1XGOA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Aminopeptidase
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
total genus 81
structure length 295
sequence length 295
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgoA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgoA01
3S2WA 4U0YA 4XRFA 3TOAA 1MATA 4FKCA 1LDJA 3CTZA 4M6XA 1A16A 2V79A 5HDGA 6PAXA 4G9YA 1Y1NA 3KLNA 1OYIA 2NRAC 1BIBA 3EDPA 1T0FA 1U6GA 3RI4A 3DQVC 4WWCA 5DCMA 3GFIA 4I0AA 4EJTA 1F5TA 3WTWC 3F21A 2GXBA 1H9TA 2XVCA 2JTVA 2HR3A 3J81K 1HKTA 5H6QA 3HRUA 2EFQA 4AVPA 1A04A 2YX4A 3T1BA 5FB2A 2DPUA 3L09A 3M8FA 1RI7A 2H27A 2RDPA 1R00A 2A3SA 4HW0A 1FT9A 1O7LA 2IT0A 1FYMA 4AIJA 5HLGA 1YS7A 3WU0A 3HIFA 3ZP5A 2QYOA 2VBXA 1R1UA 2QBYB 3FMRA 3BWGA 1Z7UA 3SFZA 3ZPLA 3P7NA 4KIGA 2HFHA 4M9SA 4G6DA 2GAUA 4IXAA 3ZMSA 3CUQB 4R60A 5DDGA 3LWFA 3KZYA 2FQ3A 3OV8A 3KETA 3GEZA 5L3EA 3KP4A 3GFMA 4ZWOA 4ZYEA 1CF7A 1QQIA 1KU7A 3Q6DA 5CDVA 2Q95A 2BB7A 1AOYA 2M45A 1ZRDA 2ESHA 4U88A 1QO0D 3QOPA 1O3TA 2ZXJA 3VODA 3H3ZA 2O8XA 1STZA 1MKMA 4Z2YA 2K4BA 4GYGA 4HQEA 4LD5A 1P92A 4EM0B 4ZZLA 1RNLA 4YG2F 2JPBA 4ZYDA 4B28A 4BHCA 3KLOA 4MATA 1ZHFA 2BGCA 2MBFA 3Q9VA 2B0LA 1QGPA 3E3VA 2PBIA 4QR8A 1R1TA 1KGSA 2EFWA 3K69A 3TQNA 3TOBA 2P7VB 2YX7A 5CYVA 2XUBA 2XROA 1LEAA 2P6SA 3VEPA 2P5VA 4HV6A 5IT3A 3DV8A 5FD6A 1XGSA 1OMIA 4HX7A 4RAZA 5HDNA 4WX9A 4OIPF 1U78A 2GIVA 1HSJA 3KZZA 1HKQA 4U6JA 4FX0A 4G7ZF 2EFNA 2QWWA 3TDZC 2A6HF 1IN5A 3RORA 2DT5A 1KU2A 2VT3A 5TRDA 1K79A 3IU8A 2FU4A 5TJJA 5BMZA 2NQ6A 2FNPA 1LDDA 3TO7A 2M8EA 3FF5A 2LSOA 4HX4A 4AIKA 4JK1X 1ZGJA 4ASNA 1H9GA 4R1HA 1YW7A 2GGBA 1IN7A 2HYFA 3IC7A 3TAVA 5EEGA 1C22A 1TQPA 2LF7A 3JAMZ 3CO6C 2B3LA 4U75A 2FMLA 4I01A 1B6AA 3COAC 2ZCWA 2P9AA 1P2FA 3MAJA 1QPMA 3L9FA 4IDYA 3MEXA 2DK5A 3CUOA 2CW0F 1XGMA 1KU3A 2XV4S 5CDEA 2QQAA 3PKBA 1SD6A 1XSXA 2EV6A 1UCRA 4JBAA 2CO5A 1GXPA 2BWUA 2P98A 3O6BB 1Y0UA 4RGSA 1LQ1A 5LHGA 2F5DA 3I59B 2P5LC 5BQTA 1XGOA 2RGVA 4U0WA 2V3XA 4R8HA 2IA2A 2MD5A 3C3WA 4OOKA 2WWYA 1J59A 5ICCA 4ZZDA 5K5RA 2V3YA 2M87A 2O3FA 1BN5A 2M5WA 4YIIA 2GTXA 2O03A 3FM5A 5LLQA 4Z7MA 2DQLA 3QAHA 1O3SA 5DUKA 5FFXA 1XCVA 3OOPA 2G7HA 5F1RA 4UUVA 4ESFA 3PFIA 5E1WA 2HGCA 3B02A 3QU6A 1ONVA 1MDMA 4HF1A 2G9WA 2H6CA 2W57A 5J6XA 1FZPB 1I27A 3GVAA 1GHCA 2XRNA 3BP8A 4L5JA 4A5MA 4EGZA 3HOTA 2FBHA 3MWMA 3NEUA 3ELKA 2RVCA 4Q5SF 3EUHA 3GLXA 3EYIA 3F72A 5JHUA 4BHBA 5DCMB 4ZYGA 3QRFF 1PP8F 4IHTA 4PGGA 1W7PD 1YJ3A 3IRQA 2Q2EA 4RAYA 2GG8A 1YTYA 2CG4A 2XIGA 4UV9A 3K2ZA 3L7WA 3MR1A 4G94A 1TQMA 1IRFA 3D5LA 4EV0A 4OIOF 1D3YA 3V8KA 5CLSA 1TNSA 3K9TA 1OYYA 4Q4ZF 2F5EA 3VOEA 3FHZA 2X0LA 1ZARA 4EJUA 2QM3A 1B9MA 1ZLJA 3PQJA 1WRJA 4KN4X 4NQWA 4D0PA 3WG9A 2CFXA 5LGUA 1AWCA 5CIKA 4MQ9F 2A61A 2EVMA 2OD5A 3GO5A 1FBSA 2JRTA 5L3CA 1WN1A 1FPQA 2BHCA 2EFPA 4OMZA 5DV5A 3WE2A 3DF8A 3H92A 1XDSA 1HW5A 3FX3A 1RZ4A 3PKDA 5LBQA 4IU6A 3F6OA 4S2RP 2XGXA 1UB9A 4I0BA 3K1PA 5ILSA 4MEYF 2J5OA 3NQOA 2L02A 1ZG3A 3WTTC 2BBYA 1EH7A 5DUIA 1YW9A 3L24A 3TO6A 2IW2A 3NRVA 3TKYA 4UVAA 2XKPA 3LQQA 3IWFA 3CTAA 3ZMTA 1LVAA 2FA5A 1QZZA 2BWYA 5F6FA 1SMTA 4FLIA 3ABTA 2QENA 3MZYA 3WTYC 3TO9A 4HLXA 2M1BA 2JT1A 2VC1A 3L7GA 1YIOA 3I54A 2CQKA 2Z3YA 4IRGA 5CE6A 1ON1A 2OKNA 2R3SA 5IT9Z 3F8CA 1IF1A 2RN7A 2M30A 2STTA 2XAQA 1IN6A 2HS5A 3RKWA 1YYVA 4UV8A 4JUQA 5AIQA 1GVJA 4UXNA 5E20A 1P6RA 1J0RA 1F4KA 3JAMK 3WTVC 1KU9A 4U0VA 5D4RA 5DD8A 4LG0A 1U5TA 2EJRA 4S2TP 2FE3A 2BWWA 2P99A 1WLRA 3EYYA 2YPRA 3O3KA 1OR7A 2GXGA 2W24A 2B3KA 3KP2A 2EA2A 1F1ZA 4I98B 1ZG1A 1ZYRF 4MTEA 1S8NA 5FFZA 3QPTA 4KUMA 3ROUA 1QNTA 4HA8A 4AD9A 2PMHA 1FNNA 1SMYF 2MH2A 3REOA 2H94A 2WC2A 2Q96A 1TLHB 4UVCA 4BXUA 4Y17A 4MEXF 1R58A 2AXLA 1YQAA 3LFKA 3E6CC 1IN8A 2VOPA 2GZ5A 3ABUA 3IU9A 4RB3C 2YSRA 5J8CA 2O6GE 4L9JA 4A6EA 2PEXA 1X3UA 2LNBA 3N4MA 3T8TA 3CUQC 1YO5C 3W6KB 4EJWA 3C18A 4O3MA 4H0EA 4G7HF 1SD5A 4ZNGA 2ETHA 1HXDA 2PI0A 1XSVA 1JHFA 1QXZA 4U7DA 1T98A 2EFOA 4EM1A 4CHUA 3N97A 1IXCA 2NAZA 3K1NA 