2GU4A

E. coli methionine aminopeptidase in complex with nlep, 1: 0.5, di-metalated
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 91
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu4A00
2BH3A 3CB5A 4FLJA 2BWWA 4S00A 4U71A 5JHUA 1YW9A 3PKAA 3BITA 5D6FA 2BN7A 3TB5A 4IF7A 2BHAA 3Q6DA 1C21A 1B6AA 2EVCA 2GZ5A 2GGBA 2MATA 3PKCA 1R5GA 2BHDA 4IECA 2BWUA 4FLIA 3RVAA 1KP0A 2P99A 1C24A 2B3LA 4MATA 4IKTA 4B28A 1QXYA 1WL6A 1YJ3A 2ZSGA 1XNZA 2HOWA 5E5BA 1WY2A 4S2TP 2NQ7A 4ZWOA 4FO7A 2P98A 3L7GA 4PNCA 1PV9A 3FM3A 5D6EA 1C23A 2BWVA 4FKCA 4U76A 5CDLA 2BWXA 5CDEA 3MATA 2GTXA 3IU9A 4PV4A 1N51A 1W7VA 3PKEA 2EVMA 1KQ0A 3PKBA 4RZYA 2BWSA 2GG3A 3CTZA 2BB7A 4OOKA 4IKRA 5JFRA 2GG5A 5JI6A 4FUKA 1QXWA 1B59A 4ZNGA 4U1BA 1YW8A 1JAWA 2Q94A 3FMQA 4IPAA 4U6ZA 1R58A 3PKDA 2GG2A 1YVMA 4A6VA 1BOAA 4JUQA 4U73A 1QZYA 3S6BA 4RZZA 2GG0A 3MR1A 2B3HA 2V3XA 3CB6A 1C27A 2EVOA 2GU5A 2V3YA 5FCHA 4EGEA 4ZWUA 2NQ6A 3IU8A 1BN5A 4RGZ1 1KQ9A 1YW7A 1XGOA 1WBQA 4U6JA 4Z7MA 2Q95A 3IG4A 2GG7A 1W2MA 4ZWPA 2Q96A 1WN1A 1XGNA 3FMRA 1QXZA 3MX6A 3D27A 2Q93A 2V6CA 4FLKA 2GG9A 4FLLA 2GGCA 4S01A 2GU7A 1WL9A 4U70A 5CE6A 3BIQA 4FO8A 2BHBA 2P9AA 2GU4A 2GA2A 4A6WA 1XGSA 1A16A 4U6EA 2OKNA 1XGMA 2V3ZA 1CHMA 5CDVA 3L24A 3RORA 1C22A 4IKUA 2B3KA 1M35A 4KM3A 2BWYA 3TAVA 5FCFA 2BHCA 4IU6A 4IDYA 2ADUA 3BIPA 4IKSA 5CIKA 4HXXA 3IU7A 4S2RP 4U75A 2G6PA 2EA4A 2DFIA 4U6WA 1WLRA 5CNXA 1R5HA 4QR8A 2GU6A 2IW2A 1MATA 1Y1NA 2BWTA 4R60A 2Q92A 1O0XA 2OAZA 4U6CA 2Q8KA 1WKMA 2EA2A 2GG8A 4U69A 5CLSA
chains in the Genus database with same CATH superfamily
2BH3A 3CB5A 4FLJA 2BWWA 4S00A 4U71A 5JHUA 1YW9A 3PKAA 3BITA 5D6FA 2BN7A 3TB5A 4IF7A 2BHAA 3Q6DA 1C21A 1B6AA 2EVCA 2GZ5A 2GGBA 2MATA 3PKCA 1R5GA 2BHDA 4IECA 2BWUA 4FLIA 3RVAA 1KP0A 2P99A 1C24A 2B3LA 4MATA 4IKTA 4B28A 1QXYA 1WL6A 1YJ3A 2ZSGA 1XNZA 2HOWA 5E5BA 1WY2A 4S2TP 2NQ7A 4ZWOA 4FO7A 2P98A 3L7GA 4PNCA 1PV9A 3FM3A 5D6EA 1C23A 2BWVA 4FKCA 4U76A 5CDLA 2BWXA 5CDEA 3MATA 2GTXA 3IU9A 4PV4A 1N51A 1W7VA 3PKEA 2EVMA 1KQ0A 3PKBA 4RZYA 2BWSA 2GG3A 3CTZA 2BB7A 4OOKA 4IKRA 5JFRA 