2P99A

E. coli methionine aminopeptidase monometalated with inhibitor ye6
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
261
structure length
261
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 85
structure length 261
sequence length 261
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p99A00
1C21A 3PKDA 2IW2A 4U6CA 4Z7MA 1XGNA 5FCHA 1C24A 4QR8A 1O0XA 1WL6A 4IKUA 4R60A 2BHBA 5JFRA 4IKTA 3L7GA 2BWTA 1R58A 1XGMA 5CNXA 4ZWUA 2BWWA 2MATA 4HXXA 4U1BA 4FUKA 3FM3A 4ZWPA 4FLKA 2P9AA 1XGSA 2GG9A 3BITA 5CLSA 1A16A 1W7VA 1WN1A 2P98A 1QXWA 2EA2A 1YVMA 4A6WA 4U6EA 1WKMA 2GU4A 5CIKA 2GG2A 2BB7A 2B3KA 1W2MA 2BHAA 2GG5A 4FKCA 4RGZ1 2B3LA 3TAVA 4S2TP 4U6ZA 1R5HA 2G6PA 1WBQA 4U73A 5CDLA 2Q8KA 2EA4A 4ZNGA 1KQ9A 2BWSA 3FMQA 2GU7A 4S00A 5JI6A 2EVOA 2EVMA 4U6WA 3RVAA 1WY2A 2DFIA 4FLIA 2Q92A 2Q93A 4S2RP 3MX6A 1JAWA 1CHMA 2GA2A 1N51A 4U6JA 2EVCA 1M35A 2Q94A 1XNZA 2GG7A 1PV9A 2GG3A 2GU5A 4FLJA 2GG8A 3CB5A 1QXZA 2GGBA 3L24A 2GTXA 2GZ5A 2V3ZA 5D6FA 2BWXA 2NQ6A 4IKSA 4U75A 4IF7A 4FO7A 4JUQA 2B3HA 2V3XA 1KP0A 5CDVA 2ADUA 3BIPA 2GGCA 5D6EA 2BWUA 5CDEA 1QZYA 4IPAA 4ZWOA 4U70A 1XGOA 1WLRA 1YJ3A 1C23A 4B28A 2ZSGA 2HOWA 3IU7A 2BWYA 3BIQA 3PKEA 4OOKA 1QXYA 4U71A 1B59A 3CB6A 4EGEA 2BHDA 4S01A 3IU8A 4FO8A 3IG4A 2NQ7A 4IECA 1C22A 2GG0A 2GU6A 4U76A 1MATA 2OKNA 4IKRA 4PNCA 2OAZA 1R5GA 3PKBA 4KM3A 2BHCA 1YW8A 1WL9A 1BOAA 2Q96A 3PKAA 3TB5A 2BN7A 2BWVA 3FMRA 3RORA 1BN5A 4A6VA 4RZYA 1YW7A 3IU9A 3S6BA 4RZZA 1YW9A 2BH3A 3PKCA 4MATA 5FCFA 4IDYA 3CTZA 2V3YA 4IU6A 2Q95A 1B6AA 1C27A 4FLLA 3MR1A 5CE6A 5JHUA 2P99A 3D27A 4PV4A 4U69A 5E5BA 2V6CA 3Q6DA 1Y1NA 1KQ0A 3MATA
chains in the Genus database with same CATH superfamily
1C21A 3PKDA 2IW2A 4U6CA 4Z7MA 1XGNA 5FCHA 1C24A 4QR8A 1O0XA 1WL6A 4IKUA 4R60A 2BHBA 5JFRA 4IKTA 3L7GA 2BWTA 1R58A 1XGMA 5CNXA 4ZWUA 2BWWA 2MATA 4HXXA 4U1BA 4FUKA 3FM3A 4ZWPA 4FLKA 2P9AA 1XGSA 2GG9A 3BITA 5CLSA 1A16A 1W7VA 1WN1A 2P98A 1QXWA 2EA2A 1YVMA 4A6WA 4U6EA 1WKMA 2GU4A 5CIKA 2GG2A 2BB7A 2B3KA 1W2MA 2BHAA 2GG5A 4FKCA 4RGZ1 2B3LA 3TAVA 4S2TP 4U6ZA 1R5HA 2G6PA 1WBQA 4U73A 5CDLA 