2P99A

E. coli methionine aminopeptidase monometalated with inhibitor ye6
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
261
structure length
261
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 85
structure length 261
sequence length 261
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p99A00
2BH3A 3FMRA 4FUKA 4U71A 4IKSA 5CDEA 4A6VA 3PKEA 2EA2A 2BB7A 4RZYA 4U6WA 4EGEA 1CHMA 1MATA 2BN7A 3L24A 4FO8A 2ADUA 2Q95A 4IECA 4U6JA 2HOWA 4FLIA 1C24A 2GG0A 4IKTA 1WBQA 1W2MA 2BHAA 4R60A 4U70A 3PKBA 2BWXA 2ZSGA 2GG3A 1B6AA 5JI6A 1N51A 3FMQA 1JAWA 3IG4A 1C23A 1KP0A 2B3KA 2G6PA 4ZNGA 1PV9A 1A16A 2GU6A 2GG8A 3MATA 3CB5A 2GGBA 4JUQA 4U6EA 3BITA 2IW2A 3BIPA 2Q96A 4PNCA 4PV4A 5CLSA 2GU4A 1QXZA 1W7VA 4OOKA 4FO7A 1C27A 1WLRA 4Z7MA 2OAZA 2EVCA 2EVOA 5D6FA 1KQ9A 1R58A 3TB5A 5E5BA 1M35A 1WKMA 2EVMA 3CTZA 5CNXA 3FM3A 1YW9A 3D27A 4RZZA 1YVMA 4IKRA 2P9AA 1YJ3A 2DFIA 2Q8KA 4IF7A 4U75A 1QXWA 2GGCA 1WY2A 2GTXA 2GG9A 4S00A 2Q93A 1BN5A 2GZ5A 4IPAA 3BIQA 2V6CA 3L7GA 1XGMA 2BWTA 4S2RP 5CDLA 5CDVA 2V3YA 2BHDA 2BWWA 4FLKA 5JHUA 2V3XA 1R5HA 3RORA 1WL9A 4RGZ1 4U69A 4ZWUA 4MATA 1YW7A 4U73A 5CIKA 4HXXA 2GG7A 2BWSA 2V3ZA 3Q6DA 3IU9A 4U6ZA 5CE6A 1YW8A 2NQ7A 2EA4A 1KQ0A 4B28A 1QXYA 4S01A 2B3HA 2GG5A 4KM3A 5FCFA 2BWYA 3PKDA 1XGSA 1QZYA 2Q94A 3MR1A 1R5GA 4S2TP 2BWUA 3PKAA 3TAVA 2BHCA 1BOAA 1C22A 3PKCA 2BWVA 4QR8A 3CB6A 1B59A 1XNZA 2NQ6A 5JFRA 1XGOA 1WL6A 1XGNA 4IDYA 1Y1NA 2BHBA 2B3LA 4ZWOA 2GU7A 4IU6A 5D6EA 4FLJA 3S6BA 4U76A 2GU5A 1O0XA 2P99A 3IU8A 5FCHA 4U6CA 4FKCA 4U1BA 2GG2A 2MATA 4ZWPA 1C21A 3MX6A 1WN1A 4A6WA 2P98A 2GA2A 4IKUA 4FLLA 3RVAA 2OKNA 2Q92A 3IU7A
chains in the Genus database with same CATH superfamily
2BH3A 3FMRA 4FUKA 4U71A 4IKSA 5CDEA 4A6VA 3PKEA 2EA2A 2BB7A 4RZYA 4U6WA 4EGEA 1CHMA 1MATA 2BN7A 3L24A 4FO8A 2ADUA 2Q95A 4IECA 4U6JA 2HOWA 4FLIA 1C24A 2GG0A 4IKTA 1WBQA 1W2MA 2BHAA 4R60A 4U70A 3PKBA 2BWXA 2ZSGA 2GG3A 1B6AA 5JI6A 1N51A 3FMQA 1JAWA 3IG4A 1C23A 1KP0A 2B3KA 2G6PA 4ZNGA 1PV9A 1A16A 2GU6A 2GG8A 3MATA 3CB5A 2GGBA 4JUQA 4U6EA 3BITA 2IW2A 3BIPA 2Q96A 4PNCA 4PV4A 5CLSA 2GU4A 