2GG5A 5JI6A 4FUKA 1QXWA 1B59A 4ZNGA 4U1BA 1YW8A 1JAWA 2Q94A 3FMQA 4IPAA 4U6ZA 1R58A 3PKDA 2GG2A 1YVMA 4A6VA 1BOAA 4JUQA 4U73A 1QZYA 3S6BA 4RZZA 2GG0A 3MR1A 2B3HA 2V3XA 3CB6A 1C27A 2EVOA 2GU5A 2V3YA 5FCHA 4EGEA 4ZWUA 2NQ6A 3IU8A 1BN5A 4RGZ1 1KQ9A 1YW7A 1XGOA 1WBQA 4U6JA 4Z7MA 2Q95A 3IG4A 2GG7A 1W2MA 4ZWPA 2Q96A 1WN1A 1XGNA 3FMRA 1QXZA 3MX6A 3D27A 2Q93A 2V6CA 4FLKA 2GG9A 4FLLA 2GGCA 4S01A 2GU7A 1WL9A 4U70A 5CE6A 3BIQA 4FO8A 2BHBA 2P9AA 2GU4A 2GA2A 4A6WA 1XGSA 1A16A 4U6EA 2OKNA 1XGMA 2V3ZA 1CHMA 5CDVA 3L24A 3RORA 1C22A 4IKUA 2B3KA 1M35A 4KM3A 2BWYA 3TAVA 5FCFA 2BHCA 4IU6A 4IDYA 2ADUA 3BIPA 4IKSA 5CIKA 4HXXA 3IU7A 4S2RP 4U75A 2G6PA 2EA4A 2DFIA 4U6WA 1WLRA 5CNXA 1R5HA 4QR8A 2GU6A 2IW2A 1MATA 1Y1NA 2BWTA 4R60A 2Q92A 1O0XA 2OAZA 4U6CA 2Q8KA 1WKMA 2EA2A 2GG8A 4U69A 5CLSA
chains in the Genus database with same CATH topology
2BH3A 3CB5A 4FLJA 2BWWA 4S00A 4U71A 5JHUA 1YW9A 3PKAA 3BITA 5D6FA 2BN7A 3TB5A 4IF7A 2BHAA 3Q6DA 1C21A 1B6AA 2EVCA 2GZ5A 2GGBA 2MATA 3PKCA 1R5GA 2BHDA 4IECA 2BWUA 4FLIA 3RVAA 1KP0A 2P99A 1C24A 2B3LA 4MATA 4IKTA 4B28A 1QXYA 1WL6A 1YJ3A 2ZSGA 1XNZA 2HOWA 5E5BA 1WY2A 4S2TP 2NQ7A 4ZWOA 4FO7A 2P98A 3L7GA 4PNCA 1PV9A 3FM3A 5D6EA 1C23A 2BWVA 4FKCA 4U76A 5CDLA 2BWXA 5CDEA 3MATA 2GTXA 3IU9A 4PV4A 1N51A 1W7VA 3PKEA 2EVMA 1KQ0A 3PKBA 4RZYA 2BWSA 2GG3A 3CTZA 2BB7A 4OOKA 4IKRA 5JFRA 2GG5A 5JI6A 4FUKA 1QXWA 1B59A 4ZNGA 4U1BA 1YW8A 1JAWA 2Q94A 3FMQA 4IPAA 4U6ZA 1R58A 3PKDA 2GG2A 1YVMA 4A6VA 1BOAA 4JUQA 4U73A 1QZYA 3S6BA 4RZZA 2GG0A 3MR1A 2B3HA 2V3XA 3CB6A 1C27A 2EVOA 2GU5A 2V3YA 5FCHA 4EGEA 4ZWUA 2NQ6A 3IU8A 1BN5A 4RGZ1 1KQ9A 1YW7A 1XGOA 1WBQA 4U6JA 4Z7MA 2Q95A 3IG4A 2GG7A 1W2MA 4ZWPA 2Q96A 1WN1A 1XGNA 3FMRA 1QXZA 3MX6A 3D27A 2Q93A 2V6CA 4FLKA 2GG9A 4FLLA 2GGCA 4S01A 2GU7A 1WL9A 4U70A 5CE6A 3BIQA 4FO8A 2BHBA 2P9AA 2GU4A 2GA2A 4A6WA 1XGSA 1A16A 4U6EA 2OKNA 1XGMA 2V3ZA 1CHMA 5CDVA 3L24A 3RORA 1C22A 4IKUA 2B3KA 1M35A 4KM3A 2BWYA 3TAVA 5FCFA 2BHCA 4IU6A 4IDYA 2ADUA 3BIPA 4IKSA 5CIKA 4HXXA 3IU7A 4S2RP 4U75A 2G6PA 2EA4A 2DFIA 4U6WA 1WLRA 5CNXA 1R5HA 