3I4PA 1TW2A 3CDHA 1U2WA 2ZFWA 4KT5C 4L9TA 3T0YA 1JHHA 4MTDA 2HEOA 1PUEE 5D6EA 5E8IA 1ZH5A 1FOKA 2FXAA 3J80Z 1BC7C 5JFRA 3RKYA 4AIHA 3VB2A 2J5PA 2XAFA 4KIBA 2OAZA 1RIOH 2QQBA 5CDLA 1D8JA 4PNCA 1QXYA 2DK8A 3F8FA 4PV4A 3BIQA 4HOBA 5LEKA 4S04A 4RB2C 4HLYA 2L01A 3SHFA 2IA0A 4NHJA 4N0BA 1SAXA 3ULQB 1R22A 1WWXA 4ESBA 2V1DA 1S7OA 4U70A 2ISYA 4LB5A 1D8KA 2KJCA 1W4MA 2Y75A 3ZN0A 1HQCA 2Q94A 2DAOA 2NYXA 2P8TA 3L00A 3MFKA 1BI3A 4GCVA 2DPDA 1PDNC 4FO7A 5F64A 5FCFA 2OA4A 2V1UA 3F8MA 2MLGA 3GX4X 4FO8A 4ZH4F 3GFJA 2FF4A 2DI3A 1T2KA 1W7PB 4HF2A 4MHGA 5JR3A 2GA1A 2XKOA 4QLCU 3WU1B 3BJAA 2MLKA 4KIFA 3AAFA 1HKSA 1IN4A 1XSDA 3IKVA 5DCFA 4K2EA 4O6JA 3HHHA 2X4HA 2HOWA 4OMYA 1QBJA 3RDIA 4UVBA 3FXRA 2PJPA 1RUOA 1B9NA 2BWVA 5CJ9A 1O57A 1LB2A 2CWEA 1TBXA 5L3BA 5E8GA 1DP7P 3JTGA 1JAWA 2B3HA 1S29A 3TGNA 4P96A 5ILUA 3GWZA 3BJOA 3HYIA 4YFNF 4A6DA 4HDUA 3CLOA 5IT9K 2OU2A 1WL6A 4S00A 3MCZA 3HRTA 1FYLA 1U8RA 1FBUA 2RV8A 3RVAA 4FX4A 1KQ9A 2ZNYA 3IWZA 1T6SA 1P4WA 5L3FA 2ZSGA 3E6BA 2CSOA 4KN7X 5LHIA 1OKRA 3QP6A 5JVTA 1MJAA 2F5FA 4GYIA 4M72A 2HWVA 2EB7A 2IPQX 1LNWA 2E1CA 1CHMA 2GQQA 1BI0A 4L18B 5DEQA 2HKOA 1DPRA 4LG0B 1U5TB 2EA4A 1P4AA 5J8FA 4HQMA 5E1XA 4N9IA 2Q8KA 4HZFA 2ZBKA 3ERED 2PMUA 4U1BA 1G4DA 3MX6A 3D27A 3K0LA 1K78B 5AIPA 1ZRFA 2FBKA 4FLLA 5FD5A 1IW7F 2BWXA 2BHAA 1XCBA 3FM3A 3KE2A 2GU4A 3DPTA 2ZJ2A 2CYYA 3JSOA 1SFUA 2GU5A 2Q92A 3JTHA 2EWNA 2Z99A 4KICA 2V1XA 1IAWA 4BNCA 2YU3A 1B4AA 4LK1F 5ED4A 4CGZA 3GFLA 3LA3A 4S05A 4RGZ1 4XLPF 4RGUA 4KMFA 2HOEA 1M35A 4KDPA 4OIRF 3GYHX 2GG0A 3RTRA 2L54A 4P9FA 5CVJA 4CICA 4F7ZA 2KRFA 1HW1A 3R60A 2E7WA 3V7CA 1W2MA 4M74A 4FLJA 4U76A 2D45A 3HRSA 2BN7A 5HS7A 4I7HA 3BPXA 4HYEA 2F2EA 2IA1A 3BOQA 5FGMA 3D0SA 2HTSA 3BDDA 3U9GA 2GG5A 3J80K 1XGNA 3BPVA 4E70A 1Z6RA 4BH9A 1PP7U 2R7FA 1KQ8A 5D5UB 4CYDA 4U7BA 5L3DA 2GG2A 2VBZA 3V4GA 4TV7A 2QBYA 4WF2A 3P9IA 2OZ6A 4XLNF 4EMSA 1F9NA 2K86A 3RYRA 4OOIA 2GG7A 2H6BA 4WXHA 1S7AA 2A07F 2VXZA 1C23A 3HSEA 1XNZA 4L9NA 3IG4A 4EJOA 2HQRA 3R4KA 3F23A 4Q47A 3EQLF 1U3EM 2UWMA 1N51A 1CF7B 3KP7A 2EK5A 2IP2A 1SD4A 3LQRA 2P5KA 2D1HA 1R5GA 1OYWA 2FEZA 2KIMA 2A68F 3MQ0A 3RPQA 5H6RA 5D5WB 3HTSB 2HZTA 5D6FA 3R61A 5D8KB 2WTEA 3WTUC 1BIAA 3DP7A 3V7SA 3WGIA 2CGPA 4ZWPA 3I71A 2L3DA 1VTNC 2GU7A 1ZGAA 4I02A 4IKTA 2H09A 4WK8F 2D1VA 3T8RA 2FMYA 5LRSA 4CXFA 5LEJA 4S01A 2PFBA 4ZYHA 2DU9A 4XBFA 4KFCA 3ECHA 3I58A 3RJPA 2JSCA 3G3ZA 4IF4A 4EJVA 2HDCA 2L4MA 3JSPA 4KM3A 1XB4A 4Y13A 5CVRA 3WTXC 2JPCA 2DTRA 4A6VA 4I09A 3E5QA 4OIQF 3FMQA 2VE9A 4UNOA 2W85A 1JGSA 1T39A 4IPAA 3DPLC 3PKCA 4MQVA 4IKRA 4QWQA 2HQNA 5KVRA 4OINF 1ZN2A 1MD0A 5HOOA 3IKTA 3KP6A 1YG2A 5JI6A 1MGTA 3R6SA 4IRIA 2BV6A 3HHGA 1J5YA 1G3WA 5EEHA 4HX8A 2RKHA 1FY7A 1G3TA 1MJ9A 4ZWUA 3W6JB 3BITA 3L2CA 4IHSA 1YW8A 5D5XB 2EVOA 4WXCA 1C21A 1EV7A 3F8BA 2LF8A 4DQ2A 4L0ZB 1QXWA 4L0YB 2PN6A 4FLKA 1OPCA 3GZ5A 3I59A 2BE5F 2F5CA 5FO5A 1MZBA 1UHMA 1R36A 3LSTA 5ERIA 4EGEA 5HS8A 5HLIA 1CGPA 3CJNA 1EH8A 3E97A 2P7CB 2VN2A 5FCHA 2TDXA 2KKOA 3DEUA 1C0WA 2MA3A 4KNYA 3V8JA 2Z5UA 1FX7A 1E2XA 2E1NA 1LEBA 1BC8C 2ESNA 2ZMEA 4PGHA 4A0XA 1YS6A 1IZ1A 1YFHA 4KA4A 3M9AA 4R79A 1S3JA 2QVOA 1IXSB 1P4XA 1QZYA 3F8NA 1E17A 1BOAA 5K5QA 1W5SA 1C24A 2NS0A 3BJ6A 4RB1A 2GGCA 4RGXA 2XASA 3P9CA 4L9VA 5HDKA 1MDMB 4CDGA 4IKSA 2A5YB 4U71A 1ULYA 5BPDA 4EM2A 1V4RA 1K6OA 4LMYA 1D5VA 4OU0A 2P6TA 1KQ0A 3ZMVA 3WE3A 3LAPA 1J9IA 4U6WA 4FHTA 3G73A 3ECOA 2Y0MA 3M1EA 3Q9SA 1ZREA 3V8LA 2A6EF 2DFIA 3F22A 3WGHA 1GXQA 3FXQA 4HBLA 2STWA 3BIPA 4LK0F 5DD4A 2QUFA 1J75A 5DYMA 1HW2A 1UHWA 5BOXA 2COMA 1K7AA 1SD7A 2HKXA 2Z9OA 1IRGA 1SFXA 3U2RA 5D4SA 4RB0A 3RPUA 3VFZA 1ODDA 2RC4A 1BM9A 1T38A 3GF2A 1USTA 4LJZF 3WTZA 1FC3A 4RZZA 3BROA 5FLXZ 2XAHA 5D5VB 1BBYA 1C27A 4ENNA 5E18F 4A6WA 4I2OA 1ZAOA 2DQRA 4M6YA 1BI2A 2ELHA 4KMUX 2ACJA 4LGWA 3U1DA 2XAJA 1FWZA 3LA7A 1B59A 2E7XA 2GU6A 3RKXA 2VE8A 4LLGF 1FSHA 1LJ9A 3IHUA 5L3GA 2OBPA 1JE8A 2EV0A 2UXXA 1ZG5A 2VODA 1U5TC 3DFGA 1WI9A 4U69A 3HOSA 5H20A 