2P99A

E. coli methionine aminopeptidase monometalated with inhibitor ye6
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
261
structure length
261
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 85
structure length 261
sequence length 261
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p99A00
2EA4A 2BWTA 2Q95A 1R58A 2B3LA 2GG8A 5CNXA 2GGCA 1WL9A 2Q96A 2GA2A 1QXYA 4U73A 3PKDA 2V3YA 1A16A 4S2TP 4ZWPA 4FLIA 3CB6A 1C23A 4PV4A 2V3XA 4ZWOA 1W7VA 2BHBA 3MATA 4U71A 2GU7A 2GG9A 1KP0A 2GZ5A 1C22A 4FUKA 2GG7A 1JAWA 2B3HA 1XGSA 4HXXA 2ADUA 4Z7MA 3BIPA 4ZNGA 4RZZA 2V3ZA 4RGZ1 2GU4A 4U6CA 1WN1A 2GG2A 3PKEA 2GG3A 1KQ0A 4A6WA 5E5BA 1R5HA 3D27A 2P98A 4IKTA 1MATA 2G6PA 4MATA 2BWSA 3Q6DA 2BHDA 4FLJA 5CIKA 3TB5A 2IW2A 2BHAA 2BWXA 4FLKA 4FKCA 3PKBA 4FO8A 2OKNA 1C21A 1XGOA 1CHMA 2OAZA 4U1BA 1KQ9A 1Y1NA 3L7GA 1BN5A 4FLLA 5CDLA 4QR8A 4RZYA 1WBQA 3FMQA 2EVCA 2GU5A 1W2MA 2BHCA 3FMRA 4S00A 1WY2A 5D6FA 4B28A 4IKUA 4PNCA 3RVAA 4U6WA 3S6BA 3TAVA 1QZYA 2BWYA 4U76A 2EVMA 3RORA 2Q8KA 4A6VA 2GGBA 2NQ7A 4S01A 2BB7A 5D6EA 1WL6A 2BWWA 3L24A 1N51A 3MR1A 4IU6A 1PV9A 4U70A 2BWUA 5CDEA 1C24A 3PKCA 2P9AA 4U75A 1XNZA 5CLSA 4IECA 3IU7A 3IU9A 4OOKA 1QXZA 4IDYA 4U6JA 2P99A 4ZWUA 2ZSGA 5CDVA 1M35A 4IKSA 2EA2A 1C27A 1QXWA 2BN7A 1XGNA 2GTXA 2EVOA 3CB5A 1BOAA 4IKRA 4S2RP 1WKMA 4IPAA 1YW7A 4IF7A 4JUQA 2MATA 2GG5A 2DFIA 3IG4A 4EGEA 1WLRA 2HOWA 2V6CA 4U6ZA 1B6AA 3IU8A 4U6EA 1R5GA 1B59A 2Q94A 2B3KA 3BITA 3BIQA 5FCFA 5JFRA 3MX6A 2Q92A 1XGMA 1O0XA 2Q93A 2BH3A 5FCHA 3FM3A 2BWVA 2GG0A 3CTZA 1YJ3A 4KM3A 5CE6A 1YVMA 5JI6A 4FO7A 2NQ6A 4R60A 5JHUA 4U69A 1YW9A 3PKAA 2GU6A 1YW8A
chains in the Genus database with same CATH superfamily
2EA4A 2BWTA 2Q95A 1R58A 2B3LA 2GG8A 5CNXA 2GGCA 1WL9A 2Q96A 2GA2A 1QXYA 4U73A 3PKDA 2V3YA 1A16A 4S2TP 4ZWPA 4FLIA 3CB6A 1C23A 4PV4A 2V3XA 4ZWOA 1W7VA 2BHBA 3MATA 4U71A 2GU7A 2GG9A 1KP0A 2GZ5A 1C22A 4FUKA 2GG7A 1JAWA 2B3HA 1XGSA 4HXXA 2ADUA 4Z7MA 3BIPA 4ZNGA 4RZZA 2V3ZA 4RGZ1 2GU4A 4U6CA 1WN1A 2GG2A 3PKEA 2GG3A 1KQ0A 4A6WA 5E5BA 1R5HA 3D27A 2P98A 4IKTA 1MATA 2G6PA 4MATA 2BWSA 3Q6DA 