2GU4A

E. coli methionine aminopeptidase in complex with nlep, 1: 0.5, di-metalated
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of catalysis by monometalated methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 91
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gu4A00
2GG3A 4U71A 4FUKA 2GU4A 3L7GA 1C27A 1YJ3A 2OAZA 4R60A 4U1BA 4PV4A 2V3ZA 2GU6A 1XNZA 5FCFA 1Y1NA 1WL9A 4S01A 2EA4A 2IW2A 1A16A 4Z7MA 5D6EA 2GTXA 1QXZA 4U76A 1XGOA 5JFRA 4OOKA 4S2RP 2BWVA 4IDYA 5JI6A 2P98A 4ZNGA 2V6CA 5CDLA 2GG7A 2Q93A 2GGBA 3CB5A 4U6ZA 5CNXA 1C22A 1BN5A 1N51A 1B59A 1O0XA 2DFIA 4U6CA 2MATA 2BB7A 2NQ6A 3IU9A 2HOWA 2NQ7A 2BN7A 1QXWA 4ZWPA 4FLLA 4RZYA 4S2TP 1XGMA 3D27A 4U69A 4FLJA 1M35A 1WBQA 2P9AA 3IG4A 4U73A 1R5HA 4IKRA 3FMRA 1XGNA 5CIKA 3RVAA 5D6FA 2GG9A 2GGCA 3MR1A 4IKSA 4U75A 3FM3A 4ZWOA 1WKMA 4RGZ1 4KM3A 4IKUA 1C23A 2GU5A 2ZSGA 2Q94A 3TAVA 2B3HA 2BWTA 2GU7A 2BWUA 1WN1A 1PV9A 4FKCA 1YW7A 4U6EA 3CB6A 2GG5A 3FMQA 1YW8A 5CDVA 2Q96A 4FLKA 4S00A 2Q8KA 2GA2A 5CLSA 1B6AA 3MX6A 2EA2A 4IKTA 2BWSA 3IU8A 4QR8A 3RORA 4FO8A 4JUQA 1C24A 1W7VA 2EVOA 2GG0A 4IECA 2ADUA 1XGSA 1KP0A 3PKCA 3TB5A 2OKNA 1QZYA 2B3LA 1MATA 3IU7A 2V3XA 5CE6A 3PKAA 2B3KA 3BIPA 2V3YA 2BHBA 2Q95A 3MATA 3PKBA 2BHCA 2Q92A 3CTZA 1C21A 4FLIA 4EGEA 1WLRA 2BH3A 4U70A 1KQ9A 3BITA 1KQ0A 2P99A 3PKDA 1WL6A 2BHAA 1BOAA 2EVCA 3Q6DA 3S6BA 4FO7A 4A6WA 2G6PA 3BIQA 4PNCA 4IU6A 4RZZA 1QXYA 1JAWA 2BWWA 4A6VA 5CDEA 4ZWUA 5JHUA 3PKEA 2GZ5A 2GG8A 1R5GA 2EVMA 4U6JA 1R58A 4IF7A 4IPAA 3L24A 1WY2A 2BWYA 5E5BA 1W2MA 2BHDA 4U6WA 1YVMA 1CHMA 2GG2A 4MATA 4HXXA 4B28A 2BWXA 5FCHA 1YW9A
chains in the Genus database with same CATH superfamily
2GG3A 4U71A 4FUKA 2GU4A 3L7GA 1C27A 1YJ3A 2OAZA 4R60A 4U1BA 4PV4A 2V3ZA 2GU6A 1XNZA 5FCFA 1Y1NA 1WL9A 4S01A 2EA4A 2IW2A 1A16A 4Z7MA 5D6EA 2GTXA 1QXZA 4U76A 1XGOA 5JFRA 4OOKA 4S2RP 2BWVA 4IDYA 5JI6A 2P98A 4ZNGA 2V6CA 5CDLA 2GG7A 2Q93A 2GGBA 3CB5A 4U6ZA 5CNXA 1C22A 1BN5A 1N51A 1B59A 1O0XA 2DFIA 4U6CA 2MATA 2BB7A 2NQ6A 3IU9A 2HOWA 2NQ7A 2BN7A 1QXWA 4ZWPA 4FLLA 4RZYA 4S2TP 1XGMA 3D27A 4U69A 4FLJA 1M35A 