3J7AO 1G3SA 1FP1D 4YFKF 5HVQC 2W84A 4M71A 1XD7A 5LRRA 3WGGA 2XAGA 4HF0A 1R5HA 1Z1DA 3MATA 2PQ8A 4B09A 2GWRA 3HSRA 3GZ6A 4BAYA 2A69F 1PV9A 4CZZA 2MC3A 3SXYA 3PKAA 2FBIA 3JW4A 4DNCA 1HSTA 4BQAA 3WTSC 1J2XA 4AWXB 3O2PE 4B8XA 2V3ZA 2OQGA 1I1GA 1TW3A 3V7RA 4A12A 1DPUA 3QP5A 4XSZF 1TTYA 1J7KA 2D2WA 2UZKA 1G3YA 2LDUA 2MATA 2VC0A 5HLHA 2QQ9A 1TQIA 2EV5A 3KCCA 2G6PA 3E6DA 3IRRA 3C7JA 5BPIA 3R0JA 1KP0A 3KEQA 1XMAA 5A2QZ 4PZJA 2PG4A 3ZMDA 2PLYA 1WSUA 4LLNA 1WL9A 1FYKA 3RIRA 4PDKA 2O61A 2Q0OA 3LAJA 2BHBA 4ENKA 2UXNA 2XHKA 5E17F 1I1SA 2IRFG 4M9ZA 3WODF 3EETA 4A2UA 1B1BA 3IL2A 1IUYA 4KYWA 4YIFA 2GG3A 2ZKZA 4ENJA 1RUNA 4IRHA 4GO1A 2OZUA 3HTUA 2Z33A 2BWSA 2V9VA 2IJLA 4PCQA 4EVIA 4HAMA 2VBYA 2ISZA 1REPC 3ML6A 1FLIA 1S6LA 2GZWA 5BS6A 3QPHA 2K27A 3GUDA 3RYPA 3K1MA 3I53A 3ZMZA 4MNUA 2RQPA 2QLZA 5AONA 1R7JA 2ZMEB 3ISPA 4LLLA 2GG9A 2YR2A 2VT2A 3F6VA 3ZQ7A 3DXJF 4WCGA 5ICGA 1Z91A 3KEOA 1ZRCA 4EGYA 4BYYA 2K7LA 4WXDA 5ILVA 1R23A 1ON2A 4ENMA 3TDUC 3M7GA 4NB5A 4P55A 5HS9A 3C1DA 3GW2A 3M8EA 4ESJA 1Z9CA 1BJAA 1LDKB 2BEOA 2NNYA 3J81Z 1UFMA 1FP2A 5K1YA 2DBBA 4A5NA 2KJBA 1V3FA 3I0TA 4G6QA 4ETSA 5LGNA 4U73A 1YLFA 2BYVE 2Q93A 4M73A 1XMKA 3I5UA 4CO8A 3CUQA 3E6MA 1XN7A 3MZHA 1H0MA 4Q48A 1G6NA 1WQ2A 2C6YA 2K4JA 3LA2A 4LFUA 5CVIA 5LGTA 2G7UA 3R0AA 4L5IA 1O3QA 4GXOA 5FLXK 2IW5A 3T5XA 1IXRC 1XDUA 2QZ8A 3QU3A 4Y15A 3KFWX 4G8XA 1KYZA 1L0OC 1ZLKA 3CB6A 2O0YA 4XSXF 1W7PA 1FBQA 4IECA 2WV0A 1WBQA 2DO7A 4FT8A 4G7OF 2MH9A 3PQKA 2NNNA 5K5OA 2VONA 1TNTA 4FUKA 3H3UA 1JXSA 3E5XA 3E5UA 3FXUA 4RS8A 2DLLA 2Y48A 1O0XA 3KP3A 3HSFA 3DKWA 2K02A 4IVNA 5KK1A 2KIFA 1BI1A 1W5TA 4JQFA 1DUXC 2EVCA 4HDVA 1WKMA 2OQRA 2JZYA 3CO7C 5CVVA 1NHAA 4IF7A 2BWTA 2FNAA 3SQNA 1O7FA 4IKUA 2FRHA 1Z05A 4LB6B 3BZ6A 3IU7A 1Z6TA 5D8LB 2VOOA 2ZO4A 3HUGA 4N9HA 2AS5F 2HYGD 4A0ZA 4EQQA 2ADUA 3SZTA 2L4AA 1MJBA 4O5VA 4YFXF 3I64A 3PKEA 1R1VA 4RGRA 4HV5A 2ZNZA 3B73A 3HRMA 2V6CA 5A2QK 1HBXG 2NQ7A 3BY6A 1SFEA 4P5OA 4UHTA 3ZN1A 5LHHA 1KYWA 2DW4A 2FSWA 4U6CA 2GA2A 4IJAA 3SZPA 3GXOA 5E1ZB 3FMSA 3FZVA 1I6XA 3CB5A 3FWEA 2LKPA 3F3XA 1K78A 1DDNA 2RNJA 4M9XA 4A0YA 2BH3A 3ZMUA 1EH6A 2HTJA 1Q1HA 1I5ZA 2FOKA 4BHPA 2P4WA 4P9UA 5ICEA 3S6BA 4U6ZA 3P9KA 5E5BA 5CVUA 1YVMA 4ON0A 5ICFA 4RZYA 3TB5A 3Q5FA 4HXXA 1KA8A 1L3LA 4MGRA 5CNXA 1USSA 3KP5A 4GGGA 2W25A 1W7VA 2VBWA 2R7DA 1FSEA 2IVMA 4U6EA 2KIUA 2BHDA 1O3RA 1WY2A
chains in the Genus database with same CATH superfamily
1ZK8A 3S2WA 4U0YA 4XRFA 2K3FA 2W00A 3TOAA 1MATA 4NDLA 1IV8A 5LFAA 1EJ9A 3I9V2 3B6CA 4FKCA 1LDJA 3CTZA 1I39A 4M6XA 2AXTC 1A16A 2V79A 5HDGA 4IOCF 6PAXA 5E3OA 4G9YA 1Y1NA 3KYCB 2DMQA 3KLNA 1OYIA 2NRAC 1BIBA 3EDPA 3RPUD 1T0FA 3HPHA 3GMEA 1U6GA 3AG3H 4S0HB 3RI4A 3DQVC 3MMYB 4WWCA 3OYBA 5DCMA 4M3FA 3GFIA 4I0AA 4EJTA 1F5TA 3WTWC 2E71A 4BACA 3F21A 2GXBA 1H9TA 2XVCA 2JN6A 2HR3A 2JTVA 5F0FA 3J81K 3LSPA 3DTKA 1HKTA 1RKTA 5H6QA 3HRUA 1R9TJ 4GRIA 2EFQA 4AVPA 1A04A 2ECBA 4QSHA 5JLWA 2YX4A 3T1BA 5FB2A 3BZCA 2DPUA 3L09A 3M8FA 5JLXA 1RI7A 2H27A 2XPWA 4F93B 5J47A 5DM7F 3FBNB 2RDPA 3GTOJ 2R92J 1R00A 2A3SA 1LFBA 3DBHB 4HW0A 4N4NB 2V9PA 1FT9A 1O7LA 3QOEA 2IT0A 5EG0A 1FYMA 4UUSA 4AIJA 1R71A 3GCMA 2HVQA 5HLGA 3ZQFA 3OYMA 1RR8C 2NS7A 1RKWA 3IH3A 1YS7A 3WU0A 3HIFA 3ZP5A 1HDDC 2QYOA 2VBXA 1R1UA 2QBYB 3FMRA 4RAFA 1YE9A 2HI3A 2V26A 2HVSA 3BWGA 2L7FP 1Z7UA 2JA5J 3K4KA 3SFZA 3ZPLA 3P7NA 5B5EC 1XPXA 2VJ4A 4E7SA 4KIGA 5DTDA 2HFHA 3LSIA 4M9SA 1PVEA 1BL0A 3JRHA 4G6DA 4AUXA 4PJNA 2GAUA 4IXAA 3IH4A 3BG5A 3CUQB 3ZMSA 1AU7A 4R60A 5DDGA 3C2BA 3KZYA 3LWFA 2FQ3A 3OV8A 3KETA 3GEZA 5L3EA 3KP4A 2UUZA 2L5QA 3GFMA 3KZIC 4ZWOA 4XICA 3PNYA 4ZYEA 4CYCA 1CF7A 3GTJJ 1TL8A 1QQIA 1KU7A 3Q6DA 5CDVA 2Q95A 2BB7A 4FISA 2IS4A 2OCCH 2XF7A 2M45A 4MIMA 1ZRDA 1AOYA 2ESHA 4LIUA 3ZQCA 4U88A 1SANA 1SAUA 1QO0D 3X2QH 3QOPA 1O3TA 2ZXJA 3VODA 3H3ZA 2O8XA 1STZA 1MKMA 3I4NJ 1T95A 4Z2YA 2K4BA 4RMNA 4GYGA 4HQEA 2IXSA 4LD5A 1P92A 2XPVA 5F27A 4EM0B 4I99C 4ZZLA 5KNLA 1AHDP 1RNLA 4YG2F 