2BHDA 4FLJA 5CIKA 3TB5A 2IW2A 2BHAA 2BWXA 4FLKA 4FKCA 3PKBA 4FO8A 2OKNA 1C21A 1XGOA 1CHMA 2OAZA 4U1BA 1KQ9A 1Y1NA 3L7GA 1BN5A 4FLLA 5CDLA 4QR8A 4RZYA 1WBQA 3FMQA 2EVCA 2GU5A 1W2MA 2BHCA 3FMRA 4S00A 1WY2A 5D6FA 4B28A 4IKUA 4PNCA 3RVAA 4U6WA 3S6BA 3TAVA 1QZYA 2BWYA 4U76A 2EVMA 3RORA 2Q8KA 4A6VA 2GGBA 2NQ7A 4S01A 2BB7A 5D6EA 1WL6A 2BWWA 3L24A 1N51A 3MR1A 4IU6A 1PV9A 4U70A 2BWUA 5CDEA 1C24A 3PKCA 2P9AA 4U75A 1XNZA 5CLSA 4IECA 3IU7A 3IU9A 4OOKA 1QXZA 4IDYA 4U6JA 2P99A 4ZWUA 2ZSGA 5CDVA 1M35A 4IKSA 2EA2A 1C27A 1QXWA 2BN7A 1XGNA 2GTXA 2EVOA 3CB5A 1BOAA 4IKRA 4S2RP 1WKMA 4IPAA 1YW7A 4IF7A 4JUQA 2MATA 2GG5A 2DFIA 3IG4A 4EGEA 1WLRA 2HOWA 2V6CA 4U6ZA 1B6AA 3IU8A 4U6EA 1R5GA 1B59A 2Q94A 2B3KA 3BITA 3BIQA 5FCFA 5JFRA 3MX6A 2Q92A 1XGMA 1O0XA 2Q93A 2BH3A 5FCHA 3FM3A 2BWVA 2GG0A 3CTZA 1YJ3A 4KM3A 5CE6A 1YVMA 5JI6A 4FO7A 2NQ6A 4R60A 5JHUA 4U69A 1YW9A 3PKAA 2GU6A 1YW8A
chains in the Genus database with same CATH topology
2EA4A 2BWTA 2Q95A 1R58A 2B3LA 2GG8A 5CNXA 2GGCA 1WL9A 2Q96A 2GA2A 1QXYA 4U73A 3PKDA 2V3YA 1A16A 4S2TP 4ZWPA 4FLIA 3CB6A 1C23A 4PV4A 2V3XA 4ZWOA 1W7VA 2BHBA 3MATA 4U71A 2GU7A 2GG9A 1KP0A 2GZ5A 1C22A 4FUKA 2GG7A 1JAWA 2B3HA 1XGSA 4HXXA 2ADUA 4Z7MA 3BIPA 4ZNGA 4RZZA 2V3ZA 4RGZ1 2GU4A 4U6CA 1WN1A 2GG2A 3PKEA 2GG3A 1KQ0A 4A6WA 5E5BA 1R5HA 3D27A 2P98A 4IKTA 1MATA 2G6PA 4MATA 2BWSA 3Q6DA 2BHDA 4FLJA 5CIKA 3TB5A 2IW2A 2BHAA 2BWXA 4FLKA 4FKCA 3PKBA 4FO8A 2OKNA 1C21A 1XGOA 1CHMA 2OAZA 4U1BA 1KQ9A 1Y1NA 3L7GA 1BN5A 4FLLA 5CDLA 4QR8A 4RZYA 1WBQA 3FMQA 2EVCA 2GU5A 1W2MA 2BHCA 3FMRA 4S00A 1WY2A 5D6FA 4B28A 4IKUA 4PNCA 3RVAA 4U6WA 3S6BA 3TAVA 1QZYA 2BWYA 4U76A 2EVMA 3RORA 2Q8KA 4A6VA 2GGBA 2NQ7A 4S01A 2BB7A 5D6EA 1WL6A 2BWWA 3L24A 1N51A 3MR1A 4IU6A 1PV9A 4U70A 2BWUA 5CDEA 1C24A 3PKCA 2P9AA 4U75A 1XNZA 5CLSA 4IECA 3IU7A 3IU9A 4OOKA 1QXZA 4IDYA 4U6JA 2P99A 4ZWUA 2ZSGA 5CDVA 1M35A 4IKSA 2EA2A 1C27A 1QXWA 2BN7A 1XGNA 2GTXA 2EVOA 3CB5A 1BOAA 4IKRA 4S2RP 1WKMA 4IPAA 1YW7A 4IF7A 4JUQA 2MATA 2GG5A 2DFIA 3IG4A 4EGEA 1WLRA 2HOWA 2V6CA 4U6ZA 1B6AA 3IU8A 4U6EA 1R5GA 1B59A 2Q94A 2B3KA 3BITA 