1QXZA 1W7VA 4OOKA 4FO7A 1C27A 1WLRA 4Z7MA 2OAZA 2EVCA 2EVOA 5D6FA 1KQ9A 1R58A 3TB5A 5E5BA 1M35A 1WKMA 2EVMA 3CTZA 5CNXA 3FM3A 1YW9A 3D27A 4RZZA 1YVMA 4IKRA 2P9AA 1YJ3A 2DFIA 2Q8KA 4IF7A 4U75A 1QXWA 2GGCA 1WY2A 2GTXA 2GG9A 4S00A 2Q93A 1BN5A 2GZ5A 4IPAA 3BIQA 2V6CA 3L7GA 1XGMA 2BWTA 4S2RP 5CDLA 5CDVA 2V3YA 2BHDA 2BWWA 4FLKA 5JHUA 2V3XA 1R5HA 3RORA 1WL9A 4RGZ1 4U69A 4ZWUA 4MATA 1YW7A 4U73A 5CIKA 4HXXA 2GG7A 2BWSA 2V3ZA 3Q6DA 3IU9A 4U6ZA 5CE6A 1YW8A 2NQ7A 2EA4A 1KQ0A 4B28A 1QXYA 4S01A 2B3HA 2GG5A 4KM3A 5FCFA 2BWYA 3PKDA 1XGSA 1QZYA 2Q94A 3MR1A 1R5GA 4S2TP 2BWUA 3PKAA 3TAVA 2BHCA 1BOAA 1C22A 3PKCA 2BWVA 4QR8A 3CB6A 1B59A 1XNZA 2NQ6A 5JFRA 1XGOA 1WL6A 1XGNA 4IDYA 1Y1NA 2BHBA 2B3LA 4ZWOA 2GU7A 4IU6A 5D6EA 4FLJA 3S6BA 4U76A 2GU5A 1O0XA 2P99A 3IU8A 5FCHA 4U6CA 4FKCA 4U1BA 2GG2A 2MATA 4ZWPA 1C21A 3MX6A 1WN1A 4A6WA 2P98A 2GA2A 4IKUA 4FLLA 3RVAA 2OKNA 2Q92A 3IU7A
chains in the Genus database with same CATH topology
2BH3A 3FMRA 4FUKA 4U71A 4IKSA 5CDEA 4A6VA 3PKEA 2EA2A 2BB7A 4RZYA 4U6WA 4EGEA 1CHMA 1MATA 2BN7A 3L24A 4FO8A 2ADUA 2Q95A 4IECA 4U6JA 2HOWA 4FLIA 1C24A 2GG0A 4IKTA 1WBQA 1W2MA 2BHAA 4R60A 4U70A 3PKBA 2BWXA 2ZSGA 2GG3A 1B6AA 5JI6A 1N51A 3FMQA 1JAWA 3IG4A 1C23A 1KP0A 2B3KA 2G6PA 4ZNGA 1PV9A 1A16A 2GU6A 2GG8A 3MATA 3CB5A 2GGBA 4JUQA 4U6EA 3BITA 2IW2A 3BIPA 2Q96A 4PNCA 4PV4A 5CLSA 2GU4A 1QXZA 1W7VA 4OOKA 4FO7A 1C27A 1WLRA 4Z7MA 2OAZA 2EVCA 2EVOA 5D6FA 1KQ9A 1R58A 3TB5A 5E5BA 1M35A 1WKMA 2EVMA 3CTZA 5CNXA 3FM3A 1YW9A 3D27A 4RZZA 1YVMA 4IKRA 2P9AA 1YJ3A 2DFIA 2Q8KA 4IF7A 4U75A 1QXWA 2GGCA 1WY2A 2GTXA 2GG9A 4S00A 2Q93A 1BN5A 2GZ5A 4IPAA 3BIQA 2V6CA 3L7GA 1XGMA 2BWTA 4S2RP 5CDLA 5CDVA 2V3YA 2BHDA 2BWWA 4FLKA 5JHUA 2V3XA 1R5HA 3RORA 1WL9A 4RGZ1 4U69A 4ZWUA 4MATA 1YW7A 4U73A 5CIKA 4HXXA 2GG7A 2BWSA 2V3ZA 3Q6DA 3IU9A 4U6ZA 5CE6A 1YW8A 2NQ7A 2EA4A 1KQ0A 4B28A 1QXYA 4S01A 2B3HA 2GG5A 4KM3A 5FCFA 2BWYA 3PKDA 1XGSA 1QZYA 2Q94A 3MR1A 1R5GA 4S2TP 2BWUA 3PKAA 3TAVA 2BHCA 1BOAA 1C22A 3PKCA 2BWVA 4QR8A 3CB6A 1B59A 1XNZA 2NQ6A 5JFRA 1XGOA 1WL6A 1XGNA 4IDYA 1Y1NA 2BHBA 2B3LA 4ZWOA 2GU7A 