4X0GA 2JPBA 4ZYDA 2BW3A 2GOMA 4B28A 1VI0A 4BHCA 3KLOA 4MATA 1D0YA 1ZHFA 2E2IJ 2BGCA 2MBFA 4A3IJ 3Q9VA 2E19A 2B0LA 1QGPA 3E3VA 2PBIA 3HKZN 4YEJA 1R1TA 4QR8A 1QHGA 2R7QA 1KGSA 2EFWA 3K69A 3TQNA 3QQAA 1WVRA 4II2A 3TOBA 2P7VB 4W97A 9ANTA 2YX7A 5CYVA 2XUBA 2XROA 1LEAA 2P6SA 3FXKA 2ME0A 3VEPA 2P5VA 2IS2A 4HV6A 4YIRX 2EQRA 2DA2A 5IT3A 3DV8A 3FXOA 5FD6A 1XGSA 1OMIA 4HX7A 4RAZA 5HDNA 3IH2A 4WX9A 4OIPF 1U78A 2DA3A 4ZDLA 2GIVA 1SC7A 1HSJA 3KZZA 1HKQA 3CMAI 4U6JA 3BG3A 4FX0A 2NVTJ 4G7ZF 2EFNA 2QWWA 3TDZC 2A6HF 1IN5A 4OWRB 2DT5A 3RORA 1KU2A 2VT3A 1I3AA 3OYEA 2CU7A 4XN0A 1YJWI 1U0JA 4CH7A 5TRDA 3K4LA 1K79A 3K70D 3IU8A 2F4MB 1GDTA 3KEYA 1MIJA 2FU4A 5TJJA 1RRJA 4BEHA 5BMZA 1IJWC 1JT0A 2NQ6A 2FNPA 1LDDA 3HUGB 4LOCA 3HG9A 1HDPA 2M8EA 3FF5A 2LSOA 4HX4A 3TO7A 4AIKA 2CRGA 2ZMEC 4JK1X 1ZR2A 2XC7A 3BC8A 1ZGJA 3SJMA 3I55I 4NC8A 4ASNA 2EZIA 2KZGA 2DJIA 4XQFA 3CJRB 2VKEA 1H9GA 4R1HA 1YW7A 3GBGA 2GGBA 4PJMA 1IN7A 2HYFA 3IC7A 2E35A 2IS6A 3TAVA 2W48A 5EEGA 1OCPA 5IP9J 1C22A 1TQPA 2LF7A 3JAMZ 3CO6C 5FRNA 2F6CA 2B3LA 4U75A 2FMLA 3OR2C 1B6AA 4I01A 4LIVA 1KONA 3COAC 2ZCWA 4UB6C 2Y31A 3CC4I 4KT6A 1K6YA 2DJNA 3GTPJ 2P9AA 3JR9A 1P2FA 2P0WA 3HBLA 1QPMA 3MAJA 3L9FA 5EEAA 2KLOA 4IDYA 3MEXA 2AQEA 2DK5A 3CUOA 2CW0F 2LC2A 4Y52J 1XGMA 1KU3A 2XV4S 2K9NA 2QQAA 3PKBA 1SD6A 5CDEA 2DYRH 2LKSA 2XGCA 1D1CA 4F91B 1XSXA 3HXLA 2EV6A 1UCRA 4JBAA 1ETQA 2CO5A 1GXPA 4XLAA 2FD5A 2BWUA 3OYAA 2P98A 3O6BB 1Y0UA 3OL4A 2DXIA 1MBKA 1GT0C 4RGSA 2EZLA 3DEEA 1LQ1A 4XORA 1N25A 5LHGA 2F5DA 3I59B 2IGOA 2P5LC 2QGUA 5BQTA 1XGOA 2RGVA 4U0WA 2V3XA 4R8HA 1XMXA 4XM3A 2IA2A 2HPMA 4DZPA 4DGWB 2OF7A 3OY9A 2MD5A 3C3WA 2KPMA 4OOKA 2WWYA 1X1DA 2ZB9A 1J59A 1MNMC 1Y6IA 5ICCA 2AO9A 4C3IJ 4ZZDA 5K5RA 1WJFA 4RM3A 1ZR4A 2V3YA 2M87A 1LUJB 2O3FA 1BN5A 2M5WA 4F55A 2RREA 4YIIA 4XONA 1W36D 3PJRA 3PO2J 2GTXA 2O03A 3FM5A 2VB6A 5LLQA 3Q3SA 4Z7MA 2DQLA 3QAHA 1O3SA 2OV7A 3A0BC 5DUKA 5FFXA 1YITI 5IYCJ 1XCVA 1BR2A 2G7HA 2R4GA 3OOPA 3OR1C 5F1RA 1WH5A 2ZJPF 4UUVA 4FASD 4ESFA 2N8GA 3PFIA 5E1WA 5F08A 4BBRJ 2HGCA 2MSYA 3B02A 1WFXA 3QU6A 1ONVA 1MDMA 4HF1A 2G9WA 2H6CA 2FUG2 2K85A 2W57A 5J6XA 2NOJB 1Y56A 1FZPB 3BCBA 2LR8A 1I27A 3CP2A 3NWSA 3GVAA 2W82A 4OAZA 4PFPA 3BR2A 1I50J 1GHCA 3FIWA 4Y7NJ 4E7LA 2LREA 2XRNA 3BP8A 4L5JA 1BW6A 4A5MA 5KAFC 3OL3A 2H8WA 4EGZA 3HOTA 1X1BA 2FBHA 2M4KA 3MWMA 3NEUA 3ELKA 1W5CC 2RVCA 2EINH 1GV2A 4Q5SF 2A05A 2IGKA 3A1YA 3KPHA 3EUHA 1VFCA 1FJLA 3GLXA 3ZQIA 1NH3A 3HJEA 3EYIA 3F72A 5JHUA 4BHBA 4OAYA 5DCMB 4ZYGA 3QRFF 3HOYJ 1PP8F 4IHTA 2KDOA 4PGGA 1W7PD 1YJ3A 3ZR8X 2Y2ZA 3IRQA 2Q2EA 2VQHA 4CCNA 4RAYA 2EZHA 2GG8A 2AQFA 2ZJQF 1YTYA 2CG4A 2XIGA 4UV9A 3K2ZA 3CMEI 3L7WA 2WAEA 3MR1A 4G94A 2ZSHB 1TQMA 1IRFA 3D5LA 2B63J 4EV0A 4OIOF 1D3YA 3V8KA 5CLSA 4UUSB 3H0DA 1TNSA 3K9TA 4J01A 1OYYA 4Q4ZF 2F5EA 3VOEA 2HDWA 3FHZA 4ZTFA 2X0LA 3OSFA 1ZARA 4EJUA 2E2HJ 2QM3A 1B9MA 1ZLJA 2Z16A 3PQJA 5HNHA 1WRJA 3MVPA 2WY7Q 1B72A 4KN4X 4NQWA 1VQ9I 4E7JA 4D0PA 1X4PA 4BQOA 3WG9A 2CFXA 5LGUA 1AWCA 5CIKA 2ECCA 1YIJI 4MQ9F 2R7WA 4PJJA 2A61A 2EVMA 5EF6A 2LBFA 2VIXA 2OD5A 4PJ0C 3GO5A 1FBSA 2JRTA 1GLNA 4IQ4A 2DYSH 4EATA 5L3CA 1WN1A 1FPQA 2BHCA 2EFPA 5GTHC 4CYCB 4C2TA 4OMZA 3GLLA 5DV5A 3WE2A 3DF8A 4D5CA 3H92A 1XDSA 1HW5A 3FX3A 4DYCA 4E7KA 2CUJA 1RZ4A 3DBLB 1R49A 3CC2I 3PKDA 3HOUJ 3S3NA 5LBQA 4DBRA 4IU6A 1TWGJ 3F6OA 1MBJA 4S2RP 2XGXA 1UB9A 4I0BA 1HLVA 2XGDA 3K1PA 3HPGA 4GDFA 5ILSA 5KAIC 3SEQA 4MEYF 2BVLA 2J5OA 3NQOA 2BW3B 3O8GA 1MSFC 2L02A 1PUFA 1TWFJ 1ZG3A 1S72I 3WTTC 2BBYA 3TEDA 2IS1A 1EH7A 5DUIA 1YW9A 1QHHD 1N75A 4F3QA 3L24A 1QRYA 1Y1VJ 3QYBA 3TL4X 3TO6A 2IW2A 4X6AJ 2M7AA 3G1LA 3PNVA 2E1OA 1M1EB 3NRVA 3TKYA 2DMUA 3I3LA 4UVAA 1OISA 1Z7LA 1V5GA 2M0CA 2XKPA 3OYDA 3LQQA 3IWFA 3CTAA 3ZMTA 1LVAA 1AKHA 2CFOA 2F48A 1XC5A 2Y9ZA 1ZKGA 3K70C 2BXYA 2FA5A 1QZZA 2BWYA 5F6FA 1SMTA 3E1SA 4FLIA 3ABTA 2QENA 1UG2A 3MZYA 4M3DA 3WTYC 3TO9A 2FJ1A 4HLXA 4DYQA 2M1BA 2JT1A 1ETKA 2VC1A 3FBIB 2F4IA 3L7GA 3FHNA 1B8IA 2OJED 