2P99A

E. coli methionine aminopeptidase monometalated with inhibitor ye6
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
261
structure length
261
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 85
structure length 261
sequence length 261
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p99A00
4ZWUA 1CHMA 2BHCA 3BIPA 5CLSA 2G6PA 2EA4A 2GA2A 5CDVA 2GG2A 4FLKA 3MR1A 1C24A 3BITA 1BN5A 1KP0A 3PKBA 4U76A 1O0XA 4FLIA 4EGEA 4IPAA 4ZWPA 2HOWA 1R5HA 3IU8A 3IU9A 1QXWA 2GG5A 4IKUA 3CB6A 3FM3A 2V3YA 5CNXA 2BWYA 1YW7A 1YVMA 4S01A 2BN7A 3L7GA 4HXXA 2GU5A 2Q8KA 4IKSA 5FCFA 1YJ3A 1WLRA 3PKAA 1XNZA 4S00A 4RGZ1 1MATA 2B3KA 4S2RP 2BWXA 2B3HA 2GU4A 4IECA 1WY2A 4FKCA 4U6EA 4A6WA 5CE6A 4JUQA 3PKCA 4S2TP 3IU7A 1W2MA 1WL9A 5JHUA 2MATA 4IKTA 4QR8A 4U71A 1KQ0A 2GU6A 1R5GA 5FCHA 2BWWA 3L24A 2BHAA 2P98A 1C23A 4A6VA 1QXZA 3PKEA 5D6EA 1WN1A 2V6CA 2P99A 4U70A 1A16A 5E5BA 3Q6DA 2GZ5A 4U1BA 1XGOA 3MATA 3S6BA 4RZZA 4RZYA 2NQ6A 4U75A 2BWSA 2Q95A 3CTZA 3D27A 2EVCA 4ZNGA 4U6WA 2OKNA 4IKRA 1XGMA 2Q92A 1R58A 4U73A 1B59A 4B28A 1YW9A 3PKDA 1WKMA 2EVMA 2GG3A 2BH3A 2Q96A 1M35A 2GU7A 1C21A 3FMQA 4PNCA 2ADUA 4MATA 4U6ZA 5CIKA 2ZSGA 4FUKA 2BWUA 2BWVA 2BHBA 2GGCA 1WL6A 4IU6A 4FO8A 2OAZA 1PV9A 4U69A 1C22A 5CDEA 2BB7A 4FO7A 1BOAA 4OOKA 4ZWOA 2GTXA 1C27A 1N51A 1QXYA 2BHDA 3FMRA 4KM3A 5D6FA 3RVAA 4IDYA 2GG7A 3TAVA 4IF7A 1QZYA 2Q93A 2EVOA 2GG0A 3IG4A 3MX6A 5JI6A 2NQ7A 1WBQA 2GG9A 4R60A 3RORA 2V3ZA 1W7VA 3TB5A 4PV4A 2GGBA 3BIQA 2P9AA 4U6CA 1JAWA 1Y1NA 1B6AA 2IW2A 5JFRA 4Z7MA 2EA2A 1KQ9A 2V3XA 2B3LA 2BWTA 1YW8A 2GG8A 4FLJA 2DFIA 4U6JA 3CB5A 4FLLA 1XGNA 2Q94A 1XGSA 5CDLA
chains in the Genus database with same CATH superfamily
4ZWUA 1CHMA 2BHCA 3BIPA 5CLSA 2G6PA 2EA4A 2GA2A 5CDVA 2GG2A 4FLKA 3MR1A 1C24A 3BITA 1BN5A 1KP0A 3PKBA 4U76A 1O0XA 4FLIA 4EGEA 4IPAA 4ZWPA 2HOWA 1R5HA 3IU8A 3IU9A 1QXWA 2GG5A 4IKUA 3CB6A 3FM3A 2V3YA 5CNXA 2BWYA 1YW7A 1YVMA 4S01A 2BN7A 3L7GA 4HXXA 2GU5A 2Q8KA 4IKSA 5FCFA 1YJ3A 1WLRA 3PKAA 1XNZA 4S00A 4RGZ1 1MATA 2B3KA 4S2RP 2BWXA 2B3HA 2GU4A 4IECA 1WY2A 4FKCA 4U6EA 4A6WA 5CE6A 4JUQA 