2P99A

E. coli methionine aminopeptidase monometalated with inhibitor ye6
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
261
structure length
261
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 261
sequence length 261
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p99A00
1A16A 1W2MA 4IDYA 2B3KA 1KQ9A 1QXYA 2BHCA 4IKUA 1C24A 4U70A 1M35A 4KM3A 2B3HA 2BWSA 1B6AA 1QXWA 1C21A 3RVAA 4EGEA 1PV9A 2GGBA 5CDVA 2BWXA 2Q95A 5JHUA 2GG8A 1WL6A 3TAVA 2GU6A 1XGNA 3BIQA 3CB5A 4FKCA 2G6PA 3FMQA 2V6CA 3L7GA 2GG9A 1QXZA 2Q92A 4FLJA 4FUKA 3CB6A 4IKTA 2BHAA 1WL9A 2GG3A 2GGCA 4U71A 4U6CA 3IG4A 3PKCA 2BWUA 5FCHA 2GG0A 3BITA 4FLLA 1WKMA 3PKDA 1Y1NA 3TB5A 4IU6A 1WY2A 4S01A 3D27A 5JI6A 1O0XA 4HXXA 4ZWOA 1R5GA 1KP0A 2P98A 4R60A 2BWTA 4OOKA 4FO7A 5CLSA 2NQ6A 2GA2A 2V3YA 3MATA 4FO8A 4PNCA 5CDLA 3PKBA 1C27A 1BN5A 1MATA 1YVMA 5CDEA 4Z7MA 1N51A 2BH3A 4IF7A 2GZ5A 2EVOA 3Q6DA 1WBQA 4PV4A 4IPAA 2NQ7A 3CTZA 3BIPA 4ZNGA 1B59A 4QR8A 4RZYA 2EA4A 5E5BA 5CE6A 5D6EA 1YW8A 1XGSA 2BN7A 1R5HA 2BHBA 2IW2A 2EA2A 4MATA 2BWWA 3MX6A 4U73A 3FM3A 4U6WA 2GTXA 1C22A 4ZWUA 2OKNA 2GG2A 3S6BA 2BWYA 4U6JA 1YJ3A 3L24A 1KQ0A 3RORA 2EVMA 2OAZA 2Q93A 1BOAA 3IU9A 3MR1A 1CHMA 2V3ZA 3PKAA 4B28A 2DFIA 4RGZ1 4S2TP 4U75A 4U6EA 5CIKA 5CNXA 1WN1A 1YW9A 2MATA 3IU8A 4RZZA 4U76A 4S00A 3PKEA 2GU4A 2BHDA 2P99A 4ZWPA 1QZYA 2Q96A 1W7VA 2GU7A 4IKRA 4U6ZA 2HOWA 1WLRA 1JAWA 5D6FA 2BB7A 2EVCA 1YW7A 3FMRA 2BWVA 5FCFA 1R58A 2B3LA 2GG7A 2ZSGA 2V3XA 4U69A 4JUQA 4FLKA 4A6VA 4IKSA 3IU7A 4U1BA 1XGOA 2GG5A 2P9AA 4IECA 4FLIA 2Q8KA 5JFRA 4S2RP 2GU5A 4A6WA 2ADUA 2Q94A 1XGMA 1C23A 1XNZA
chains in the Genus database with same CATH superfamily
1A16A 1W2MA 4IDYA 2B3KA 1KQ9A 1QXYA 2BHCA 4IKUA 1C24A 4U70A 1M35A 4KM3A 2B3HA 2BWSA 1B6AA 1QXWA 1C21A 3RVAA 4EGEA 1PV9A 2GGBA 5CDVA 2BWXA 2Q95A 5JHUA 2GG8A 1WL6A 3TAVA 2GU6A 1XGNA 3BIQA 3CB5A 4FKCA 2G6PA 3FMQA 2V6CA 3L7GA 2GG9A 1QXZA 2Q92A 4FLJA 4FUKA 3CB6A 4IKTA 2BHAA 1WL9A 2GG3A 2GGCA 4U71A 4U6CA 3IG4A 3PKCA 2BWUA 5FCHA 2GG0A 3BITA 4FLLA 1WKMA 3PKDA 1Y1NA 3TB5A 4IU6A 1WY2A 4S01A 3D27A 5JI6A 