4IU6A 5D6EA 4FLJA 3S6BA 4U76A 2GU5A 1O0XA 2P99A 3IU8A 5FCHA 4U6CA 4FKCA 4U1BA 2GG2A 2MATA 4ZWPA 1C21A 3MX6A 1WN1A 4A6WA 2P98A 2GA2A 4IKUA 4FLLA 3RVAA 2OKNA 2Q92A 3IU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH3 A;  3FMR A;  4FUK A;  4U71 A;  4IKS A;  5CDE A;  4A6V A;  3PKE A;  2EA2 A;  2BB7 A;  4RZY A;  4U6W A;  4EGE A;  1CHM A;  1MAT A;  2BN7 A;  3L24 A;  4FO8 A;  2ADU A;  2Q95 A;  4IEC A;  4U6J A;  2HOW A;  4FLI A;  1C24 A;  2GG0 A;  4IKT A;  1WBQ A;  1W2M A;  2BHA A;  4R60 A;  4U70 A;  3PKB A;  2BWX A;  2ZSG A;  2GG3 A;  1B6A A;  5JI6 A;  1N51 A;  3FMQ A;  1JAW A;  3IG4 A;  1C23 A;  1KP0 A;  2B3K A;  2G6P A;  4ZNG A;  1PV9 A;  1A16 A;  2GU6 A;  2GG8 A;  3MAT A;  3CB5 A;  2GGB A;  4JUQ A;  4U6E A;  3BIT A;  2IW2 A;  3BIP A;  2Q96 A;  4PNC A;  4PV4 A;  5CLS A;  2GU4 A;  1QXZ A;  1W7V A;  4OOK A;  4FO7 A;  1C27 A;  1WLR A;  4Z7M A;  2OAZ A;  2EVC A;  2EVO A;  5D6F A;  1KQ9 A;  1R58 A;  3TB5 A;  5E5B A;  1M35 A;  1WKM A;  2EVM A;  3CTZ A;  5CNX A;  3FM3 A;  1YW9 A;  3D27 A;  4RZZ A;  1YVM A;  4IKR A;  2P9A A;  1YJ3 A;  2DFI A;  2Q8K A;  4IF7 A;  4U75 A;  1QXW A;  2GGC A;  1WY2 A;  2GTX A;  2GG9 A;  4S00 A;  2Q93 A;  1BN5 A;  2GZ5 A;  4IPA A;  3BIQ A;  2V6C A;  3L7G A;  1XGM A;  2BWT A;  4S2R P;  5CDL A;  5CDV A;  2V3Y A;  2BHD A;  2BWW A;  4FLK A;  5JHU A;  2V3X A;  1R5H A;  3ROR A;  1WL9 A;  4RGZ 1;  4U69 A;  4ZWU A;  4MAT A;  1YW7 A;  4U73 A;  5CIK A;  4HXX A;  2GG7 A;  2BWS A;  2V3Z A;  3Q6D A;  3IU9 A;  4U6Z A;  5CE6 A;  1YW8 A;  2NQ7 A;  2EA4 A;  1KQ0 A;  4B28 A;  1QXY A;  4S01 A;  2B3H A;  2GG5 A;  4KM3 A;  5FCF A;  2BWY A;  3PKD A;  1XGS A;  1QZY A;  2Q94 A;  3MR1 A;  1R5G A;  4S2T P;  2BWU A;  3PKA A;  3TAV A;  2BHC A;  1BOA A;  1C22 A;  3PKC A;  2BWV A;  4QR8 A;  3CB6 A;  1B59 A;  1XNZ A;  2NQ6 A;  5JFR A;  1XGO A;  1WL6 A;  1XGN A;  4IDY A;  1Y1N A;  2BHB A;  2B3L A;  4ZWO A;  2GU7 A;  4IU6 A;  5D6E A;  4FLJ A;  3S6B A;  4U76 A;  2GU5 A;  1O0X A;  2P99 A;  3IU8 A;  5FCH A;  4U6C A;  4FKC A;  4U1B A;  2GG2 A;  2MAT A;  4ZWP A;  1C21 A;  3MX6 A;  1WN1 A;  4A6W A;  2P98 A;  2GA2 A;  4IKU A;  4FLL A;  3RVA A;  2OKN A;  2Q92 A;  3IU7 A; 