3PKCA 4S2TP 3IU7A 1W2MA 1WL9A 5JHUA 2MATA 4IKTA 4QR8A 4U71A 1KQ0A 2GU6A 1R5GA 5FCHA 2BWWA 3L24A 2BHAA 2P98A 1C23A 4A6VA 1QXZA 3PKEA 5D6EA 1WN1A 2V6CA 2P99A 4U70A 1A16A 5E5BA 3Q6DA 2GZ5A 4U1BA 1XGOA 3MATA 3S6BA 4RZZA 4RZYA 2NQ6A 4U75A 2BWSA 2Q95A 3CTZA 3D27A 2EVCA 4ZNGA 4U6WA 2OKNA 4IKRA 1XGMA 2Q92A 1R58A 4U73A 1B59A 4B28A 1YW9A 3PKDA 1WKMA 2EVMA 2GG3A 2BH3A 2Q96A 1M35A 2GU7A 1C21A 3FMQA 4PNCA 2ADUA 4MATA 4U6ZA 5CIKA 2ZSGA 4FUKA 2BWUA 2BWVA 2BHBA 2GGCA 1WL6A 4IU6A 4FO8A 2OAZA 1PV9A 4U69A 1C22A 5CDEA 2BB7A 4FO7A 1BOAA 4OOKA 4ZWOA 2GTXA 1C27A 1N51A 1QXYA 2BHDA 3FMRA 4KM3A 5D6FA 3RVAA 4IDYA 2GG7A 3TAVA 4IF7A 1QZYA 2Q93A 2EVOA 2GG0A 3IG4A 3MX6A 5JI6A 2NQ7A 1WBQA 2GG9A 4R60A 3RORA 2V3ZA 1W7VA 3TB5A 4PV4A 2GGBA 3BIQA 2P9AA 4U6CA 1JAWA 1Y1NA 1B6AA 2IW2A 5JFRA 4Z7MA 2EA2A 1KQ9A 2V3XA 2B3LA 2BWTA 1YW8A 2GG8A 4FLJA 2DFIA 4U6JA 3CB5A 4FLLA 1XGNA 2Q94A 1XGSA 5CDLA
chains in the Genus database with same CATH topology
4ZWUA 1CHMA 2BHCA 3BIPA 5CLSA 2G6PA 2EA4A 2GA2A 5CDVA 2GG2A 4FLKA 3MR1A 1C24A 3BITA 1BN5A 1KP0A 3PKBA 4U76A 1O0XA 4FLIA 4EGEA 4IPAA 4ZWPA 2HOWA 1R5HA 3IU8A 3IU9A 1QXWA 2GG5A 4IKUA 3CB6A 3FM3A 2V3YA 5CNXA 2BWYA 1YW7A 1YVMA 4S01A 2BN7A 3L7GA 4HXXA 2GU5A 2Q8KA 4IKSA 5FCFA 1YJ3A 1WLRA 3PKAA 1XNZA 4S00A 4RGZ1 1MATA 2B3KA 4S2RP 2BWXA 2B3HA 2GU4A 4IECA 1WY2A 4FKCA 4U6EA 4A6WA 5CE6A 4JUQA 3PKCA 4S2TP 3IU7A 1W2MA 1WL9A 5JHUA 2MATA 4IKTA 4QR8A 4U71A 1KQ0A 2GU6A 1R5GA 5FCHA 2BWWA 3L24A 2BHAA 2P98A 1C23A 4A6VA 1QXZA 3PKEA 5D6EA 1WN1A 2V6CA 2P99A 4U70A 1A16A 5E5BA 3Q6DA 2GZ5A 4U1BA 1XGOA 3MATA 3S6BA 4RZZA 4RZYA 2NQ6A 4U75A 2BWSA 2Q95A 3CTZA 3D27A 2EVCA 4ZNGA 4U6WA 2OKNA 4IKRA 1XGMA 2Q92A 1R58A 4U73A 1B59A 4B28A 1YW9A 3PKDA 1WKMA 2EVMA 2GG3A 2BH3A 2Q96A 1M35A 2GU7A 1C21A 3FMQA 4PNCA 2ADUA 4MATA 4U6ZA 5CIKA 2ZSGA 4FUKA 2BWUA 2BWVA 2BHBA 2GGCA 1WL6A 4IU6A 4FO8A 2OAZA 1PV9A 4U69A 1C22A 5CDEA 2BB7A 4FO7A 1BOAA 4OOKA 4ZWOA 2GTXA 1C27A 1N51A 1QXYA 2BHDA 3FMRA 4KM3A 5D6FA 3RVAA 4IDYA 2GG7A 3TAVA 4IF7A 1QZYA 2Q93A 2EVOA 2GG0A 3IG4A 3MX6A 5JI6A 2NQ7A 1WBQA 2GG9A 4R60A 3RORA 2V3ZA 1W7VA 