1YIOA 3I54A 2CQKA 2X6WA 2Z3YA 4IRGA 5CE6A 1TT5B 1ON1A 2OKNA 2BZTA 2R3SA 5IT9Z 3F8CA 1IF1A 3S3MA 2RN7A 2DFFA 2M30A 1YI2I 2STTA 2XAQA 3LSHA 1IN6A 2HS5A 4XK4A 3RZDJ 3BR6A 4A3GJ 3RKWA 5GAGJ 1YYVA 4UV8A 4JUQA 5AIQA 1GVJA 3QYFA 2CQNA 4BEHB 4UXNA 1ETOA 5E20A 1P6RA 1J0RA 1F4KA 2DODA 1RESA 3K2AA 1JJ8C 3JAMK 1R4MB 3LSRA 3WTVC 1KU9A 4U0VA 5D4RA 5DD8A 3J7AY 2FQ4A 2OC6A 4LG0A 1U5TA 3BG6A 3F0CA 3S15J 3ZQGA 4XLEA 2EJRA 4S2TP 4A3EJ 2FE3A 2BWWA 2V1NA 2P99A 5K7HA 1WLRA 1NTCA 3GTGJ 3EYYA 1LVKA 2YPRA 3O3KA 3CF2A 4XMYA 5CPRB 1OR7A 2GXGA 1EKEA 2W24A 2B3KA 3KP2A 2EA2A 1PYVA 3OYLA 5HNFA 3L2QA 1F1ZA 4I98B 1ZG1A 1ZYRF 4MTEA 2D5VA 1S8NA 3SZGA 5FFZA 3QPTA 4XKWA 2M2EA 4KUMA 2WY8Q 1E3OC 5GAEJ 3ROUA 1QNTA 3FKJA 1QPIA 4HA8A 1GVDA 4AD9A 3JCUC 2XB0X 4AC0A 4DYRA 2PMHA 1FNNA 1SMYF 2MH2A 3REOA 1I3QJ 2H94A 3EUKL 5CQGA 2LMDA 2WC2A 3WU2C 2Q96A 4E7ZA 3CESA 4I6ZA 1TLHB 1IGNA 4XLFA 4UVCA 2OTLI 4BXUA 4Y17A 4MEXF 1R58A 4E4HA 2AXLA 1YQAA 3LFKA 3PNTA 2HOSA 5F0HA 3E6CC 1WCMJ 1F43A 2V7FA 1IN8A 2VOPA 2GZ5A 2H1KA 3H9QA 3ABUA 3FK7A 3IU9A 4AVZA 3AG2H 4RB3C 1BR4A 2YSRA 2ICWG 5J8CA 3UKGA 2O6GE 3GTKJ 4KISA 1IDYA 1SVMA 4L9JA 4A6EA 2ID3A 2PEXA 1X3UA 2LNBA 3N4MA 3T8TA 3H5RA 3CUQC 4G6TB 3W6KB 1YO5C 4EJWA 4B47A 4CZCA 2CUEA 3C18A 4O3MA 4H0EA 4G7HF 3AL0C 2DA5A 1SD5A 1Z3YA 2R0QC 4ZNGA 1MH4A 1D0ZA 2O9LA 4A3BJ 3DU6A 2ETHA 1HXDA 3LSMA 2PI0A 3HOWJ 4A3MJ 1MW7A 5FKKA 4XKCA 4XRMA 5EZGA 2IGMA 5FROA 3S1RJ 1XSVA 2NVQJ 1JHFA 3FXLA 3JRAA 1QXZA 3LMMA 1MBFA 4U7DA 3CZ6A 5F04A 4RBOA 4BJTA 1T98A 1Y39A 2EFOA 4EM1A 3U21A 4CHUA 4DBQA 3N97A 4QPOA 3CDIA 1IXCA 2NAZA 3CCLI 2DMTA 3K1NA 3C2HA 1IRXA 3I4PA 4V2FA 4BDYA 1G59A 3S1NJ 4DW6A 4AIDA 5M3FJ 1TW2A 1V5FA 3CDHA 3ABLH 1U2WA 1S9HA 2ZFWA 4HSTA 3S17J 4KT5C 5C4JJ 4L9TA 1HF0A 2R5YA 3T0YA 2VL8A 1JHHA 4XN3A 4BJ6C 5HLTA 4MTDA 2HEOA 2FOWA 5D6EA 5E8IA 1PUEE 1ZH5A 4XR6A 1FOKA 1Q1VA 1FMWA 3AG1H 3CCYA 4HG2A 2FXAA 3J80Z 2YUSA 4G12A 1BC7C 4LG3A 5JFRA 3RKYA 3GTLJ 4AIHA 1T33A 3VB2A 3VYTB 2J5PA 1RPWA 2XAFA 4KIBA 3NARA 2JRMA 2OAZA 1RIOH 2QQBA 1TWHJ 1SFOJ 5CDLA 1A35A 3IUOA 1D8JA 4PNCA 1QXYA 2DK8A 2GM4A 5FKNA 2ZC2A 4X1EA 1OLTA 3GZNB 3MD2A 3F8FA 3ZOBA 3LNQA 2GBYA 4PV4A 1ZELA 1U8BA 3BIQA 4HOBA 3A0HC 5LEKA 4S04A 4RB2C 2LVSA 2DFEA 1AA7A 2HPIA 2ZSIB 1U9OA 3BTLA 4HLYA 1Y1WJ 2L01A 3SHFA 2DDAA 5HODA 3HL2A 2IA0A 4BE2A 1VQ4I 4NHJA 4N0BA 1SAXA 3ULQB 2EZKA 1I6HJ 1R22A 1WWXA 4ESBA 2V6EA 2V1DA 1S7OA 3HEFA 4U70A 3CMYA 3AL0B 2ISYA 4LB5A 1D8KA 3K4BA 2KJCA 2VJ5A 1W4MA 2Y75A 3CLQA 2XPUA 1HQCA 4JYKA 3ZN0A 2Q94A 3CCMI 2DAOA 2G0EA 2NYXA 2P8TA 3L00A 2O5RA 3MFKA 2ELJA 1BI3A 4GCVA 1WGXA 2HU9A 2BVMA 1B72B 4NQWB 2DPDA 3DEWA 2CW7A 1TC3C 1PDNC 2KRCA 3FDYA 3TW7A 5F64A 4FO7A 5FCFA 2OA4A 2V1UA 3F8MA 2MLGA 3BR0A 3FK6A 4XNFA 4ANJA 3GX4X 3FKIJ 3P5JA 2LBFB 4FO8A 4ZH4F 3GFJA 2FF4A 1VQMI 2DI3A 1T2KA 2L9VA 1W7PB 1T8IA 3CCQI 4HF2A 2O8KA 2VASA 4MHGA 5JR3A 1GUUA 2GA1A 3F9KA 2XKOA 3QPLA 4BGDA 2E5NA 4QLCU 4BDZA 2FX0A 3WU1B 3BJAA 2MLKA 3K4MA 2BY2A 4KIFA 3AAFA 1HKSA 2XSJC 3A01A 1IN4A 1MBGA 3IKVA 1XSDA 5DCFA 3A4CA 4K2EA 3RSNA 1A6IA 4O6JA 5IY5H 3DLLF 3EUAA 3HHHA 2X4HA 2JSPA 2HOWA 2XSDC 1LE8A 2NOGA 3BLYA 2OUMA 2HDDA 2MD0A 3S2HJ 1Y8QB 4OMYA 1QBJA 3RDIA 1UG0A 3W6VA 4UVBA 2CS3A 3FXRA 3H1CA 3SDGA 4ABZA 1RR7A 2PJPA 1PUFB 1B9NA 1RUOA 2BWVA 5CJ9A 3OMYA 4FE4A 3KYDB 5GAHJ 1O57A 2PMZA 1D0XA 3H36A 2CWEA 1LB2A 1BJZA 3OYJA 1TBXA 4Y3OA 2R7ZJ 4D9JA 5L3BA 1WH7A 4HNTA 4RLQA 5E8GA 1DP7P 3JTGA 1JAWA 3OS0A 2B3HA 4ZYAA 1S29A 3TGNA 4P96A 5EZHA 2LY1A 4B3AA 5ILUA 2DA4A 3GWZA 3BJOA 3HYIA 4YFNF 4A6DA 1UELB 4HDUA 4L5EA 1OCZH 3ZRGA 2Z2SB 4ZC3A 4CCJA 3CLOA 5IT9K 2OU2A 1WL6A 2K5CA 1GV5A 4S00A 4IEJA 3MCZA 3HRTA 3VWBA 1FYLA 1U9NA 2KHMA 3K10A 3ZGKA 1U8RA 1FBUA 2RV8A 1TZLA 2WA0A 4HSRA 3RVAA 1B8IB 4FX4A 1KQ9A 2ZNYA 3DWLE 3IWZA 1DQUA 3M1CA 1T6SA 1P4WA 2JUCA 5L3FA 2A6TA 3E6BA 2CSOA 4KN7X 5LHIA 2ZSGA 3OIPA 1OKRA 3QP6A 5JVTA 2X6YA 1MJAA 2F4OB 2XF6A 4C3JJ 2F5FA 2NS8A 1OCRH 4GYIA 1MMNA 3PSIA 4M72A 2HWVA 2EB7A 2Y9YA 