#chains in the Genus database with same CATH topology
 2BH3 A;  3FMR A;  4FUK A;  4U71 A;  4IKS A;  5CDE A;  4A6V A;  3PKE A;  2EA2 A;  2BB7 A;  4RZY A;  4U6W A;  4EGE A;  1CHM A;  1MAT A;  2BN7 A;  3L24 A;  4FO8 A;  2ADU A;  2Q95 A;  4IEC A;  4U6J A;  2HOW A;  4FLI A;  1C24 A;  2GG0 A;  4IKT A;  1WBQ A;  1W2M A;  2BHA A;  4R60 A;  4U70 A;  3PKB A;  2BWX A;  2ZSG A;  2GG3 A;  1B6A A;  5JI6 A;  1N51 A;  3FMQ A;  1JAW A;  3IG4 A;  1C23 A;  1KP0 A;  2B3K A;  2G6P A;  4ZNG A;  1PV9 A;  1A16 A;  2GU6 A;  2GG8 A;  3MAT A;  3CB5 A;  2GGB A;  4JUQ A;  4U6E A;  3BIT A;  2IW2 A;  3BIP A;  2Q96 A;  4PNC A;  4PV4 A;  5CLS A;  2GU4 A;  1QXZ A;  1W7V A;  4OOK A;  4FO7 A;  1C27 A;  1WLR A;  4Z7M A;  2OAZ A;  2EVC A;  2EVO A;  5D6F A;  1KQ9 A;  1R58 A;  3TB5 A;  5E5B A;  1M35 A;  1WKM A;  2EVM A;  3CTZ A;  5CNX A;  3FM3 A;  1YW9 A;  3D27 A;  4RZZ A;  1YVM A;  4IKR A;  2P9A A;  1YJ3 A;  2DFI A;  2Q8K A;  4IF7 A;  4U75 A;  1QXW A;  2GGC A;  1WY2 A;  2GTX A;  2GG9 A;  4S00 A;  2Q93 A;  1BN5 A;  2GZ5 A;  4IPA A;  3BIQ A;  2V6C A;  3L7G A;  1XGM A;  2BWT A;  4S2R P;  5CDL A;  5CDV A;  2V3Y A;  2BHD A;  2BWW A;  4FLK A;  5JHU A;  2V3X A;  1R5H A;  3ROR A;  1WL9 A;  4RGZ 1;  4U69 A;  4ZWU A;  4MAT A;  1YW7 A;  4U73 A;  5CIK A;  4HXX A;  2GG7 A;  2BWS A;  2V3Z A;  3Q6D A;  3IU9 A;  4U6Z A;  5CE6 A;  1YW8 A;  2NQ7 A;  2EA4 A;  1KQ0 A;  4B28 A;  1QXY A;  4S01 A;  2B3H A;  2GG5 A;  4KM3 A;  5FCF A;  2BWY A;  3PKD A;  1XGS A;  1QZY A;  2Q94 A;  3MR1 A;  1R5G A;  4S2T P;  2BWU A;  3PKA A;  3TAV A;  2BHC A;  1BOA A;  1C22 A;  3PKC A;  2BWV A;  4QR8 A;  3CB6 A;  1B59 A;  1XNZ A;  2NQ6 A;  5JFR A;  1XGO A;  1WL6 A;  1XGN A;  4IDY A;  1Y1N A;  2BHB A;  2B3L A;  4ZWO A;  2GU7 A;  4IU6 A;  5D6E A;  4FLJ A;  3S6B A;  4U76 A;  2GU5 A;  1O0X A;  2P99 A;  3IU8 A;  5FCH A;  4U6C A;  4FKC A;  4U1B A;  2GG2 A;  2MAT A;  4ZWP A;  1C21 A;  3MX6 A;  1WN1 A;  4A6W A;  2P98 A;  2GA2 A;  4IKU A;  4FLL A;  3RVA A;  2OKN A;  2Q92 A;  3IU7 A; 