1WBQA 2P9AA 3IG4A 4U73A 1R5HA 4IKRA 3FMRA 1XGNA 5CIKA 3RVAA 5D6FA 2GG9A 2GGCA 3MR1A 4IKSA 4U75A 3FM3A 4ZWOA 1WKMA 4RGZ1 4KM3A 4IKUA 1C23A 2GU5A 2ZSGA 2Q94A 3TAVA 2B3HA 2BWTA 2GU7A 2BWUA 1WN1A 1PV9A 4FKCA 1YW7A 4U6EA 3CB6A 2GG5A 3FMQA 1YW8A 5CDVA 2Q96A 4FLKA 4S00A 2Q8KA 2GA2A 5CLSA 1B6AA 3MX6A 2EA2A 4IKTA 2BWSA 3IU8A 4QR8A 3RORA 4FO8A 4JUQA 1C24A 1W7VA 2EVOA 2GG0A 4IECA 2ADUA 1XGSA 1KP0A 3PKCA 3TB5A 2OKNA 1QZYA 2B3LA 1MATA 3IU7A 2V3XA 5CE6A 3PKAA 2B3KA 3BIPA 2V3YA 2BHBA 2Q95A 3MATA 3PKBA 2BHCA 2Q92A 3CTZA 1C21A 4FLIA 4EGEA 1WLRA 2BH3A 4U70A 1KQ9A 3BITA 1KQ0A 2P99A 3PKDA 1WL6A 2BHAA 1BOAA 2EVCA 3Q6DA 3S6BA 4FO7A 4A6WA 2G6PA 3BIQA 4PNCA 4IU6A 4RZZA 1QXYA 1JAWA 2BWWA 4A6VA 5CDEA 4ZWUA 5JHUA 3PKEA 2GZ5A 2GG8A 1R5GA 2EVMA 4U6JA 1R58A 4IF7A 4IPAA 3L24A 1WY2A 2BWYA 5E5BA 1W2MA 2BHDA 4U6WA 1YVMA 1CHMA 2GG2A 4MATA 4HXXA 4B28A 2BWXA 5FCHA 1YW9A
chains in the Genus database with same CATH topology
2GG3A 4U71A 4FUKA 2GU4A 3L7GA 1C27A 1YJ3A 2OAZA 4R60A 4U1BA 4PV4A 2V3ZA 2GU6A 1XNZA 5FCFA 1Y1NA 1WL9A 4S01A 2EA4A 2IW2A 1A16A 4Z7MA 5D6EA 2GTXA 1QXZA 4U76A 1XGOA 5JFRA 4OOKA 4S2RP 2BWVA 4IDYA 5JI6A 2P98A 4ZNGA 2V6CA 5CDLA 2GG7A 2Q93A 2GGBA 3CB5A 4U6ZA 5CNXA 1C22A 1BN5A 1N51A 1B59A 1O0XA 2DFIA 4U6CA 2MATA 2BB7A 2NQ6A 3IU9A 2HOWA 2NQ7A 2BN7A 1QXWA 4ZWPA 4FLLA 4RZYA 4S2TP 1XGMA 3D27A 4U69A 4FLJA 1M35A 1WBQA 2P9AA 3IG4A 4U73A 1R5HA 4IKRA 3FMRA 1XGNA 5CIKA 3RVAA 5D6FA 2GG9A 2GGCA 3MR1A 4IKSA 4U75A 3FM3A 4ZWOA 1WKMA 4RGZ1 4KM3A 4IKUA 1C23A 2GU5A 2ZSGA 2Q94A 3TAVA 2B3HA 2BWTA 2GU7A 2BWUA 1WN1A 1PV9A 4FKCA 1YW7A 4U6EA 3CB6A 2GG5A 3FMQA 1YW8A 5CDVA 2Q96A 4FLKA 4S00A 2Q8KA 2GA2A 5CLSA 1B6AA 3MX6A 2EA2A 4IKTA 2BWSA 3IU8A 4QR8A 3RORA 4FO8A 4JUQA 1C24A 1W7VA 2EVOA 2GG0A 4IECA 2ADUA 1XGSA 1KP0A 3PKCA 3TB5A 2OKNA 1QZYA 2B3LA 1MATA 3IU7A 2V3XA 5CE6A 3PKAA 2B3KA 3BIPA 2V3YA 2BHBA 2Q95A 3MATA 3PKBA 2BHCA 2Q92A 3CTZA 1C21A 4FLIA 4EGEA 1WLRA 2BH3A 4U70A 1KQ9A 3BITA 1KQ0A 2P99A 3PKDA 1WL6A 2BHAA 1BOAA 2EVCA 3Q6DA 3S6BA 4FO7A 4A6WA 2G6PA 3BIQA 4PNCA 4IU6A 4RZZA 1QXYA 1JAWA 2BWWA 4A6VA 5CDEA 4ZWUA 