2LOOA 4HNUA 2IPQX 5IOZA 1LNWA 5DM6F 2E1CA 3RZOJ 4JOMA 1CHMA 2EPFA 3IV5A 3QYEA 2GQQA 1BI0A 4JX5A 4L18B 5DEQA 2HKOA 1DPRA 4LG0B 1U5TB 3H5NA 2PMZN 2EA4A 1P4AA 2KISA 5J8FA 4HQMA 1T0FC 5E1XA 3DKXA 2MW8A 2VXDA 4N9IA 2XDVA 2Q8KA 4HZFA 2ZBKA 3K4NA 3RQ4A 4M6VA 3OS1A 3ERED 1W1WE 2LFBA 2PMUA 4U1BA 1G4DA 3IAS2 3MX6A 1XX5A 3BCAA 2DFHA 1JKRC 3K0LA 3D27A 1K78B 5AIPA 1ZRFA 4A3CJ 1X1PA 2FBKA 4FLLA 4FQGA 5FD5A 1IW7F 5M5XJ 1MSEC 2DA6A 2R7XA 2BWXA 2BHAA 1XCBA 3FM3A 3KE2A 3CCJI 1JKQC 2GU4A 2M3AA 5JHFA 1FOWA 3DPTA 2ZJ2A 1FMVA 1PJRA 2CYYA 3JSOA 1SFUA 2VKHA 3FISA 2GU5A 2Q92A 3JTHA 5TISC 3PO3J 2EWNA 4IHXA 4MO7A 2Z99A 3G4SI 4KICA 4CCOA 2V1XA 1CQTA 1IAWA 4BNCA 2Y30A 2YU3A 1B4AA 4LK1F 3CCUI 5ED4A 2EIKH 4UUTA 4CGZA 2JVHA 3GFLA 3CC7I 3LA3A 3HOXJ 4S05A 4RGZ1 4XLPF 2GOXB 4RGUA 4KMFA 2HOEA 1M35A 4KDPA 4OIRF 1MNEA 2Y0SA 3GYHX 5F1JA 3Q0UA 3PIPF 2GG0A 3RTRA 2L54A 2M34A 2RNGA 1S5LC 4P9FA 5CVJA 1VZ0A 3M8JA 3BG9A 4CICA 2W7NA 1R5ID 4F7ZA 2P81A 3TBIA 1YJNI 2E36A 1UMQA 2BY0A 2KRFA 5H2FC 1HW1A 3CCRI 1N78A 2XB5A 1WJCA 5E3LA 3R60A 2E7WA 3V7CA 2B9SA 3OIOA 1W2MA 1DGRM 3S32A 3PIOF 4M74A 3OS2A 4FLJA 2D45A 4U76A 3G6EI 2QKMB 3HRSA 1X2NA 2BN7A 5HS7A 4BXFA 4I7HA 4FTHA 3BPXA 3BR1A 1IC8A 1TWCJ 2F2EA 4HYEA 3ZQQA 4B43A 2R5ZA 2IA1A 3BOQA 5FGMA 5FRMA 4UY8I 4W1UA 3D0SA 3A02A 2HTSA 2DOFA 3BDDA 4NUBA 2DA7A 2L7KA 2BHYA 1BOBA 1BW5A 3U9GA 2GG5A 2HYJA 3J80K 1FTTA 1XGNA 4NC6A 4D1QA 3BPVA 1MMDA 4E70A 1WJ5A 1Z6RA 1MNDA 4BH9A 4BU2A 1PP7U 3HOZJ 2R7FA 1KQ8A 2BXZA 2CUFA 5FKMA 5D5UB 3S1QJ 1WZ2A 3BQZA 1V55H 4CYDA 4U7BA 5L3DA 5TGTA 2VBZA 2GG2A 3V4GA 5EG0B 4TV7A 2Y0SN 4D7NA 2QBYA 4WF2A 4ZDOA 3P9IA 4C9YA 2GXAA 4ZJZA 2OZ6A 3L2RA 4XLNF 2BHZA 4EMSA 1VQLI 4PFOA 1F9NA 2K86A 3RYRA 4OOIA 2GG7A 2H6BA 4WXHA 1S7AA 5FKOA 2A07F 2VXZA 1C23A 2R7RA 3VSLA 3HSEA 3WHCA 4QTRA 1K83J 5FLMJ 1XNZA 4L9NA 4A3KJ 3IG4A 3LSGA 1YRNA 4EJOA 2HQRA 2M7BA 3R4KA 3S2DJ 3F23A 3DLAA 2W1OA 1FOYA 4Q47A 1WJEA 3EQLF 3JRBA 1U3EM 4DJAA 2LRDA 1HC8A 2LD5A 2QSFX 2UWMA 1N51A 3S93A 2JA6J 1BA5A 5DS9A 1CF7B 3HB9A 3KP7A 2EK5A 2IP2A 2KQRA 2COBA 1SD4A 2KP6A 3KX2A 3LQRA 1H89C 2I10A 1X3ZB 1YJ9I 1J09A 3HZJA 2P5KA 5IP6A 2D1HA 1R5GA 1T56A 4BY1J 1OYWA 2KL4A 2JJ7A 4I76A 4ZTJA 4RA2A 3G71I 3S14J 3FXMA 2FEZA 2KIMA 2A68F 3C2GA 3MQ0A 2LK2A 3RPQA 5H6RA 2VQGA 5D5WB 3HTSB 2HZTA 2RAEA 5D6FA 3R61A 3RCOA 5E3MA 5D8KB 2WTEA 3A03A 3WTUC 1BIAA 2CQQA 3DP7A 4IL6C 3V7SA 1HCRA 3WGIA 2CGPA 4ZWPA 3G1OA 3I71A 2L3DA 1VTNC 2GU7A 1NK2P 3L2VA 3K4CA 1ZGAA 4I02A 4IKTA 2H09A 4WK8F 2D1VA 1MMAA 2UV1A 4D5FA 3T8RA 2E1MC 2FMYA 1V5EA 4C30A 1D5YA 5LRSA 3W2WA 4CXFA 3CCVI 1LE8B 5LEJA 2H8RA 4S01A 2PFBA 4ZYHA 1JGGA 2DU9A 3KIOA 2WB1A 4XBFA 4KFCA 3ECHA 3I58A 2BOLA 3S8PA 3RJPA 4BUPA 2JSCA 4BY7J 3G3ZA 2EIJH 4IF4A 3CCSI 4NC7A 4BL0B 4EJVA 2HDCA 2L4MA 3JSPA 4KM3A 1P7JA 3H0GJ 1VQNI 1XB4A 3MKLA 4Y13A 2M8GX 2QEXI 1JUMA 1LKXA 3OYIA 5CVRA 3WHBA 5FLVA 3RQIA 3MKWB 3WTXC 2HOAA 2CMPA 1K4SA 4IHWA 1IO2A 4Z6YA 3SFIA 2JPCA 2DTRA 3CDLA 4IOAF 4A6VA 4I09A 3E5QA 4CCMA 4OIQF 1ETXA 3ASOH 3WG7H 3FMQA 4YELA 2NXNB 3JRFA 1JTXA 3BQYA 2VE9A 4UNOA 2W85A 1JGSA 1TP4A 1T39A 2KT0A 4IPAA 3DPLC 2M0MA 4XOPA 3CD6I 2VQLA 2VLAA 5IOYA 1POGA 3PKCA 4MQVA 4ITVA 1NG6A 4IKRA 4QWQA 2HQNA 5KVRA 4OINF 3JRIA 1WPKA 1X4OA 5M3MJ 3UNGC 1ZN2A 4AYBA 2DDBA 1MD0A 5HOOA 3IKTA 2WBMA 1ACIA 3KP6A 5C44J 1YG2A 5JI6A 1MGTA 3R6SA 2ZFUA 4IRIA 4XKVA 2BV6A 3HHGA 3CP8A 1J5YA 1G3WA 5EEHA 4HX8A 1JJ6C 2RKHA 4FETA 1FY7A 1G3TA 1MJ9A 4ZWUA 2HQAA 4II3A 4Y33A 3W6JB 3BITA 1LFPA 3L2CA 1EA3A 5C3EJ 4IHSA 1YW8A 5D5XB 2E1MB 2EVOA 4WXCA 1C21A 1EV7A 2HOTA 5EJCA 3F8BA 3OYGA 2LF8A 4DQ2A 1DU0A 1ZQ3P 4L0ZB 1QXWA 3LSKA 2PN6A 4L0YB 1OPCA 4FLKA 3GZ5A 3OYHA 4BXXJ 3I59A 2EBIA 2BE5F 2F5CA 5FO5A 1MZBA 3EUHC 1W36C 2TRTA 2GIZA 1UHMA 1R36A 2L9NA 3M3YJ 2LYCA 3LSTA 3LOCA 3D5SC 4XKBA 4HEA2 5ERIA 4B3XA 5K7FA 2LTPA 4EGEA 2EH3A 5HS8A 3DCFA 5HLIA 1CGPA 3CJNA 1EH8A 4CUGA 3E97A 2P7CB 1QVTA 2VN2A 5FCHA 2E60A 4B44A 2TDXA 3DEUA 2KKOA 3BTCA 2MA3A 4YRVA 3V8JA 