#chains in the Genus database with same CATH homology
 2BH3 A;  3FMR A;  4FUK A;  4U71 A;  4IKS A;  5CDE A;  4A6V A;  3PKE A;  2EA2 A;  2BB7 A;  4RZY A;  4U6W A;  4EGE A;  1CHM A;  1MAT A;  2BN7 A;  3L24 A;  4FO8 A;  2ADU A;  2Q95 A;  4IEC A;  4U6J A;  2HOW A;  4FLI A;  1C24 A;  2GG0 A;  4IKT A;  1WBQ A;  1W2M A;  2BHA A;  4R60 A;  4U70 A;  3PKB A;  2BWX A;  2ZSG A;  2GG3 A;  1B6A A;  5JI6 A;  1N51 A;  3FMQ A;  1JAW A;  3IG4 A;  1C23 A;  1KP0 A;  2B3K A;  2G6P A;  4ZNG A;  1PV9 A;  1A16 A;  2GU6 A;  2GG8 A;  3MAT A;  3CB5 A;  2GGB A;  4JUQ A;  4U6E A;  3BIT A;  2IW2 A;  3BIP A;  2Q96 A;  4PNC A;  4PV4 A;  5CLS A;  2GU4 A;  1QXZ A;  1W7V A;  4OOK A;  4FO7 A;  1C27 A;  1WLR A;  4Z7M A;  2OAZ A;  2EVC A;  2EVO A;  5D6F A;  1KQ9 A;  1R58 A;  3TB5 A;  5E5B A;  1M35 A;  1WKM A;  2EVM A;  3CTZ A;  5CNX A;  3FM3 A;  1YW9 A;  3D27 A;  4RZZ A;  1YVM A;  4IKR A;  2P9A A;  1YJ3 A;  2DFI A;  2Q8K A;  4IF7 A;  4U75 A;  1QXW A;  2GGC A;  1WY2 A;  2GTX A;  2GG9 A;  4S00 A;  2Q93 A;  1BN5 A;  2GZ5 A;  4IPA A;  3BIQ A;  2V6C A;  3L7G A;  1XGM A;  2BWT A;  4S2R P;  5CDL A;  5CDV A;  2V3Y A;  2BHD A;  2BWW A;  4FLK A;  5JHU A;  2V3X A;  1R5H A;  3ROR A;  1WL9 A;  4RGZ 1;  4U69 A;  4ZWU A;  4MAT A;  1YW7 A;  4U73 A;  5CIK A;  4HXX A;  2GG7 A;  2BWS A;  2V3Z A;  3Q6D A;  3IU9 A;  4U6Z A;  5CE6 A;  1YW8 A;  2NQ7 A;  2EA4 A;  1KQ0 A;  4B28 A;  1QXY A;  4S01 A;  2B3H A;  2GG5 A;  4KM3 A;  5FCF A;  2BWY A;  3PKD A;  1XGS A;  1QZY A;  2Q94 A;  3MR1 A;  1R5G A;  4S2T P;  2BWU A;  3PKA A;  3TAV A;  2BHC A;  1BOA A;  1C22 A;  3PKC A;  2BWV A;  4QR8 A;  3CB6 A;  1B59 A;  1XNZ A;  2NQ6 A;  5JFR A;  1XGO A;  1WL6 A;  1XGN A;  4IDY A;  1Y1N A;  2BHB A;  2B3L A;  4ZWO A;  2GU7 A;  4IU6 A;  5D6E A;  4FLJ A;  3S6B A;  4U76 A;  2GU5 A;  1O0X A;  2P99 A;  3IU8 A;  5FCH A;  4U6C A;  4FKC A;  4U1B A;  2GG2 A;  2MAT A;  4ZWP A;  1C21 A;  3MX6 A;  1WN1 A;  4A6W A;  2P98 A;  2GA2 A;  4IKU A;  4FLL A;  3RVA A;  2OKN A;  2Q92 A;  3IU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...