3BIQA 5FCFA 5JFRA 3MX6A 2Q92A 1XGMA 1O0XA 2Q93A 2BH3A 5FCHA 3FM3A 2BWVA 2GG0A 3CTZA 1YJ3A 4KM3A 5CE6A 1YVMA 5JI6A 4FO7A 2NQ6A 4R60A 5JHUA 4U69A 1YW9A 3PKAA 2GU6A 1YW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA4 A;  2BWT A;  2Q95 A;  1R58 A;  2B3L A;  2GG8 A;  5CNX A;  2GGC A;  1WL9 A;  2Q96 A;  2GA2 A;  1QXY A;  4U73 A;  3PKD A;  2V3Y A;  1A16 A;  4S2T P;  4ZWP A;  4FLI A;  3CB6 A;  1C23 A;  4PV4 A;  2V3X A;  4ZWO A;  1W7V A;  2BHB A;  3MAT A;  4U71 A;  2GU7 A;  2GG9 A;  1KP0 A;  2GZ5 A;  1C22 A;  4FUK A;  2GG7 A;  1JAW A;  2B3H A;  1XGS A;  4HXX A;  2ADU A;  4Z7M A;  3BIP A;  4ZNG A;  4RZZ A;  2V3Z A;  4RGZ 1;  2GU4 A;  4U6C A;  1WN1 A;  2GG2 A;  3PKE A;  2GG3 A;  1KQ0 A;  4A6W A;  5E5B A;  1R5H A;  3D27 A;  2P98 A;  4IKT A;  1MAT A;  2G6P A;  4MAT A;  2BWS A;  3Q6D A;  2BHD A;  4FLJ A;  5CIK A;  3TB5 A;  2IW2 A;  2BHA A;  2BWX A;  4FLK A;  4FKC A;  3PKB A;  4FO8 A;  2OKN A;  1C21 A;  1XGO A;  1CHM A;  2OAZ A;  4U1B A;  1KQ9 A;  1Y1N A;  3L7G A;  1BN5 A;  4FLL A;  5CDL A;  4QR8 A;  4RZY A;  1WBQ A;  3FMQ A;  2EVC A;  2GU5 A;  1W2M A;  2BHC A;  3FMR A;  4S00 A;  1WY2 A;  5D6F A;  4B28 A;  4IKU A;  4PNC A;  3RVA A;  4U6W A;  3S6B A;  3TAV A;  1QZY A;  2BWY A;  4U76 A;  2EVM A;  3ROR A;  2Q8K A;  4A6V A;  2GGB A;  2NQ7 A;  4S01 A;  2BB7 A;  5D6E A;  1WL6 A;  2BWW A;  3L24 A;  1N51 A;  3MR1 A;  4IU6 A;  1PV9 A;  4U70 A;  2BWU A;  5CDE A;  1C24 A;  3PKC A;  2P9A A;  4U75 A;  1XNZ A;  5CLS A;  4IEC A;  3IU7 A;  3IU9 A;  4OOK A;  1QXZ A;  4IDY A;  4U6J A;  2P99 A;  4ZWU A;  2ZSG A;  5CDV A;  1M35 A;  4IKS A;  2EA2 A;  1C27 A;  1QXW A;  2BN7 A;  1XGN A;  2GTX A;  2EVO A;  3CB5 A;  1BOA A;  4IKR A;  4S2R P;  1WKM A;  4IPA A;  1YW7 A;  4IF7 A;  4JUQ A;  2MAT A;  2GG5 A;  2DFI A;  3IG4 A;  4EGE A;  1WLR A;  2HOW A;  2V6C A;  4U6Z A;  1B6A A;  3IU8 A;  4U6E A;  1R5G A;  1B59 A;  2Q94 A;  2B3K A;  3BIT A;  3BIQ A;  5FCF A;  5JFR A;  3MX6 A;  2Q92 A;  1XGM A;  1O0X A;  2Q93 A;  2BH3 A;  5FCH A;  3FM3 A;  2BWV A;  2GG0 A;  3CTZ A;  1YJ3 A;  4KM3 A;  5CE6 A;  1YVM A;  5JI6 A;  4FO7 A;  2NQ6 A;  4R60 A;  5JHU A;  4U69 A;  1YW9 A;  3PKA A;  2GU6 A;  1YW8 A; 