3TB5A 4PV4A 2GGBA 3BIQA 2P9AA 4U6CA 1JAWA 1Y1NA 1B6AA 2IW2A 5JFRA 4Z7MA 2EA2A 1KQ9A 2V3XA 2B3LA 2BWTA 1YW8A 2GG8A 4FLJA 2DFIA 4U6JA 3CB5A 4FLLA 1XGNA 2Q94A 1XGSA 5CDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWU A;  1CHM A;  2BHC A;  3BIP A;  5CLS A;  2G6P A;  2EA4 A;  2GA2 A;  5CDV A;  2GG2 A;  4FLK A;  3MR1 A;  1C24 A;  3BIT A;  1BN5 A;  1KP0 A;  3PKB A;  4U76 A;  1O0X A;  4FLI A;  4EGE A;  4IPA A;  4ZWP A;  2HOW A;  1R5H A;  3IU8 A;  3IU9 A;  1QXW A;  2GG5 A;  4IKU A;  3CB6 A;  3FM3 A;  2V3Y A;  5CNX A;  2BWY A;  1YW7 A;  1YVM A;  4S01 A;  2BN7 A;  3L7G A;  4HXX A;  2GU5 A;  2Q8K A;  4IKS A;  5FCF A;  1YJ3 A;  1WLR A;  3PKA A;  1XNZ A;  4S00 A;  4RGZ 1;  1MAT A;  2B3K A;  4S2R P;  2BWX A;  2B3H A;  2GU4 A;  4IEC A;  1WY2 A;  4FKC A;  4U6E A;  4A6W A;  5CE6 A;  4JUQ A;  3PKC A;  4S2T P;  3IU7 A;  1W2M A;  1WL9 A;  5JHU A;  2MAT A;  4IKT A;  4QR8 A;  4U71 A;  1KQ0 A;  2GU6 A;  1R5G A;  5FCH A;  2BWW A;  3L24 A;  2BHA A;  2P98 A;  1C23 A;  4A6V A;  1QXZ A;  3PKE A;  5D6E A;  1WN1 A;  2V6C A;  2P99 A;  4U70 A;  1A16 A;  5E5B A;  3Q6D A;  2GZ5 A;  4U1B A;  1XGO A;  3MAT A;  3S6B A;  4RZZ A;  4RZY A;  2NQ6 A;  4U75 A;  2BWS A;  2Q95 A;  3CTZ A;  3D27 A;  2EVC A;  4ZNG A;  4U6W A;  2OKN A;  4IKR A;  1XGM A;  2Q92 A;  1R58 A;  4U73 A;  1B59 A;  4B28 A;  1YW9 A;  3PKD A;  1WKM A;  2EVM A;  2GG3 A;  2BH3 A;  2Q96 A;  1M35 A;  2GU7 A;  1C21 A;  3FMQ A;  4PNC A;  2ADU A;  4MAT A;  4U6Z A;  5CIK A;  2ZSG A;  4FUK A;  2BWU A;  2BWV A;  2BHB A;  2GGC A;  1WL6 A;  4IU6 A;  4FO8 A;  2OAZ A;  1PV9 A;  4U69 A;  1C22 A;  5CDE A;  2BB7 A;  4FO7 A;  1BOA A;  4OOK A;  4ZWO A;  2GTX A;  1C27 A;  1N51 A;  1QXY A;  2BHD A;  3FMR A;  4KM3 A;  5D6F A;  3RVA A;  4IDY A;  2GG7 A;  3TAV A;  4IF7 A;  1QZY A;  2Q93 A;  2EVO A;  2GG0 A;  3IG4 A;  3MX6 A;  5JI6 A;  2NQ7 A;  1WBQ A;  2GG9 A;  4R60 A;  3ROR A;  2V3Z A;  1W7V A;  3TB5 A;  4PV4 A;  2GGB A;  3BIQ A;  2P9A A;  4U6C A;  1JAW A;  1Y1N A;  1B6A A;  2IW2 A;  5JFR A;  4Z7M A;  2EA2 A;  1KQ9 A;  2V3X A;  2B3L A;  2BWT A;  1YW8 A;  2GG8 A;  4FLJ A;  2DFI A;  4U6J A;  3CB5 A;  4FLL A;  1XGN A;  2Q94 A;  1XGS A;  5CDL A; 