1C0WA 2Z5UA 1OCOH 4KNYA 1FX7A 1E2XA 2E1NA 3OYCA 1VQ7I 1LEBA 1BC8C 2ESNA 2ZMEA 4PGHA 3J7ZI 4A0XA 5IYDJ 3SEZA 1YS6A 3VYSB 1IZ1A 2L9SA 1YFHA 2XAUA 4KA4A 3M9AA 3L1PA 2KFDA 3OIQA 3ZQHA 4A69C 3NWTA 4BBSJ 2DMPA 2PJRA 4R79A 1S3JA 2L2OA 2QVOA 1IXSB 1P4XA 3H9JA 2MFZA 1LPQA 3M4OJ 1QZYA 1FTZA 2LLKA 3F8NA 4V19K 1E17A 1BOAA 1ITYA 5K5QA 1W5SA 1C24A 2NS0A 3JRCA 3BJ6A 4RB1A 1DGWY 2GGCA 4RGXA 2DOAA 2XASA 3P9CA 2JA2A 4L9VA 3PUFA 5HDKA 1MDMB 3V42A 4CDGA 4IKSA 2A5YB 4CA0A 4U71A 1ULYA 1A36A 4IKFA 5IP7J 5BPDA 4EM2A 1V4RA 1K6OA 4LMYA 1A5JA 3OYFA 3U1KA 1D5VA 2V4JC 1S7EA 1R6RA 5KCMA 3H9GA 4IHYA 1E3PA 2VJJA 1ETWA 4OU0A 1JTYA 2CJJA 4PK4A 3VDXA 2P6TA 1KQ0A 3ZMVA 1RC9A 3WE3A 1Z77A 3LAPA 3S3OA 5FKLA 1J9IA 4U6WA 4DOZA 1OFCX 3A2KA 2R5ZB 5C4XJ 2QSHX 4FHTA 3G73A 1QA6A 4B4CA 3ECOA 2Y0MA 3M1EA 2LH9A 4FE7A 3L2UA 3Q9SA 1ZREA 5J40A 3V8LA 1OQYA 2A6EF 2DFIA 3F22A 1MBEA 3WGHA 3J7YJ 3CQZJ 1GXQA 3FXQA 4HBLA 2STWA 3BIPA 3EPZA 2I8DA 2X1DA 3Q0WA 2X51A 2ID6A 2Q2EB 4LK0F 5DD4A 2QUFA 1J75A 5DYMA 1HW2A 2E34A 1UHWA 5BOXA 2HNHA 1ORKA 2COMA 1K7AA 3HKZA 1SD7A 2A5WA 3HGGA 4NNJA 2ZXIA 2HKXA 2Z9OA 1IRGA 1JI8A 1SFXA 3U2RA 3ONQA 3I4MJ 5D4SA 3AFHA 4RB0A 2LKXA 3RPUA 1H88C 3VFZA 3DBRB 1ODDA 2RC4A 3HOVJ 2VQCA 1BM9A 1T38A 2CV1A 2QQ8A 3GF2A 1USTA 4LJZF 3WTZA 1ETVA 2JVGA 1FC3A 3K7AJ 1YRNB 3BROA 1R4NB 5FLXZ 4RZZA 2XAHA 3W3CA 3OYNA 1MH3A 5D5VB 1BBYA 2MYSA 1C27A 4ENNA 5E18F 2WAQA 4A6WA 4I2OA 1VQPI 2W4SA 2HXOA 2LG4A 5M5WJ 1ZAOA 2DQRA 3BTIA 4M6YA 2L0KA 4DZJA 2ZJRF 2X6XA 1BI2A 1VQ6I 4A93J 2ELHA 4KMUX 3I56I 2Y69H 2ACJA 3JREA 4LGWA 2R7UA 3U1DA 2K9LA 4XOTA 2XAJA 2HQ5A 1FWZA 3LA7A 3OSGA 1B59A 1QU3A 3BT9A 2E7XA 2GU6A 3RKXA 2I5UA 2VE8A 4LLGF 2CQXA 1YX3A 1LJ9A 3IHUA 5L3GA 1FSHA 2OBPA 1JE8A 2EV0A 2UXXA 1ZG5A 4JX4A 2VODA 4MFEA 5CKTA 1U5TC 2VUMJ 1G8XA 2K3PA 3ZCOA 2X1CA 5JVGF 3DFGA 1WI9A 4U69A 3HOSA 2X9DA 3DKYA 5H20A 4BE1A 3J7AO 1G3SA 4ZDPA 2JA7J 1FP1D 4YFKF 5HVQC 2YS9A 2W84A 4M71A 1OR7C 3LSJA 1XD7A 2VKDA 5LRRA 3WGGA 2XAGA 4HF0A 1WI3A 1R5HA 3PUBA 1Z1DA 3MATA 2PQ8A 1Z67A 4B09A 3HC7A 3AKZA 2Z1DA 4M3GA 1JUSA 1X3WB 1HA8A 2GWRA 1AKHB 3LFUA 1IG7A 3HSRA 2GLOA 3GZ6A 4M3EA 4BAYA 2A69F 1PV9A 4A3DJ 4CZZA 2MC3A 3VSKA 1FEXA 3SXYA 5GPAA 3OWTA 1WJAA 3PKAA 2FBIA 2WAQN 3JW4A 4BS9A 1HSTA 4DNCA 3WTSC 4BQAA 1J2XA 3H35A 4AWXB 3RKQA 3O2PE 4B8XA 3D5RC 2OQGA 2V3ZA 1I1GA 1TW3A 3V7RA 2JWTA 4A12A 1FOXA 1KZHA 1DPUA 3QP5A 4XSZF 1TTYA 1Z21A 2VPRA 1J7KA 2XF5A 2D2WA 2UZKA 3MKZA 1WY2A 1G3YA 2LDUA 2MATA 1UJ8A 3QPSA 1XG1A 4A3LJ 2VC0A 3OOUA 3H3VK 4C2MJ 2X6OA 2QQ9A 5HLHA 1ZGWA 1TQIA 2EV5A 3KCCA 4IO9F 2G6PA 1Y8RB 3E6DA 4XIDA 2IBDA 3IRRA 3C7JA 2XGEA 4U87A 4QPQA 5BPIA 3R0JA 1KP0A 3KEQA 1XMAA 3BTJA 5A2QZ 4JX6A 5B1BH 4PZJA 1IDZA 2PG4A 3ZMDA 2PLYA 2L7ZA 4HNVA 1WSUA 5IYBJ 4LLNA 1WL9A 1FYKA 3RIRA 5M5YJ 4BE0A 4PDKA 2O61A 2Q0OA 1Y0NA 1YX5A 3L2WA 1QVUA 3LAJA 3O8HA 5EGOA 2BHBA 3TMOA 4ENKA 4PJLA 2UXNA 2XHKA 5E17F 1I1SA 2IRFG 4M9ZA 3WODF 2DT6A 2EIMH 2X48A 4KJZA 2JUGA 1Z0XA 3EETA 4A2UA 1B1BA 3IL2A 3CF5F 1VQKI 4C3HJ 1IUYA 4KYWA 3HGYA 3NAUA 4PSWA 4YIFA 2K9MA 3SDBA 2GG3A 2ZKZA 4ENJA 1RUNA 2BY1A 2NVYJ 2LY9A 4IRHA 4GO1A 2OZUA 3K4JA 4AU7A 2OPTA 3ASNH 5J1YA 3HTUA 4RAGA 4CCKA 2Z33A 2BY3A 2BWSA 3OYKA 2V9VA 2HXIA 2IJLA 4PCQA 4EVIA 2O7OA 4HAMA 1IV6A 2VBYA 2ISZA 1REPC 3ML6A 1BR1A 1FLIA 1S6LA 1W0TA 4IQJA 5BNGA 2GZWA 5BS6A 3QPHA 3DTEA 2L9RA 2K27A 3GUDA 2R7OA 3RYPA 3K1MA 3I53A 3ZMZA 4MNUA 1Z3XA 2RQPA 2QLZA 5AONA 1R7JA 2ZMEB 2KDZA 2K9SA 4M3BA 3ISPA 4LLLA 1VQ8I 3MZ8A 5CQEA 2PX9A 2GG9A 2WADA 2YR2A 2VT2A 2KRHA 4BJ5C 4F52A 1ZTRA 5EYRA 4A3JJ 2E2JJ 2PJRB 3F6VA 3ZQ7A 2R7TA 2R7SA 2CUZA 3DXJF 4WCGA 2LY2A 5ICGA 1Z91A 4F92B 3VYRB 1VNDA 1QZEA 3KEOA 1ZRCA 4EGYA 3ABMH 2ZXHA 4BYYA 2K7LA 2HVRA 4WXDA 5ILVA 1V54H 1R23A 1ON2A 4IHVA 2MG4A 4ENMA 3TDUC 2ELKA 2ZXWH 1XTAA 3M7GA 4HPQA 4NB5A 4P55A 4XLHA 5HS9A 3C1DA 3GW2A 5B1AH 1WJBA 3M8EA 4ESJA 1VQOI 2WV1A 3FXJA 1Z9CA 2DN0A 1MMSA 4RDUA 1BJAA 1LDKB 2BEOA 3BZKA 3TP0A 3VYUB 3J81Z 2NNYA 1UFMA 2R5YB 