#chains in the Genus database with same CATH topology
 2EA4 A;  2BWT A;  2Q95 A;  1R58 A;  2B3L A;  2GG8 A;  5CNX A;  2GGC A;  1WL9 A;  2Q96 A;  2GA2 A;  1QXY A;  4U73 A;  3PKD A;  2V3Y A;  1A16 A;  4S2T P;  4ZWP A;  4FLI A;  3CB6 A;  1C23 A;  4PV4 A;  2V3X A;  4ZWO A;  1W7V A;  2BHB A;  3MAT A;  4U71 A;  2GU7 A;  2GG9 A;  1KP0 A;  2GZ5 A;  1C22 A;  4FUK A;  2GG7 A;  1JAW A;  2B3H A;  1XGS A;  4HXX A;  2ADU A;  4Z7M A;  3BIP A;  4ZNG A;  4RZZ A;  2V3Z A;  4RGZ 1;  2GU4 A;  4U6C A;  1WN1 A;  2GG2 A;  3PKE A;  2GG3 A;  1KQ0 A;  4A6W A;  5E5B A;  1R5H A;  3D27 A;  2P98 A;  4IKT A;  1MAT A;  2G6P A;  4MAT A;  2BWS A;  3Q6D A;  2BHD A;  4FLJ A;  5CIK A;  3TB5 A;  2IW2 A;  2BHA A;  2BWX A;  4FLK A;  4FKC A;  3PKB A;  4FO8 A;  2OKN A;  1C21 A;  1XGO A;  1CHM A;  2OAZ A;  4U1B A;  1KQ9 A;  1Y1N A;  3L7G A;  1BN5 A;  4FLL A;  5CDL A;  4QR8 A;  4RZY A;  1WBQ A;  3FMQ A;  2EVC A;  2GU5 A;  1W2M A;  2BHC A;  3FMR A;  4S00 A;  1WY2 A;  5D6F A;  4B28 A;  4IKU A;  4PNC A;  3RVA A;  4U6W A;  3S6B A;  3TAV A;  1QZY A;  2BWY A;  4U76 A;  2EVM A;  3ROR A;  2Q8K A;  4A6V A;  2GGB A;  2NQ7 A;  4S01 A;  2BB7 A;  5D6E A;  1WL6 A;  2BWW A;  3L24 A;  1N51 A;  3MR1 A;  4IU6 A;  1PV9 A;  4U70 A;  2BWU A;  5CDE A;  1C24 A;  3PKC A;  2P9A A;  4U75 A;  1XNZ A;  5CLS A;  4IEC A;  3IU7 A;  3IU9 A;  4OOK A;  1QXZ A;  4IDY A;  4U6J A;  2P99 A;  4ZWU A;  2ZSG A;  5CDV A;  1M35 A;  4IKS A;  2EA2 A;  1C27 A;  1QXW A;  2BN7 A;  1XGN A;  2GTX A;  2EVO A;  3CB5 A;  1BOA A;  4IKR A;  4S2R P;  1WKM A;  4IPA A;  1YW7 A;  4IF7 A;  4JUQ A;  2MAT A;  2GG5 A;  2DFI A;  3IG4 A;  4EGE A;  1WLR A;  2HOW A;  2V6C A;  4U6Z A;  1B6A A;  3IU8 A;  4U6E A;  1R5G A;  1B59 A;  2Q94 A;  2B3K A;  3BIT A;  3BIQ A;  5FCF A;  5JFR A;  3MX6 A;  2Q92 A;  1XGM A;  1O0X A;  2Q93 A;  2BH3 A;  5FCH A;  3FM3 A;  2BWV A;  2GG0 A;  3CTZ A;  1YJ3 A;  4KM3 A;  5CE6 A;  1YVM A;  5JI6 A;  4FO7 A;  2NQ6 A;  4R60 A;  5JHU A;  4U69 A;  1YW9 A;  3PKA A;  2GU6 A;  1YW8 A; 