1O0XA 4HXXA 4ZWOA 1R5GA 1KP0A 2P98A 4R60A 2BWTA 4OOKA 4FO7A 5CLSA 2NQ6A 2GA2A 2V3YA 3MATA 4FO8A 4PNCA 5CDLA 3PKBA 1C27A 1BN5A 1MATA 1YVMA 5CDEA 4Z7MA 1N51A 2BH3A 4IF7A 2GZ5A 2EVOA 3Q6DA 1WBQA 4PV4A 4IPAA 2NQ7A 3CTZA 3BIPA 4ZNGA 1B59A 4QR8A 4RZYA 2EA4A 5E5BA 5CE6A 5D6EA 1YW8A 1XGSA 2BN7A 1R5HA 2BHBA 2IW2A 2EA2A 4MATA 2BWWA 3MX6A 4U73A 3FM3A 4U6WA 2GTXA 1C22A 4ZWUA 2OKNA 2GG2A 3S6BA 2BWYA 4U6JA 1YJ3A 3L24A 1KQ0A 3RORA 2EVMA 2OAZA 2Q93A 1BOAA 3IU9A 3MR1A 1CHMA 2V3ZA 3PKAA 4B28A 2DFIA 4RGZ1 4S2TP 4U75A 4U6EA 5CIKA 5CNXA 1WN1A 1YW9A 2MATA 3IU8A 4RZZA 4U76A 4S00A 3PKEA 2GU4A 2BHDA 2P99A 4ZWPA 1QZYA 2Q96A 1W7VA 2GU7A 4IKRA 4U6ZA 2HOWA 1WLRA 1JAWA 5D6FA 2BB7A 2EVCA 1YW7A 3FMRA 2BWVA 5FCFA 1R58A 2B3LA 2GG7A 2ZSGA 2V3XA 4U69A 4JUQA 4FLKA 4A6VA 4IKSA 3IU7A 4U1BA 1XGOA 2GG5A 2P9AA 4IECA 4FLIA 2Q8KA 5JFRA 4S2RP 2GU5A 4A6WA 2ADUA 2Q94A 1XGMA 1C23A 1XNZA
chains in the Genus database with same CATH topology
1A16A 1W2MA 4IDYA 2B3KA 1KQ9A 1QXYA 2BHCA 4IKUA 1C24A 4U70A 1M35A 4KM3A 2B3HA 2BWSA 1B6AA 1QXWA 1C21A 3RVAA 4EGEA 1PV9A 2GGBA 5CDVA 2BWXA 2Q95A 5JHUA 2GG8A 1WL6A 3TAVA 2GU6A 1XGNA 3BIQA 3CB5A 4FKCA 2G6PA 3FMQA 2V6CA 3L7GA 2GG9A 1QXZA 2Q92A 4FLJA 4FUKA 3CB6A 4IKTA 2BHAA 1WL9A 2GG3A 2GGCA 4U71A 4U6CA 3IG4A 3PKCA 2BWUA 5FCHA 2GG0A 3BITA 4FLLA 1WKMA 3PKDA 1Y1NA 3TB5A 4IU6A 1WY2A 4S01A 3D27A 5JI6A 1O0XA 4HXXA 4ZWOA 1R5GA 1KP0A 2P98A 4R60A 2BWTA 4OOKA 4FO7A 5CLSA 2NQ6A 2GA2A 2V3YA 3MATA 4FO8A 4PNCA 5CDLA 3PKBA 1C27A 1BN5A 1MATA 1YVMA 5CDEA 4Z7MA 1N51A 2BH3A 4IF7A 2GZ5A 2EVOA 3Q6DA 1WBQA 4PV4A 4IPAA 2NQ7A 3CTZA 3BIPA 4ZNGA 1B59A 4QR8A 4RZYA 2EA4A 5E5BA 5CE6A 5D6EA 1YW8A 1XGSA 2BN7A 1R5HA 2BHBA 2IW2A 2EA2A 4MATA 2BWWA 3MX6A 4U73A 3FM3A 4U6WA 2GTXA 1C22A 4ZWUA 2OKNA 2GG2A 3S6BA 2BWYA 4U6JA 1YJ3A 3L24A 1KQ0A 3RORA 2EVMA 2OAZA 2Q93A 1BOAA 3IU9A 3MR1A 1CHMA 2V3ZA 3PKAA 4B28A 2DFIA 4RGZ1 4S2TP 4U75A 4U6EA 5CIKA 5CNXA 1WN1A 1YW9A 2MATA 3IU8A 4RZZA 4U76A 4S00A 3PKEA 2GU4A 2BHDA 2P99A 4ZWPA 1QZYA 2Q96A 1W7VA 2GU7A 4IKRA 4U6ZA 2HOWA 1WLRA 1JAWA 5D6FA 2BB7A 2EVCA 1YW7A 3FMRA 2BWVA 5FCFA 1R58A 