2Q8KA 2EA4A 4ZNGA 1KQ9A 2BWSA 3FMQA 2GU7A 4S00A 5JI6A 2EVOA 2EVMA 4U6WA 3RVAA 1WY2A 2DFIA 4FLIA 2Q92A 2Q93A 4S2RP 3MX6A 1JAWA 1CHMA 2GA2A 1N51A 4U6JA 2EVCA 1M35A 2Q94A 1XNZA 2GG7A 1PV9A 2GG3A 2GU5A 4FLJA 2GG8A 3CB5A 1QXZA 2GGBA 3L24A 2GTXA 2GZ5A 2V3ZA 5D6FA 2BWXA 2NQ6A 4IKSA 4U75A 4IF7A 4FO7A 4JUQA 2B3HA 2V3XA 1KP0A 5CDVA 2ADUA 3BIPA 2GGCA 5D6EA 2BWUA 5CDEA 1QZYA 4IPAA 4ZWOA 4U70A 1XGOA 1WLRA 1YJ3A 1C23A 4B28A 2ZSGA 2HOWA 3IU7A 2BWYA 3BIQA 3PKEA 4OOKA 1QXYA 4U71A 1B59A 3CB6A 4EGEA 2BHDA 4S01A 3IU8A 4FO8A 3IG4A 2NQ7A 4IECA 1C22A 2GG0A 2GU6A 4U76A 1MATA 2OKNA 4IKRA 4PNCA 2OAZA 1R5GA 3PKBA 4KM3A 2BHCA 1YW8A 1WL9A 1BOAA 2Q96A 3PKAA 3TB5A 2BN7A 2BWVA 3FMRA 3RORA 1BN5A 4A6VA 4RZYA 1YW7A 3IU9A 3S6BA 4RZZA 1YW9A 2BH3A 3PKCA 4MATA 5FCFA 4IDYA 3CTZA 2V3YA 4IU6A 2Q95A 1B6AA 1C27A 4FLLA 3MR1A 5CE6A 5JHUA 2P99A 3D27A 4PV4A 4U69A 5E5BA 2V6CA 3Q6DA 1Y1NA 1KQ0A 3MATA
chains in the Genus database with same CATH topology
1C21A 3PKDA 2IW2A 4U6CA 4Z7MA 1XGNA 5FCHA 1C24A 4QR8A 1O0XA 1WL6A 4IKUA 4R60A 2BHBA 5JFRA 4IKTA 3L7GA 2BWTA 1R58A 1XGMA 5CNXA 4ZWUA 2BWWA 2MATA 4HXXA 4U1BA 4FUKA 3FM3A 4ZWPA 4FLKA 2P9AA 1XGSA 2GG9A 3BITA 5CLSA 1A16A 1W7VA 1WN1A 2P98A 1QXWA 2EA2A 1YVMA 4A6WA 4U6EA 1WKMA 2GU4A 5CIKA 2GG2A 2BB7A 2B3KA 1W2MA 2BHAA 2GG5A 4FKCA 4RGZ1 2B3LA 3TAVA 4S2TP 4U6ZA 1R5HA 2G6PA 1WBQA 4U73A 5CDLA 2Q8KA 2EA4A 4ZNGA 1KQ9A 2BWSA 3FMQA 2GU7A 4S00A 5JI6A 2EVOA 2EVMA 4U6WA 3RVAA 1WY2A 2DFIA 4FLIA 2Q92A 2Q93A 4S2RP 3MX6A 1JAWA 1CHMA 2GA2A 1N51A 4U6JA 2EVCA 1M35A 2Q94A 1XNZA 2GG7A 1PV9A 2GG3A 2GU5A 4FLJA 2GG8A 3CB5A 1QXZA 2GGBA 3L24A 2GTXA 2GZ5A 2V3ZA 5D6FA 2BWXA 2NQ6A 4IKSA 4U75A 4IF7A 4FO7A 4JUQA 2B3HA 2V3XA 1KP0A 5CDVA 2ADUA 3BIPA 2GGCA 5D6EA 2BWUA 5CDEA 1QZYA 4IPAA 4ZWOA 4U70A 1XGOA 1WLRA 1YJ3A 1C23A 4B28A 2ZSGA 2HOWA 3IU7A 2BWYA 3BIQA 3PKEA 4OOKA 1QXYA 4U71A 1B59A 3CB6A 4EGEA 2BHDA 4S01A 3IU8A 4FO8A 3IG4A 2NQ7A 4IECA 1C22A 2GG0A 2GU6A 4U76A 1MATA 2OKNA 4IKRA 4PNCA 2OAZA 1R5GA 3PKBA 4KM3A 2BHCA 1YW8A 1WL9A 1BOAA 2Q96A 3PKAA 3TB5A 2BN7A 2BWVA 3FMRA 3RORA 1BN5A 4A6VA 4RZYA 1YW7A 3IU9A 