5JHUA 3PKEA 2GZ5A 2GG8A 1R5GA 2EVMA 4U6JA 1R58A 4IF7A 4IPAA 3L24A 1WY2A 2BWYA 5E5BA 1W2MA 2BHDA 4U6WA 1YVMA 1CHMA 2GG2A 4MATA 4HXXA 4B28A 2BWXA 5FCHA 1YW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG3 A;  4U71 A;  4FUK A;  2GU4 A;  3L7G A;  1C27 A;  1YJ3 A;  2OAZ A;  4R60 A;  4U1B A;  4PV4 A;  2V3Z A;  2GU6 A;  1XNZ A;  5FCF A;  1Y1N A;  1WL9 A;  4S01 A;  2EA4 A;  2IW2 A;  1A16 A;  4Z7M A;  5D6E A;  2GTX A;  1QXZ A;  4U76 A;  1XGO A;  5JFR A;  4OOK A;  4S2R P;  2BWV A;  4IDY A;  5JI6 A;  2P98 A;  4ZNG A;  2V6C A;  5CDL A;  2GG7 A;  2Q93 A;  2GGB A;  3CB5 A;  4U6Z A;  5CNX A;  1C22 A;  1BN5 A;  1N51 A;  1B59 A;  1O0X A;  2DFI A;  4U6C A;  2MAT A;  2BB7 A;  2NQ6 A;  3IU9 A;  2HOW A;  2NQ7 A;  2BN7 A;  1QXW A;  4ZWP A;  4FLL A;  4RZY A;  4S2T P;  1XGM A;  3D27 A;  4U69 A;  4FLJ A;  1M35 A;  1WBQ A;  2P9A A;  3IG4 A;  4U73 A;  1R5H A;  4IKR A;  3FMR A;  1XGN A;  5CIK A;  3RVA A;  5D6F A;  2GG9 A;  2GGC A;  3MR1 A;  4IKS A;  4U75 A;  3FM3 A;  4ZWO A;  1WKM A;  4RGZ 1;  4KM3 A;  4IKU A;  1C23 A;  2GU5 A;  2ZSG A;  2Q94 A;  3TAV A;  2B3H A;  2BWT A;  2GU7 A;  2BWU A;  1WN1 A;  1PV9 A;  4FKC A;  1YW7 A;  4U6E A;  3CB6 A;  2GG5 A;  3FMQ A;  1YW8 A;  5CDV A;  2Q96 A;  4FLK A;  4S00 A;  2Q8K A;  2GA2 A;  5CLS A;  1B6A A;  3MX6 A;  2EA2 A;  4IKT A;  2BWS A;  3IU8 A;  4QR8 A;  3ROR A;  4FO8 A;  4JUQ A;  1C24 A;  1W7V A;  2EVO A;  2GG0 A;  4IEC A;  2ADU A;  1XGS A;  1KP0 A;  3PKC A;  3TB5 A;  2OKN A;  1QZY A;  2B3L A;  1MAT A;  3IU7 A;  2V3X A;  5CE6 A;  3PKA A;  2B3K A;  3BIP A;  2V3Y A;  2BHB A;  2Q95 A;  3MAT A;  3PKB A;  2BHC A;  2Q92 A;  3CTZ A;  1C21 A;  4FLI A;  4EGE A;  1WLR A;  2BH3 A;  4U70 A;  1KQ9 A;  3BIT A;  1KQ0 A;  2P99 A;  3PKD A;  1WL6 A;  2BHA A;  1BOA A;  2EVC A;  3Q6D A;  3S6B A;  4FO7 A;  4A6W A;  2G6P A;  3BIQ A;  4PNC A;  4IU6 A;  4RZZ A;  1QXY A;  1JAW A;  2BWW A;  4A6V A;  5CDE A;  4ZWU A;  5JHU A;  3PKE A;  2GZ5 A;  2GG8 A;  1R5G A;  2EVM A;  4U6J A;  1R58 A;  4IF7 A;  4IPA A;  3L24 A;  1WY2 A;  2BWY A;  5E5B A;  1W2M A;  2BHD A;  4U6W A;  1YVM A;  1CHM A;  2GG2 A;  4MAT A;  4HXX A;  4B28 A;  2BWX A;  5FCH A;  1YW9 A; 