#chains in the Genus database with same CATH topology
 4ZWU A;  1CHM A;  2BHC A;  3BIP A;  5CLS A;  2G6P A;  2EA4 A;  2GA2 A;  5CDV A;  2GG2 A;  4FLK A;  3MR1 A;  1C24 A;  3BIT A;  1BN5 A;  1KP0 A;  3PKB A;  4U76 A;  1O0X A;  4FLI A;  4EGE A;  4IPA A;  4ZWP A;  2HOW A;  1R5H A;  3IU8 A;  3IU9 A;  1QXW A;  2GG5 A;  4IKU A;  3CB6 A;  3FM3 A;  2V3Y A;  5CNX A;  2BWY A;  1YW7 A;  1YVM A;  4S01 A;  2BN7 A;  3L7G A;  4HXX A;  2GU5 A;  2Q8K A;  4IKS A;  5FCF A;  1YJ3 A;  1WLR A;  3PKA A;  1XNZ A;  4S00 A;  4RGZ 1;  1MAT A;  2B3K A;  4S2R P;  2BWX A;  2B3H A;  2GU4 A;  4IEC A;  1WY2 A;  4FKC A;  4U6E A;  4A6W A;  5CE6 A;  4JUQ A;  3PKC A;  4S2T P;  3IU7 A;  1W2M A;  1WL9 A;  5JHU A;  2MAT A;  4IKT A;  4QR8 A;  4U71 A;  1KQ0 A;  2GU6 A;  1R5G A;  5FCH A;  2BWW A;  3L24 A;  2BHA A;  2P98 A;  1C23 A;  4A6V A;  1QXZ A;  3PKE A;  5D6E A;  1WN1 A;  2V6C A;  2P99 A;  4U70 A;  1A16 A;  5E5B A;  3Q6D A;  2GZ5 A;  4U1B A;  1XGO A;  3MAT A;  3S6B A;  4RZZ A;  4RZY A;  2NQ6 A;  4U75 A;  2BWS A;  2Q95 A;  3CTZ A;  3D27 A;  2EVC A;  4ZNG A;  4U6W A;  2OKN A;  4IKR A;  1XGM A;  2Q92 A;  1R58 A;  4U73 A;  1B59 A;  4B28 A;  1YW9 A;  3PKD A;  1WKM A;  2EVM A;  2GG3 A;  2BH3 A;  2Q96 A;  1M35 A;  2GU7 A;  1C21 A;  3FMQ A;  4PNC A;  2ADU A;  4MAT A;  4U6Z A;  5CIK A;  2ZSG A;  4FUK A;  2BWU A;  2BWV A;  2BHB A;  2GGC A;  1WL6 A;  4IU6 A;  4FO8 A;  2OAZ A;  1PV9 A;  4U69 A;  1C22 A;  5CDE A;  2BB7 A;  4FO7 A;  1BOA A;  4OOK A;  4ZWO A;  2GTX A;  1C27 A;  1N51 A;  1QXY A;  2BHD A;  3FMR A;  4KM3 A;  5D6F A;  3RVA A;  4IDY A;  2GG7 A;  3TAV A;  4IF7 A;  1QZY A;  2Q93 A;  2EVO A;  2GG0 A;  3IG4 A;  3MX6 A;  5JI6 A;  2NQ7 A;  1WBQ A;  2GG9 A;  4R60 A;  3ROR A;  2V3Z A;  1W7V A;  3TB5 A;  4PV4 A;  2GGB A;  3BIQ A;  2P9A A;  4U6C A;  1JAW A;  1Y1N A;  1B6A A;  2IW2 A;  5JFR A;  4Z7M A;  2EA2 A;  1KQ9 A;  2V3X A;  2B3L A;  2BWT A;  1YW8 A;  2GG8 A;  4FLJ A;  2DFI A;  4U6J A;  3CB5 A;  4FLL A;  1XGN A;  2Q94 A;  1XGS A;  5CDL A; 