3S6BA 4RZZA 1YW9A 2BH3A 3PKCA 4MATA 5FCFA 4IDYA 3CTZA 2V3YA 4IU6A 2Q95A 1B6AA 1C27A 4FLLA 3MR1A 5CE6A 5JHUA 2P99A 3D27A 4PV4A 4U69A 5E5BA 2V6CA 3Q6DA 1Y1NA 1KQ0A 3MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C21 A;  3PKD A;  2IW2 A;  4U6C A;  4Z7M A;  1XGN A;  5FCH A;  1C24 A;  4QR8 A;  1O0X A;  1WL6 A;  4IKU A;  4R60 A;  2BHB A;  5JFR A;  4IKT A;  3L7G A;  2BWT A;  1R58 A;  1XGM A;  5CNX A;  4ZWU A;  2BWW A;  2MAT A;  4HXX A;  4U1B A;  4FUK A;  3FM3 A;  4ZWP A;  4FLK A;  2P9A A;  1XGS A;  2GG9 A;  3BIT A;  5CLS A;  1A16 A;  1W7V A;  1WN1 A;  2P98 A;  1QXW A;  2EA2 A;  1YVM A;  4A6W A;  4U6E A;  1WKM A;  2GU4 A;  5CIK A;  2GG2 A;  2BB7 A;  2B3K A;  1W2M A;  2BHA A;  2GG5 A;  4FKC A;  4RGZ 1;  2B3L A;  3TAV A;  4S2T P;  4U6Z A;  1R5H A;  2G6P A;  1WBQ A;  4U73 A;  5CDL A;  2Q8K A;  2EA4 A;  4ZNG A;  1KQ9 A;  2BWS A;  3FMQ A;  2GU7 A;  4S00 A;  5JI6 A;  2EVO A;  2EVM A;  4U6W A;  3RVA A;  1WY2 A;  2DFI A;  4FLI A;  2Q92 A;  2Q93 A;  4S2R P;  3MX6 A;  1JAW A;  1CHM A;  2GA2 A;  1N51 A;  4U6J A;  2EVC A;  1M35 A;  2Q94 A;  1XNZ A;  2GG7 A;  1PV9 A;  2GG3 A;  2GU5 A;  4FLJ A;  2GG8 A;  3CB5 A;  1QXZ A;  2GGB A;  3L24 A;  2GTX A;  2GZ5 A;  2V3Z A;  5D6F A;  2BWX A;  2NQ6 A;  4IKS A;  4U75 A;  4IF7 A;  4FO7 A;  4JUQ A;  2B3H A;  2V3X A;  1KP0 A;  5CDV A;  2ADU A;  3BIP A;  2GGC A;  5D6E A;  2BWU A;  5CDE A;  1QZY A;  4IPA A;  4ZWO A;  4U70 A;  1XGO A;  1WLR A;  1YJ3 A;  1C23 A;  4B28 A;  2ZSG A;  2HOW A;  3IU7 A;  2BWY A;  3BIQ A;  3PKE A;  4OOK A;  1QXY A;  4U71 A;  1B59 A;  3CB6 A;  4EGE A;  2BHD A;  4S01 A;  3IU8 A;  4FO8 A;  3IG4 A;  2NQ7 A;  4IEC A;  1C22 A;  2GG0 A;  2GU6 A;  4U76 A;  1MAT A;  2OKN A;  4IKR A;  4PNC A;  2OAZ A;  1R5G A;  3PKB A;  4KM3 A;  2BHC A;  1YW8 A;  1WL9 A;  1BOA A;  2Q96 A;  3PKA A;  3TB5 A;  2BN7 A;  2BWV A;  3FMR A;  3ROR A;  1BN5 A;  4A6V A;  4RZY A;  1YW7 A;  3IU9 A;  3S6B A;  4RZZ A;  1YW9 A;  2BH3 A;  3PKC A;  4MAT A;  5FCF A;  4IDY A;  3CTZ A;  2V3Y A;  4IU6 A;  2Q95 A;  1B6A A;  1C27 A;  4FLL A;  3MR1 A;  5CE6 A;  5JHU A;  2P99 A;  3D27 A;  4PV4 A;  4U69 A;  5E5B A;  2V6C A;  3Q6D A;  1Y1N A;  1KQ0 A;  3MAT A; 