4QR8A 2GU6A 2IW2A 1MATA 1Y1NA 2BWTA 4R60A 2Q92A 1O0XA 2OAZA 4U6CA 2Q8KA 1WKMA 2EA2A 2GG8A 4U69A 5CLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH3 A;  3CB5 A;  4FLJ A;  2BWW A;  4S00 A;  4U71 A;  5JHU A;  1YW9 A;  3PKA A;  3BIT A;  5D6F A;  2BN7 A;  3TB5 A;  4IF7 A;  2BHA A;  3Q6D A;  1C21 A;  1B6A A;  2EVC A;  2GZ5 A;  2GGB A;  2MAT A;  3PKC A;  1R5G A;  2BHD A;  4IEC A;  2BWU A;  4FLI A;  3RVA A;  1KP0 A;  2P99 A;  1C24 A;  2B3L A;  4MAT A;  4IKT A;  4B28 A;  1QXY A;  1WL6 A;  1YJ3 A;  2ZSG A;  1XNZ A;  2HOW A;  5E5B A;  1WY2 A;  4S2T P;  2NQ7 A;  4ZWO A;  4FO7 A;  2P98 A;  3L7G A;  4PNC A;  1PV9 A;  3FM3 A;  5D6E A;  1C23 A;  2BWV A;  4FKC A;  4U76 A;  5CDL A;  2BWX A;  5CDE A;  3MAT A;  2GTX A;  3IU9 A;  4PV4 A;  1N51 A;  1W7V A;  3PKE A;  2EVM A;  1KQ0 A;  3PKB A;  4RZY A;  2BWS A;  2GG3 A;  3CTZ A;  2BB7 A;  4OOK A;  4IKR A;  5JFR A;  2GG5 A;  5JI6 A;  4FUK A;  1QXW A;  1B59 A;  4ZNG A;  4U1B A;  1YW8 A;  1JAW A;  2Q94 A;  3FMQ A;  4IPA A;  4U6Z A;  1R58 A;  3PKD A;  2GG2 A;  1YVM A;  4A6V A;  1BOA A;  4JUQ A;  4U73 A;  1QZY A;  3S6B A;  4RZZ A;  2GG0 A;  3MR1 A;  2B3H A;  2V3X A;  3CB6 A;  1C27 A;  2EVO A;  2GU5 A;  2V3Y A;  5FCH A;  4EGE A;  4ZWU A;  2NQ6 A;  3IU8 A;  1BN5 A;  4RGZ 1;  1KQ9 A;  1YW7 A;  1XGO A;  1WBQ A;  4U6J A;  4Z7M A;  2Q95 A;  3IG4 A;  2GG7 A;  1W2M A;  4ZWP A;  2Q96 A;  1WN1 A;  1XGN A;  3FMR A;  1QXZ A;  3MX6 A;  3D27 A;  2Q93 A;  2V6C A;  4FLK A;  2GG9 A;  4FLL A;  2GGC A;  4S01 A;  2GU7 A;  1WL9 A;  4U70 A;  5CE6 A;  3BIQ A;  4FO8 A;  2BHB A;  2P9A A;  2GU4 A;  2GA2 A;  4A6W A;  1XGS A;  1A16 A;  4U6E A;  2OKN A;  1XGM A;  2V3Z A;  1CHM A;  5CDV A;  3L24 A;  3ROR A;  1C22 A;  4IKU A;  2B3K A;  1M35 A;  4KM3 A;  2BWY A;  3TAV A;  5FCF A;  2BHC A;  4IU6 A;  4IDY A;  2ADU A;  3BIP A;  4IKS A;  5CIK A;  4HXX A;  3IU7 A;  4S2R P;  4U75 A;  2G6P A;  2EA4 A;  2DFI A;  4U6W A;  1WLR A;  5CNX A;  1R5H A;  4QR8 A;  2GU6 A;  2IW2 A;  1MAT A;  1Y1N A;  2BWT A;  4R60 A;  2Q92 A;  1O0X A;  2OAZ A;  4U6C A;  2Q8K A;  1WKM A;  2EA2 A;  2GG8 A;  4U69 A;  5CLS A; 