#chains in the Genus database with same CATH topology
 2GG3 A;  4U71 A;  4FUK A;  2GU4 A;  3L7G A;  1C27 A;  1YJ3 A;  2OAZ A;  4R60 A;  4U1B A;  4PV4 A;  2V3Z A;  2GU6 A;  1XNZ A;  5FCF A;  1Y1N A;  1WL9 A;  4S01 A;  2EA4 A;  2IW2 A;  1A16 A;  4Z7M A;  5D6E A;  2GTX A;  1QXZ A;  4U76 A;  1XGO A;  5JFR A;  4OOK A;  4S2R P;  2BWV A;  4IDY A;  5JI6 A;  2P98 A;  4ZNG A;  2V6C A;  5CDL A;  2GG7 A;  2Q93 A;  2GGB A;  3CB5 A;  4U6Z A;  5CNX A;  1C22 A;  1BN5 A;  1N51 A;  1B59 A;  1O0X A;  2DFI A;  4U6C A;  2MAT A;  2BB7 A;  2NQ6 A;  3IU9 A;  2HOW A;  2NQ7 A;  2BN7 A;  1QXW A;  4ZWP A;  4FLL A;  4RZY A;  4S2T P;  1XGM A;  3D27 A;  4U69 A;  4FLJ A;  1M35 A;  1WBQ A;  2P9A A;  3IG4 A;  4U73 A;  1R5H A;  4IKR A;  3FMR A;  1XGN A;  5CIK A;  3RVA A;  5D6F A;  2GG9 A;  2GGC A;  3MR1 A;  4IKS A;  4U75 A;  3FM3 A;  4ZWO A;  1WKM A;  4RGZ 1;  4KM3 A;  4IKU A;  1C23 A;  2GU5 A;  2ZSG A;  2Q94 A;  3TAV A;  2B3H A;  2BWT A;  2GU7 A;  2BWU A;  1WN1 A;  1PV9 A;  4FKC A;  1YW7 A;  4U6E A;  3CB6 A;  2GG5 A;  3FMQ A;  1YW8 A;  5CDV A;  2Q96 A;  4FLK A;  4S00 A;  2Q8K A;  2GA2 A;  5CLS A;  1B6A A;  3MX6 A;  2EA2 A;  4IKT A;  2BWS A;  3IU8 A;  4QR8 A;  3ROR A;  4FO8 A;  4JUQ A;  1C24 A;  1W7V A;  2EVO A;  2GG0 A;  4IEC A;  2ADU A;  1XGS A;  1KP0 A;  3PKC A;  3TB5 A;  2OKN A;  1QZY A;  2B3L A;  1MAT A;  3IU7 A;  2V3X A;  5CE6 A;  3PKA A;  2B3K A;  3BIP A;  2V3Y A;  2BHB A;  2Q95 A;  3MAT A;  3PKB A;  2BHC A;  2Q92 A;  3CTZ A;  1C21 A;  4FLI A;  4EGE A;  1WLR A;  2BH3 A;  4U70 A;  1KQ9 A;  3BIT A;  1KQ0 A;  2P99 A;  3PKD A;  1WL6 A;  2BHA A;  1BOA A;  2EVC A;  3Q6D A;  3S6B A;  4FO7 A;  4A6W A;  2G6P A;  3BIQ A;  4PNC A;  4IU6 A;  4RZZ A;  1QXY A;  1JAW A;  2BWW A;  4A6V A;  5CDE A;  4ZWU A;  5JHU A;  3PKE A;  2GZ5 A;  2GG8 A;  1R5G A;  2EVM A;  4U6J A;  1R58 A;  4IF7 A;  4IPA A;  3L24 A;  1WY2 A;  2BWY A;  5E5B A;  1W2M A;  2BHD A;  4U6W A;  1YVM A;  1CHM A;  2GG2 A;  4MAT A;  4HXX A;  4B28 A;  2BWX A;  5FCH A;  1YW9 A; 