#chains in the Genus database with same CATH topology
 1C21 A;  3PKD A;  2IW2 A;  4U6C A;  4Z7M A;  1XGN A;  5FCH A;  1C24 A;  4QR8 A;  1O0X A;  1WL6 A;  4IKU A;  4R60 A;  2BHB A;  5JFR A;  4IKT A;  3L7G A;  2BWT A;  1R58 A;  1XGM A;  5CNX A;  4ZWU A;  2BWW A;  2MAT A;  4HXX A;  4U1B A;  4FUK A;  3FM3 A;  4ZWP A;  4FLK A;  2P9A A;  1XGS A;  2GG9 A;  3BIT A;  5CLS A;  1A16 A;  1W7V A;  1WN1 A;  2P98 A;  1QXW A;  2EA2 A;  1YVM A;  4A6W A;  4U6E A;  1WKM A;  2GU4 A;  5CIK A;  2GG2 A;  2BB7 A;  2B3K A;  1W2M A;  2BHA A;  2GG5 A;  4FKC A;  4RGZ 1;  2B3L A;  3TAV A;  4S2T P;  4U6Z A;  1R5H A;  2G6P A;  1WBQ A;  4U73 A;  5CDL A;  2Q8K A;  2EA4 A;  4ZNG A;  1KQ9 A;  2BWS A;  3FMQ A;  2GU7 A;  4S00 A;  5JI6 A;  2EVO A;  2EVM A;  4U6W A;  3RVA A;  1WY2 A;  2DFI A;  4FLI A;  2Q92 A;  2Q93 A;  4S2R P;  3MX6 A;  1JAW A;  1CHM A;  2GA2 A;  1N51 A;  4U6J A;  2EVC A;  1M35 A;  2Q94 A;  1XNZ A;  2GG7 A;  1PV9 A;  2GG3 A;  2GU5 A;  4FLJ A;  2GG8 A;  3CB5 A;  1QXZ A;  2GGB A;  3L24 A;  2GTX A;  2GZ5 A;  2V3Z A;  5D6F A;  2BWX A;  2NQ6 A;  4IKS A;  4U75 A;  4IF7 A;  4FO7 A;  4JUQ A;  2B3H A;  2V3X A;  1KP0 A;  5CDV A;  2ADU A;  3BIP A;  2GGC A;  5D6E A;  2BWU A;  5CDE A;  1QZY A;  4IPA A;  4ZWO A;  4U70 A;  1XGO A;  1WLR A;  1YJ3 A;  1C23 A;  4B28 A;  2ZSG A;  2HOW A;  3IU7 A;  2BWY A;  3BIQ A;  3PKE A;  4OOK A;  1QXY A;  4U71 A;  1B59 A;  3CB6 A;  4EGE A;  2BHD A;  4S01 A;  3IU8 A;  4FO8 A;  3IG4 A;  2NQ7 A;  4IEC A;  1C22 A;  2GG0 A;  2GU6 A;  4U76 A;  1MAT A;  2OKN A;  4IKR A;  4PNC A;  2OAZ A;  1R5G A;  3PKB A;  4KM3 A;  2BHC A;  1YW8 A;  1WL9 A;  1BOA A;  2Q96 A;  3PKA A;  3TB5 A;  2BN7 A;  2BWV A;  3FMR A;  3ROR A;  1BN5 A;  4A6V A;  4RZY A;  1YW7 A;  3IU9 A;  3S6B A;  4RZZ A;  1YW9 A;  2BH3 A;  3PKC A;  4MAT A;  5FCF A;  4IDY A;  3CTZ A;  2V3Y A;  4IU6 A;  2Q95 A;  1B6A A;  1C27 A;  4FLL A;  3MR1 A;  5CE6 A;  5JHU A;  2P99 A;  3D27 A;  4PV4 A;  4U69 A;  5E5B A;  2V6C A;  3Q6D A;  1Y1N A;  1KQ0 A;  3MAT A; 