#chains in the Genus database with same CATH homology
 2EA4 A;  2BWT A;  2Q95 A;  1R58 A;  2B3L A;  2GG8 A;  5CNX A;  2GGC A;  1WL9 A;  2Q96 A;  2GA2 A;  1QXY A;  4U73 A;  3PKD A;  2V3Y A;  1A16 A;  4S2T P;  4ZWP A;  4FLI A;  3CB6 A;  1C23 A;  4PV4 A;  2V3X A;  4ZWO A;  1W7V A;  2BHB A;  3MAT A;  4U71 A;  2GU7 A;  2GG9 A;  1KP0 A;  2GZ5 A;  1C22 A;  4FUK A;  2GG7 A;  1JAW A;  2B3H A;  1XGS A;  4HXX A;  2ADU A;  4Z7M A;  3BIP A;  4ZNG A;  4RZZ A;  2V3Z A;  4RGZ 1;  2GU4 A;  4U6C A;  1WN1 A;  2GG2 A;  3PKE A;  2GG3 A;  1KQ0 A;  4A6W A;  5E5B A;  1R5H A;  3D27 A;  2P98 A;  4IKT A;  1MAT A;  2G6P A;  4MAT A;  2BWS A;  3Q6D A;  2BHD A;  4FLJ A;  5CIK A;  3TB5 A;  2IW2 A;  2BHA A;  2BWX A;  4FLK A;  4FKC A;  3PKB A;  4FO8 A;  2OKN A;  1C21 A;  1XGO A;  1CHM A;  2OAZ A;  4U1B A;  1KQ9 A;  1Y1N A;  3L7G A;  1BN5 A;  4FLL A;  5CDL A;  4QR8 A;  4RZY A;  1WBQ A;  3FMQ A;  2EVC A;  2GU5 A;  1W2M A;  2BHC A;  3FMR A;  4S00 A;  1WY2 A;  5D6F A;  4B28 A;  4IKU A;  4PNC A;  3RVA A;  4U6W A;  3S6B A;  3TAV A;  1QZY A;  2BWY A;  4U76 A;  2EVM A;  3ROR A;  2Q8K A;  4A6V A;  2GGB A;  2NQ7 A;  4S01 A;  2BB7 A;  5D6E A;  1WL6 A;  2BWW A;  3L24 A;  1N51 A;  3MR1 A;  4IU6 A;  1PV9 A;  4U70 A;  2BWU A;  5CDE A;  1C24 A;  3PKC A;  2P9A A;  4U75 A;  1XNZ A;  5CLS A;  4IEC A;  3IU7 A;  3IU9 A;  4OOK A;  1QXZ A;  4IDY A;  4U6J A;  2P99 A;  4ZWU A;  2ZSG A;  5CDV A;  1M35 A;  4IKS A;  2EA2 A;  1C27 A;  1QXW A;  2BN7 A;  1XGN A;  2GTX A;  2EVO A;  3CB5 A;  1BOA A;  4IKR A;  4S2R P;  1WKM A;  4IPA A;  1YW7 A;  4IF7 A;  4JUQ A;  2MAT A;  2GG5 A;  2DFI A;  3IG4 A;  4EGE A;  1WLR A;  2HOW A;  2V6C A;  4U6Z A;  1B6A A;  3IU8 A;  4U6E A;  1R5G A;  1B59 A;  2Q94 A;  2B3K A;  3BIT A;  3BIQ A;  5FCF A;  5JFR A;  3MX6 A;  2Q92 A;  1XGM A;  1O0X A;  2Q93 A;  2BH3 A;  5FCH A;  3FM3 A;  2BWV A;  2GG0 A;  3CTZ A;  1YJ3 A;  4KM3 A;  5CE6 A;  1YVM A;  5JI6 A;  4FO7 A;  2NQ6 A;  4R60 A;  5JHU A;  4U69 A;  1YW9 A;  3PKA A;  2GU6 A;  1YW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...