#chains in the Genus database with same CATH homology
 2GG3 A;  4U71 A;  4FUK A;  2GU4 A;  3L7G A;  1C27 A;  1YJ3 A;  2OAZ A;  4R60 A;  4U1B A;  4PV4 A;  2V3Z A;  2GU6 A;  1XNZ A;  5FCF A;  1Y1N A;  1WL9 A;  4S01 A;  2EA4 A;  2IW2 A;  1A16 A;  4Z7M A;  5D6E A;  2GTX A;  1QXZ A;  4U76 A;  1XGO A;  5JFR A;  4OOK A;  4S2R P;  2BWV A;  4IDY A;  5JI6 A;  2P98 A;  4ZNG A;  2V6C A;  5CDL A;  2GG7 A;  2Q93 A;  2GGB A;  3CB5 A;  4U6Z A;  5CNX A;  1C22 A;  1BN5 A;  1N51 A;  1B59 A;  1O0X A;  2DFI A;  4U6C A;  2MAT A;  2BB7 A;  2NQ6 A;  3IU9 A;  2HOW A;  2NQ7 A;  2BN7 A;  1QXW A;  4ZWP A;  4FLL A;  4RZY A;  4S2T P;  1XGM A;  3D27 A;  4U69 A;  4FLJ A;  1M35 A;  1WBQ A;  2P9A A;  3IG4 A;  4U73 A;  1R5H A;  4IKR A;  3FMR A;  1XGN A;  5CIK A;  3RVA A;  5D6F A;  2GG9 A;  2GGC A;  3MR1 A;  4IKS A;  4U75 A;  3FM3 A;  4ZWO A;  1WKM A;  4RGZ 1;  4KM3 A;  4IKU A;  1C23 A;  2GU5 A;  2ZSG A;  2Q94 A;  3TAV A;  2B3H A;  2BWT A;  2GU7 A;  2BWU A;  1WN1 A;  1PV9 A;  4FKC A;  1YW7 A;  4U6E A;  3CB6 A;  2GG5 A;  3FMQ A;  1YW8 A;  5CDV A;  2Q96 A;  4FLK A;  4S00 A;  2Q8K A;  2GA2 A;  5CLS A;  1B6A A;  3MX6 A;  2EA2 A;  4IKT A;  2BWS A;  3IU8 A;  4QR8 A;  3ROR A;  4FO8 A;  4JUQ A;  1C24 A;  1W7V A;  2EVO A;  2GG0 A;  4IEC A;  2ADU A;  1XGS A;  1KP0 A;  3PKC A;  3TB5 A;  2OKN A;  1QZY A;  2B3L A;  1MAT A;  3IU7 A;  2V3X A;  5CE6 A;  3PKA A;  2B3K A;  3BIP A;  2V3Y A;  2BHB A;  2Q95 A;  3MAT A;  3PKB A;  2BHC A;  2Q92 A;  3CTZ A;  1C21 A;  4FLI A;  4EGE A;  1WLR A;  2BH3 A;  4U70 A;  1KQ9 A;  3BIT A;  1KQ0 A;  2P99 A;  3PKD A;  1WL6 A;  2BHA A;  1BOA A;  2EVC A;  3Q6D A;  3S6B A;  4FO7 A;  4A6W A;  2G6P A;  3BIQ A;  4PNC A;  4IU6 A;  4RZZ A;  1QXY A;  1JAW A;  2BWW A;  4A6V A;  5CDE A;  4ZWU A;  5JHU A;  3PKE A;  2GZ5 A;  2GG8 A;  1R5G A;  2EVM A;  4U6J A;  1R58 A;  4IF7 A;  4IPA A;  3L24 A;  1WY2 A;  2BWY A;  5E5B A;  1W2M A;  2BHD A;  4U6W A;  1YVM A;  1CHM A;  2GG2 A;  4MAT A;  4HXX A;  4B28 A;  2BWX A;  5FCH A;  1YW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...