#chains in the Genus database with same CATH homology
 1C21 A;  3PKD A;  2IW2 A;  4U6C A;  4Z7M A;  1XGN A;  5FCH A;  1C24 A;  4QR8 A;  1O0X A;  1WL6 A;  4IKU A;  4R60 A;  2BHB A;  5JFR A;  4IKT A;  3L7G A;  2BWT A;  1R58 A;  1XGM A;  5CNX A;  4ZWU A;  2BWW A;  2MAT A;  4HXX A;  4U1B A;  4FUK A;  3FM3 A;  4ZWP A;  4FLK A;  2P9A A;  1XGS A;  2GG9 A;  3BIT A;  5CLS A;  1A16 A;  1W7V A;  1WN1 A;  2P98 A;  1QXW A;  2EA2 A;  1YVM A;  4A6W A;  4U6E A;  1WKM A;  2GU4 A;  5CIK A;  2GG2 A;  2BB7 A;  2B3K A;  1W2M A;  2BHA A;  2GG5 A;  4FKC A;  4RGZ 1;  2B3L A;  3TAV A;  4S2T P;  4U6Z A;  1R5H A;  2G6P A;  1WBQ A;  4U73 A;  5CDL A;  2Q8K A;  2EA4 A;  4ZNG A;  1KQ9 A;  2BWS A;  3FMQ A;  2GU7 A;  4S00 A;  5JI6 A;  2EVO A;  2EVM A;  4U6W A;  3RVA A;  1WY2 A;  2DFI A;  4FLI A;  2Q92 A;  2Q93 A;  4S2R P;  3MX6 A;  1JAW A;  1CHM A;  2GA2 A;  1N51 A;  4U6J A;  2EVC A;  1M35 A;  2Q94 A;  1XNZ A;  2GG7 A;  1PV9 A;  2GG3 A;  2GU5 A;  4FLJ A;  2GG8 A;  3CB5 A;  1QXZ A;  2GGB A;  3L24 A;  2GTX A;  2GZ5 A;  2V3Z A;  5D6F A;  2BWX A;  2NQ6 A;  4IKS A;  4U75 A;  4IF7 A;  4FO7 A;  4JUQ A;  2B3H A;  2V3X A;  1KP0 A;  5CDV A;  2ADU A;  3BIP A;  2GGC A;  5D6E A;  2BWU A;  5CDE A;  1QZY A;  4IPA A;  4ZWO A;  4U70 A;  1XGO A;  1WLR A;  1YJ3 A;  1C23 A;  4B28 A;  2ZSG A;  2HOW A;  3IU7 A;  2BWY A;  3BIQ A;  3PKE A;  4OOK A;  1QXY A;  4U71 A;  1B59 A;  3CB6 A;  4EGE A;  2BHD A;  4S01 A;  3IU8 A;  4FO8 A;  3IG4 A;  2NQ7 A;  4IEC A;  1C22 A;  2GG0 A;  2GU6 A;  4U76 A;  1MAT A;  2OKN A;  4IKR A;  4PNC A;  2OAZ A;  1R5G A;  3PKB A;  4KM3 A;  2BHC A;  1YW8 A;  1WL9 A;  1BOA A;  2Q96 A;  3PKA A;  3TB5 A;  2BN7 A;  2BWV A;  3FMR A;  3ROR A;  1BN5 A;  4A6V A;  4RZY A;  1YW7 A;  3IU9 A;  3S6B A;  4RZZ A;  1YW9 A;  2BH3 A;  3PKC A;  4MAT A;  5FCF A;  4IDY A;  3CTZ A;  2V3Y A;  4IU6 A;  2Q95 A;  1B6A A;  1C27 A;  4FLL A;  3MR1 A;  5CE6 A;  5JHU A;  2P99 A;  3D27 A;  4PV4 A;  4U69 A;  5E5B A;  2V6C A;  3Q6D A;  1Y1N A;  1KQ0 A;  3MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...