2B3LA 2GG7A 2ZSGA 2V3XA 4U69A 4JUQA 4FLKA 4A6VA 4IKSA 3IU7A 4U1BA 1XGOA 2GG5A 2P9AA 4IECA 4FLIA 2Q8KA 5JFRA 4S2RP 2GU5A 4A6WA 2ADUA 2Q94A 1XGMA 1C23A 1XNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A16 A;  1W2M A;  4IDY A;  2B3K A;  1KQ9 A;  1QXY A;  2BHC A;  4IKU A;  1C24 A;  4U70 A;  1M35 A;  4KM3 A;  2B3H A;  2BWS A;  1B6A A;  1QXW A;  1C21 A;  3RVA A;  4EGE A;  1PV9 A;  2GGB A;  5CDV A;  2BWX A;  2Q95 A;  5JHU A;  2GG8 A;  1WL6 A;  3TAV A;  2GU6 A;  1XGN A;  3BIQ A;  3CB5 A;  4FKC A;  2G6P A;  3FMQ A;  2V6C A;  3L7G A;  2GG9 A;  1QXZ A;  2Q92 A;  4FLJ A;  4FUK A;  3CB6 A;  4IKT A;  2BHA A;  1WL9 A;  2GG3 A;  2GGC A;  4U71 A;  4U6C A;  3IG4 A;  3PKC A;  2BWU A;  5FCH A;  2GG0 A;  3BIT A;  4FLL A;  1WKM A;  3PKD A;  1Y1N A;  3TB5 A;  4IU6 A;  1WY2 A;  4S01 A;  3D27 A;  5JI6 A;  1O0X A;  4HXX A;  4ZWO A;  1R5G A;  1KP0 A;  2P98 A;  4R60 A;  2BWT A;  4OOK A;  4FO7 A;  5CLS A;  2NQ6 A;  2GA2 A;  2V3Y A;  3MAT A;  4FO8 A;  4PNC A;  5CDL A;  3PKB A;  1C27 A;  1BN5 A;  1MAT A;  1YVM A;  5CDE A;  4Z7M A;  1N51 A;  2BH3 A;  4IF7 A;  2GZ5 A;  2EVO A;  3Q6D A;  1WBQ A;  4PV4 A;  4IPA A;  2NQ7 A;  3CTZ A;  3BIP A;  4ZNG A;  1B59 A;  4QR8 A;  4RZY A;  2EA4 A;  5E5B A;  5CE6 A;  5D6E A;  1YW8 A;  1XGS A;  2BN7 A;  1R5H A;  2BHB A;  2IW2 A;  2EA2 A;  4MAT A;  2BWW A;  3MX6 A;  4U73 A;  3FM3 A;  4U6W A;  2GTX A;  1C22 A;  4ZWU A;  2OKN A;  2GG2 A;  3S6B A;  2BWY A;  4U6J A;  1YJ3 A;  3L24 A;  1KQ0 A;  3ROR A;  2EVM A;  2OAZ A;  2Q93 A;  1BOA A;  3IU9 A;  3MR1 A;  1CHM A;  2V3Z A;  3PKA A;  4B28 A;  2DFI A;  4RGZ 1;  4S2T P;  4U75 A;  4U6E A;  5CIK A;  5CNX A;  1WN1 A;  1YW9 A;  2MAT A;  3IU8 A;  4RZZ A;  4U76 A;  4S00 A;  3PKE A;  2GU4 A;  2BHD A;  2P99 A;  4ZWP A;  1QZY A;  2Q96 A;  1W7V A;  2GU7 A;  4IKR A;  4U6Z A;  2HOW A;  1WLR A;  1JAW A;  5D6F A;  2BB7 A;  2EVC A;  1YW7 A;  3FMR A;  2BWV A;  5FCF A;  1R58 A;  2B3L A;  2GG7 A;  2ZSG A;  2V3X A;  4U69 A;  4JUQ A;  4FLK A;  4A6V A;  4IKS A;  3IU7 A;  4U1B A;  1XGO A;  2GG5 A;  2P9A A;  4IEC A;  4FLI A;  2Q8K A;  5JFR A;  4S2R P;  2GU5 A;  4A6W A;  2ADU A;  2Q94 A;  1XGM A;  1C23 A;  1XNZ A; 