#chains in the Genus database with same CATH topology
 2BH3 A;  3CB5 A;  4FLJ A;  2BWW A;  4S00 A;  4U71 A;  5JHU A;  1YW9 A;  3PKA A;  3BIT A;  5D6F A;  2BN7 A;  3TB5 A;  4IF7 A;  2BHA A;  3Q6D A;  1C21 A;  1B6A A;  2EVC A;  2GZ5 A;  2GGB A;  2MAT A;  3PKC A;  1R5G A;  2BHD A;  4IEC A;  2BWU A;  4FLI A;  3RVA A;  1KP0 A;  2P99 A;  1C24 A;  2B3L A;  4MAT A;  4IKT A;  4B28 A;  1QXY A;  1WL6 A;  1YJ3 A;  2ZSG A;  1XNZ A;  2HOW A;  5E5B A;  1WY2 A;  4S2T P;  2NQ7 A;  4ZWO A;  4FO7 A;  2P98 A;  3L7G A;  4PNC A;  1PV9 A;  3FM3 A;  5D6E A;  1C23 A;  2BWV A;  4FKC A;  4U76 A;  5CDL A;  2BWX A;  5CDE A;  3MAT A;  2GTX A;  3IU9 A;  4PV4 A;  1N51 A;  1W7V A;  3PKE A;  2EVM A;  1KQ0 A;  3PKB A;  4RZY A;  2BWS A;  2GG3 A;  3CTZ A;  2BB7 A;  4OOK A;  4IKR A;  5JFR A;  2GG5 A;  5JI6 A;  4FUK A;  1QXW A;  1B59 A;  4ZNG A;  4U1B A;  1YW8 A;  1JAW A;  2Q94 A;  3FMQ A;  4IPA A;  4U6Z A;  1R58 A;  3PKD A;  2GG2 A;  1YVM A;  4A6V A;  1BOA A;  4JUQ A;  4U73 A;  1QZY A;  3S6B A;  4RZZ A;  2GG0 A;  3MR1 A;  2B3H A;  2V3X A;  3CB6 A;  1C27 A;  2EVO A;  2GU5 A;  2V3Y A;  5FCH A;  4EGE A;  4ZWU A;  2NQ6 A;  3IU8 A;  1BN5 A;  4RGZ 1;  1KQ9 A;  1YW7 A;  1XGO A;  1WBQ A;  4U6J A;  4Z7M A;  2Q95 A;  3IG4 A;  2GG7 A;  1W2M A;  4ZWP A;  2Q96 A;  1WN1 A;  1XGN A;  3FMR A;  1QXZ A;  3MX6 A;  3D27 A;  2Q93 A;  2V6C A;  4FLK A;  2GG9 A;  4FLL A;  2GGC A;  4S01 A;  2GU7 A;  1WL9 A;  4U70 A;  5CE6 A;  3BIQ A;  4FO8 A;  2BHB A;  2P9A A;  2GU4 A;  2GA2 A;  4A6W A;  1XGS A;  1A16 A;  4U6E A;  2OKN A;  1XGM A;  2V3Z A;  1CHM A;  5CDV A;  3L24 A;  3ROR A;  1C22 A;  4IKU A;  2B3K A;  1M35 A;  4KM3 A;  2BWY A;  3TAV A;  5FCF A;  2BHC A;  4IU6 A;  4IDY A;  2ADU A;  3BIP A;  4IKS A;  5CIK A;  4HXX A;  3IU7 A;  4S2R P;  4U75 A;  2G6P A;  2EA4 A;  2DFI A;  4U6W A;  1WLR A;  5CNX A;  1R5H A;  4QR8 A;  2GU6 A;  2IW2 A;  1MAT A;  1Y1N A;  2BWT A;  4R60 A;  2Q92 A;  1O0X A;  2OAZ A;  4U6C A;  2Q8K A;  1WKM A;  2EA2 A;  2GG8 A;  4U69 A;  5CLS A; 