#chains in the Genus database with same CATH homology
 4ZWU A;  1CHM A;  2BHC A;  3BIP A;  5CLS A;  2G6P A;  2EA4 A;  2GA2 A;  5CDV A;  2GG2 A;  4FLK A;  3MR1 A;  1C24 A;  3BIT A;  1BN5 A;  1KP0 A;  3PKB A;  4U76 A;  1O0X A;  4FLI A;  4EGE A;  4IPA A;  4ZWP A;  2HOW A;  1R5H A;  3IU8 A;  3IU9 A;  1QXW A;  2GG5 A;  4IKU A;  3CB6 A;  3FM3 A;  2V3Y A;  5CNX A;  2BWY A;  1YW7 A;  1YVM A;  4S01 A;  2BN7 A;  3L7G A;  4HXX A;  2GU5 A;  2Q8K A;  4IKS A;  5FCF A;  1YJ3 A;  1WLR A;  3PKA A;  1XNZ A;  4S00 A;  4RGZ 1;  1MAT A;  2B3K A;  4S2R P;  2BWX A;  2B3H A;  2GU4 A;  4IEC A;  1WY2 A;  4FKC A;  4U6E A;  4A6W A;  5CE6 A;  4JUQ A;  3PKC A;  4S2T P;  3IU7 A;  1W2M A;  1WL9 A;  5JHU A;  2MAT A;  4IKT A;  4QR8 A;  4U71 A;  1KQ0 A;  2GU6 A;  1R5G A;  5FCH A;  2BWW A;  3L24 A;  2BHA A;  2P98 A;  1C23 A;  4A6V A;  1QXZ A;  3PKE A;  5D6E A;  1WN1 A;  2V6C A;  2P99 A;  4U70 A;  1A16 A;  5E5B A;  3Q6D A;  2GZ5 A;  4U1B A;  1XGO A;  3MAT A;  3S6B A;  4RZZ A;  4RZY A;  2NQ6 A;  4U75 A;  2BWS A;  2Q95 A;  3CTZ A;  3D27 A;  2EVC A;  4ZNG A;  4U6W A;  2OKN A;  4IKR A;  1XGM A;  2Q92 A;  1R58 A;  4U73 A;  1B59 A;  4B28 A;  1YW9 A;  3PKD A;  1WKM A;  2EVM A;  2GG3 A;  2BH3 A;  2Q96 A;  1M35 A;  2GU7 A;  1C21 A;  3FMQ A;  4PNC A;  2ADU A;  4MAT A;  4U6Z A;  5CIK A;  2ZSG A;  4FUK A;  2BWU A;  2BWV A;  2BHB A;  2GGC A;  1WL6 A;  4IU6 A;  4FO8 A;  2OAZ A;  1PV9 A;  4U69 A;  1C22 A;  5CDE A;  2BB7 A;  4FO7 A;  1BOA A;  4OOK A;  4ZWO A;  2GTX A;  1C27 A;  1N51 A;  1QXY A;  2BHD A;  3FMR A;  4KM3 A;  5D6F A;  3RVA A;  4IDY A;  2GG7 A;  3TAV A;  4IF7 A;  1QZY A;  2Q93 A;  2EVO A;  2GG0 A;  3IG4 A;  3MX6 A;  5JI6 A;  2NQ7 A;  1WBQ A;  2GG9 A;  4R60 A;  3ROR A;  2V3Z A;  1W7V A;  3TB5 A;  4PV4 A;  2GGB A;  3BIQ A;  2P9A A;  4U6C A;  1JAW A;  1Y1N A;  1B6A A;  2IW2 A;  5JFR A;  4Z7M A;  2EA2 A;  1KQ9 A;  2V3X A;  2B3L A;  2BWT A;  1YW8 A;  2GG8 A;  4FLJ A;  2DFI A;  4U6J A;  3CB5 A;  4FLL A;  1XGN A;  2Q94 A;  1XGS A;  5CDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...