#chains in the Genus database with same CATH topology
 1A16 A;  1W2M A;  4IDY A;  2B3K A;  1KQ9 A;  1QXY A;  2BHC A;  4IKU A;  1C24 A;  4U70 A;  1M35 A;  4KM3 A;  2B3H A;  2BWS A;  1B6A A;  1QXW A;  1C21 A;  3RVA A;  4EGE A;  1PV9 A;  2GGB A;  5CDV A;  2BWX A;  2Q95 A;  5JHU A;  2GG8 A;  1WL6 A;  3TAV A;  2GU6 A;  1XGN A;  3BIQ A;  3CB5 A;  4FKC A;  2G6P A;  3FMQ A;  2V6C A;  3L7G A;  2GG9 A;  1QXZ A;  2Q92 A;  4FLJ A;  4FUK A;  3CB6 A;  4IKT A;  2BHA A;  1WL9 A;  2GG3 A;  2GGC A;  4U71 A;  4U6C A;  3IG4 A;  3PKC A;  2BWU A;  5FCH A;  2GG0 A;  3BIT A;  4FLL A;  1WKM A;  3PKD A;  1Y1N A;  3TB5 A;  4IU6 A;  1WY2 A;  4S01 A;  3D27 A;  5JI6 A;  1O0X A;  4HXX A;  4ZWO A;  1R5G A;  1KP0 A;  2P98 A;  4R60 A;  2BWT A;  4OOK A;  4FO7 A;  5CLS A;  2NQ6 A;  2GA2 A;  2V3Y A;  3MAT A;  4FO8 A;  4PNC A;  5CDL A;  3PKB A;  1C27 A;  1BN5 A;  1MAT A;  1YVM A;  5CDE A;  4Z7M A;  1N51 A;  2BH3 A;  4IF7 A;  2GZ5 A;  2EVO A;  3Q6D A;  1WBQ A;  4PV4 A;  4IPA A;  2NQ7 A;  3CTZ A;  3BIP A;  4ZNG A;  1B59 A;  4QR8 A;  4RZY A;  2EA4 A;  5E5B A;  5CE6 A;  5D6E A;  1YW8 A;  1XGS A;  2BN7 A;  1R5H A;  2BHB A;  2IW2 A;  2EA2 A;  4MAT A;  2BWW A;  3MX6 A;  4U73 A;  3FM3 A;  4U6W A;  2GTX A;  1C22 A;  4ZWU A;  2OKN A;  2GG2 A;  3S6B A;  2BWY A;  4U6J A;  1YJ3 A;  3L24 A;  1KQ0 A;  3ROR A;  2EVM A;  2OAZ A;  2Q93 A;  1BOA A;  3IU9 A;  3MR1 A;  1CHM A;  2V3Z A;  3PKA A;  4B28 A;  2DFI A;  4RGZ 1;  4S2T P;  4U75 A;  4U6E A;  5CIK A;  5CNX A;  1WN1 A;  1YW9 A;  2MAT A;  3IU8 A;  4RZZ A;  4U76 A;  4S00 A;  3PKE A;  2GU4 A;  2BHD A;  2P99 A;  4ZWP A;  1QZY A;  2Q96 A;  1W7V A;  2GU7 A;  4IKR A;  4U6Z A;  2HOW A;  1WLR A;  1JAW A;  5D6F A;  2BB7 A;  2EVC A;  1YW7 A;  3FMR A;  2BWV A;  5FCF A;  1R58 A;  2B3L A;  2GG7 A;  2ZSG A;  2V3X A;  4U69 A;  4JUQ A;  4FLK A;  4A6V A;  4IKS A;  3IU7 A;  4U1B A;  1XGO A;  2GG5 A;  2P9A A;  4IEC A;  4FLI A;  2Q8K A;  5JFR A;  4S2R P;  2GU5 A;  4A6W A;  2ADU A;  2Q94 A;  1XGM A;  1C23 A;  1XNZ A; 