#chains in the Genus database with same CATH homology
 2BH3 A;  3CB5 A;  4FLJ A;  2BWW A;  4S00 A;  4U71 A;  5JHU A;  1YW9 A;  3PKA A;  3BIT A;  5D6F A;  2BN7 A;  3TB5 A;  4IF7 A;  2BHA A;  3Q6D A;  1C21 A;  1B6A A;  2EVC A;  2GZ5 A;  2GGB A;  2MAT A;  3PKC A;  1R5G A;  2BHD A;  4IEC A;  2BWU A;  4FLI A;  3RVA A;  1KP0 A;  2P99 A;  1C24 A;  2B3L A;  4MAT A;  4IKT A;  4B28 A;  1QXY A;  1WL6 A;  1YJ3 A;  2ZSG A;  1XNZ A;  2HOW A;  5E5B A;  1WY2 A;  4S2T P;  2NQ7 A;  4ZWO A;  4FO7 A;  2P98 A;  3L7G A;  4PNC A;  1PV9 A;  3FM3 A;  5D6E A;  1C23 A;  2BWV A;  4FKC A;  4U76 A;  5CDL A;  2BWX A;  5CDE A;  3MAT A;  2GTX A;  3IU9 A;  4PV4 A;  1N51 A;  1W7V A;  3PKE A;  2EVM A;  1KQ0 A;  3PKB A;  4RZY A;  2BWS A;  2GG3 A;  3CTZ A;  2BB7 A;  4OOK A;  4IKR A;  5JFR A;  2GG5 A;  5JI6 A;  4FUK A;  1QXW A;  1B59 A;  4ZNG A;  4U1B A;  1YW8 A;  1JAW A;  2Q94 A;  3FMQ A;  4IPA A;  4U6Z A;  1R58 A;  3PKD A;  2GG2 A;  1YVM A;  4A6V A;  1BOA A;  4JUQ A;  4U73 A;  1QZY A;  3S6B A;  4RZZ A;  2GG0 A;  3MR1 A;  2B3H A;  2V3X A;  3CB6 A;  1C27 A;  2EVO A;  2GU5 A;  2V3Y A;  5FCH A;  4EGE A;  4ZWU A;  2NQ6 A;  3IU8 A;  1BN5 A;  4RGZ 1;  1KQ9 A;  1YW7 A;  1XGO A;  1WBQ A;  4U6J A;  4Z7M A;  2Q95 A;  3IG4 A;  2GG7 A;  1W2M A;  4ZWP A;  2Q96 A;  1WN1 A;  1XGN A;  3FMR A;  1QXZ A;  3MX6 A;  3D27 A;  2Q93 A;  2V6C A;  4FLK A;  2GG9 A;  4FLL A;  2GGC A;  4S01 A;  2GU7 A;  1WL9 A;  4U70 A;  5CE6 A;  3BIQ A;  4FO8 A;  2BHB A;  2P9A A;  2GU4 A;  2GA2 A;  4A6W A;  1XGS A;  1A16 A;  4U6E A;  2OKN A;  1XGM A;  2V3Z A;  1CHM A;  5CDV A;  3L24 A;  3ROR A;  1C22 A;  4IKU A;  2B3K A;  1M35 A;  4KM3 A;  2BWY A;  3TAV A;  5FCF A;  2BHC A;  4IU6 A;  4IDY A;  2ADU A;  3BIP A;  4IKS A;  5CIK A;  4HXX A;  3IU7 A;  4S2R P;  4U75 A;  2G6P A;  2EA4 A;  2DFI A;  4U6W A;  1WLR A;  5CNX A;  1R5H A;  4QR8 A;  2GU6 A;  2IW2 A;  1MAT A;  1Y1N A;  2BWT A;  4R60 A;  2Q92 A;  1O0X A;  2OAZ A;  4U6C A;  2Q8K A;  1WKM A;  2EA2 A;  2GG8 A;  4U69 A;  5CLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...