A;  4FKC A;  3MAT A;  2HOW A;  2BWS A;  3MX6 A;  1C21 A;  4RGZ 1;  3CTZ A;  3RVA A;  2OKN A;  2Q8K A;  4IKS A;  1JAW A;  4QR8 A;  1PV9 A;  1WLR A;  2Q94 A;  1KP0 A;  2BWT A;  4U70 A;  4PNC A;  2BWW A;  2BWY A;  4U73 A;  1N51 A;  4JUQ A;  2GU5 A;  1R58 A;  5D6F A;  2ADU A;  1YW7 A;  3FM3 A;  1XGS A;  2BHC A;  3MR1 A;  2G6P A;  2BWU A;  1C27 A;  3TAV A;  3TB5 A;  5JFR A;  2V3Y A;  5FCF A;  4ZWU A;  4FUK A;  1C24 A;  1XGO A;  2P98 A;  3ROR A;  5JHU A;  1XGM A;  2Q96 A;  2BHA A;  1R5G A;  1BN5 A;  5FCH A;  2GG9 A;  1W2M A;  4IKR A;  4A6V A;  5D6E A;  1QXW A;  5CE6 A;  2EVM A;  2DFI A;  3L24 A;  5CDL A;  2EA4 A;  2GGB A;  2GU4 A;  1Y1N A;  2GZ5 A;  2BWV A;  1B6A A;  1O0X A;  2BWX A;  3Q6D A;  4S2T P;  2GG5 A;  1M35 A;  2BHB A;  4S00 A;  1B59 A;  4S01 A;  2GU7 A;  4ZWO A;  4U71 A;  2BN7 A;  4U6W A;  3IU7 A;  3L7G A;  4B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...