#chains in the Genus database with same CATH homology
 1A16 A;  1W2M A;  4IDY A;  2B3K A;  1KQ9 A;  1QXY A;  2BHC A;  4IKU A;  1C24 A;  4U70 A;  1M35 A;  4KM3 A;  2B3H A;  2BWS A;  1B6A A;  1QXW A;  1C21 A;  3RVA A;  4EGE A;  1PV9 A;  2GGB A;  5CDV A;  2BWX A;  2Q95 A;  5JHU A;  2GG8 A;  1WL6 A;  3TAV A;  2GU6 A;  1XGN A;  3BIQ A;  3CB5 A;  4FKC A;  2G6P A;  3FMQ A;  2V6C A;  3L7G A;  2GG9 A;  1QXZ A;  2Q92 A;  4FLJ A;  4FUK A;  3CB6 A;  4IKT A;  2BHA A;  1WL9 A;  2GG3 A;  2GGC A;  4U71 A;  4U6C A;  3IG4 A;  3PKC A;  2BWU A;  5FCH A;  2GG0 A;  3BIT A;  4FLL A;  1WKM A;  3PKD A;  1Y1N A;  3TB5 A;  4IU6 A;  1WY2 A;  4S01 A;  3D27 A;  5JI6 A;  1O0X A;  4HXX A;  4ZWO A;  1R5G A;  1KP0 A;  2P98 A;  4R60 A;  2BWT A;  4OOK A;  4FO7 A;  5CLS A;  2NQ6 A;  2GA2 A;  2V3Y A;  3MAT A;  4FO8 A;  4PNC A;  5CDL A;  3PKB A;  1C27 A;  1BN5 A;  1MAT A;  1YVM A;  5CDE A;  4Z7M A;  1N51 A;  2BH3 A;  4IF7 A;  2GZ5 A;  2EVO A;  3Q6D A;  1WBQ A;  4PV4 A;  4IPA A;  2NQ7 A;  3CTZ A;  3BIP A;  4ZNG A;  1B59 A;  4QR8 A;  4RZY A;  2EA4 A;  5E5B A;  5CE6 A;  5D6E A;  1YW8 A;  1XGS A;  2BN7 A;  1R5H A;  2BHB A;  2IW2 A;  2EA2 A;  4MAT A;  2BWW A;  3MX6 A;  4U73 A;  3FM3 A;  4U6W A;  2GTX A;  1C22 A;  4ZWU A;  2OKN A;  2GG2 A;  3S6B A;  2BWY A;  4U6J A;  1YJ3 A;  3L24 A;  1KQ0 A;  3ROR A;  2EVM A;  2OAZ A;  2Q93 A;  1BOA A;  3IU9 A;  3MR1 A;  1CHM A;  2V3Z A;  3PKA A;  4B28 A;  2DFI A;  4RGZ 1;  4S2T P;  4U75 A;  4U6E A;  5CIK A;  5CNX A;  1WN1 A;  1YW9 A;  2MAT A;  3IU8 A;  4RZZ A;  4U76 A;  4S00 A;  3PKE A;  2GU4 A;  2BHD A;  2P99 A;  4ZWP A;  1QZY A;  2Q96 A;  1W7V A;  2GU7 A;  4IKR A;  4U6Z A;  2HOW A;  1WLR A;  1JAW A;  5D6F A;  2BB7 A;  2EVC A;  1YW7 A;  3FMR A;  2BWV A;  5FCF A;  1R58 A;  2B3L A;  2GG7 A;  2ZSG A;  2V3X A;  4U69 A;  4JUQ A;  4FLK A;  4A6V A;  4IKS A;  3IU7 A;  4U1B A;  1XGO A;  2GG5 A;  2P9A A;  4IEC A;  4FLI A;  2Q8K A;  5JFR A;  4S2R P;  2GU5 A;  4A6W A;  2ADU A;  2Q94 A;  1XGM A;  1C23 A;  1XNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...