4MFDA 1FP2A 4LITA 1UZCA 1N77A 5K1YA 3PL8A 2DBBA 3D1NI 2B7EA 4XLCA 4A5NA 2KJBA 1V3FA 3I0TA 3IAM2 4BQQA 4C2UA 4BKXA 4E7IA 4IZZA 3DPUA 3H5AA 4G6QA 4RLFA 4ETSA 2CQ7A 5LGNA 2KIQA 4U73A 3S1MJ 2X1EA 2EILH 1APLC 4P1WA 1YLFA 2BYVE 2VPLA 2Q93A 4M73A 1XMKA 3I5UA 1TT0A 4CO8A 4GFBA 3CUQA 1OCCH 3JRGA 3E6MA 1XN7A 1P7IA 1WJDA 3MZHA 5IPAA 4Q48A 1G6NA 1WQ2A 1H0MA 1UAAA 2C6YA 2JA8J 1A31A 2K4JA 1WHUA 1VQ5I 3E7LA 3LA2A 1H8AC 4LFUA 5CVIA 5LGTA 1E0EA 2G7UA 3N05A 2QA4I 2JK3A 3R0AA 4L5IA 1O3QA 2MABA 4GXOA 5FLXK 2V9KA 2IW5A 4J00A 2DOEA 3T5XA 1JKOC 4B48A 1IXRC 4H4KC 1D1AA 5GTIC 1XDUA 2QZ8A 3QU3A 2K9QA 3UR3C 4Y15A 3W2AA 4KITB 3KFWX 4G8XA 1KYZA 1L0OC 4PSXA 1ZLKA 3CB6A 2O0YA 3LL7A 1VF9A 1UHSA 1X19A 4FCYA 1TWAJ 4XSXF 1W7PA 1FBQA 3IP4B 5F0CA 2QCOA 4IECA 2WV0A 1WBQA 2DO7A 2NVUB 4FT8A 4XRSA 4G7OF 2MH9A 3PQKA 4DIQA 1YOVB 2CV2A 4RM2A 2NNNA 1SVLA 5K5OA 2VONA 1JKPC 1TNTA 1YHQI 4FUKA 3H3UA 1JXSA 3E5XA 3E5UA 3AG4H 3FXUA 3ESWB 4RS8A 2DLLA 2DTZA 2Y48A 1O0XA 3BR5A 2QF7A 3A01B 3MKYB 3KP3A 1MMGA 3CMMA 3HSFA 3DKWA 1E3HA 3GTQJ 2K02A 4IVNA 5KK1A 2KIFA 1IRZA 1BI1A 1W5TA 2WAFA 4JQFA 5K7ZA 1DUXC 2HZDA 4HDVA 2EVCA 2QKLB 4E7HA 1WKMA 2IAIA 2OQRA 2JZYA 3CO7C 2KZVA 5CVVA 4HRIA 1NHAA 2IEKA 4IF7A 2BWTA 2KMUA 2F5VA 2FNAA 3SQNA 4V2GA 2OTJI 1O7FA 4IKUA 1RETA 2FRHA 1Z05A 3M07A 4LB6B 4BQNA 1ERDA 3BZ6A 3IU7A 1Z6TA 5D8LB 1O4XA 4UB8C 2VOOA 1ETYA 3QWLA 1OJLA 1X2MA 2DT7B 4QIWN 5E3NA 3ZQLA 3B6AA 2ZO4A 5GP9A 2AHQA 3HUGA 4PUSA 3TP3A 3W2VA 3PFYA 4N9HA 1K61A 1X1CA 2CV0A 3HDDA 2AS5F 1MBHA 3DU5A 1HOMA 2ME6A 2HYGD 3PM1A 4JP0A 4A0ZA 3HM5A 2LP0A 4CCLA 2ADUA 1ENHA 4EQQA 3SZTA 5EDNA 2L4AA 2Q1ZB 1MJBA 1FIPA 4O5VA 3MN2A 1A6QA 2DCEA 4YFXF 2DA1A 2L7MP 3I64A 2CW8A 5GADJ 3PKEA 1R1VA 2VI6A 4RGRA 4HV5A 4CSWA 5GPCA 1EF4A 2H1LA 3QODA 5B66C 1F36A 2QSGX 1JT6A 5J3LA 3B73A 2ZNZA 2RQQA 3HRMA 3G1MA 1T08B 2V6CA 5A2QK 2CH0A 1HBXG 2NQ7A 3BY6A 1SFEA 2VKVA 3TW6A 4P5OA 4UHTA 5E79C 3ZN1A 2DMNA 1NG7A 1IUFA 5LHHA 1KYWA 1D1BA 2TCTA 4NBQA 2DW4A 2FSWA 4U6CA 2GA2A 4AM3A 5J4VA 4IJAA 1X58A 2WB1N 1SEUA 3CJQB 1SVOA 3SZPA 3GXOA 2YU9J 5E1ZB 2K40A 3FMSA 3VPRA 3FZVA 1FIAA 5J4YA 1SFKA 1I6XA 3CB5A 3FWEA 2LKPA 3F3XA 4B1RA 4A3FJ 4EEFG 3CCEI 3G2BA 1X1AA 1K78A 1DDNA 2RNJA 1XS9A 2NVXJ 4M9XA 3CJTB 4A0YA 4Y4RA 1K4TA 1JUPA 2VJIA 2BH3A 5J1RA 2MC4A 2M4GA 3ZMUA 5EGOB 5J1UA 4XRSG 1EH6A 5FJ8J 2HTJA 3DTIA 3ZXSA 1Q1HA 5KHDA 1I5ZA 2OCEA 3E0JB 2FOKA 4BHPA 2P4WA 4P9UA 5ICEA 4IX7A 3S6BA 2R93J 1OCTC 3PSFA 1DP3A 4U6ZA 3P9KA 1LFUP 3ERMA 5E5BA 3ABKH 4E6KG 1W0UA 5CVUA 1YVMA 4ON0A 3Q0VA 5ICFA 3KYLA 1G2HA 2XRLA 3K6GA 4D7MA 5B3SH 4RZYA 3TB5A 3Q5FA 2MGQA 4AYBN 4HXXA 3GTMJ 2E5ZA 3S16J 1KA8A 4MLOA 1L3LA 1NK3P 3JRDA 4MGRA 5CNXA 1USSA 3KP5A 4GGGA 1DU6A 2W25A 1W7VA 3SYTA 2VBWA 4J19A 5LD2C 2R7DA 1FSEA 2IVMA 2M9HA 4N4OB 4U6EA 2JMWA 2JQ7A 2KIUA 3BR3A 1P9QC 2BHDA 3BG7A 2IGNA 2X85A 4XL9A 1O3RA 2R7VA
chains in the Genus database with same CATH topology
3S2WA 4U0YA 4XRFA 3TOAA 1MATA 4FKCA 1LDJA 3CTZA 4M6XA 1A16A 2V79A 5HDGA 6PAXA 4G9YA 1Y1NA 3KLNA 1OYIA 2NRAC 1BIBA 3EDPA 1T0FA 1U6GA 3RI4A 3DQVC 4WWCA 5DCMA 3GFIA 4I0AA 4EJTA 1F5TA 3WTWC 3F21A 2GXBA 1H9TA 2XVCA 2JTVA 2HR3A 3J81K 1HKTA 5H6QA 3HRUA 2EFQA 4AVPA 1A04A 2YX4A 3T1BA 5FB2A 2DPUA 3L09A 3M8FA 1RI7A 2H27A 2RDPA 1R00A 2A3SA 4HW0A 1FT9A 1O7LA 2IT0A 1FYMA 4AIJA 5HLGA 1YS7A 3WU0A 3HIFA 3ZP5A 2QYOA 2VBXA 1R1UA 2QBYB 3FMRA 3BWGA 1Z7UA 3SFZA 3ZPLA 3P7NA 4KIGA 2HFHA 4M9SA 4G6DA 2GAUA 4IXAA 3ZMSA 3CUQB 4R60A 5DDGA 3LWFA 3KZYA 2FQ3A 3OV8A 3KETA 3GEZA 5L3EA 3KP4A 3GFMA 4ZWOA 4ZYEA 1CF7A 1QQIA 1KU7A 3Q6DA 5CDVA 2Q95A 2BB7A 1AOYA 2M45A 1ZRDA 2ESHA 4U88A 1QO0D 3QOPA 1O3TA 2ZXJA 3VODA 3H3ZA 2O8XA 1STZA 1MKMA 4Z2YA 2K4BA 4GYGA 4HQEA 4LD5A 1P92A 4EM0B 4ZZLA 1RNLA 4YG2F 2JPBA 4ZYDA 4B28A 4BHCA 3KLOA 4MATA 1ZHFA 2BGCA 2MBFA 3Q9VA 2B0LA 1QGPA 3E3VA 2PBIA 4QR8A 1R1TA 1KGSA 2EFWA 3K69A 3TQNA 3TOBA 2P7VB 2YX7A 5CYVA 2XUBA 2XROA 1LEAA 2P6SA 3VEPA 2P5VA 4HV6A 5IT3A 3DV8A 5FD6A 1XGSA 1OMIA 4HX7A 4RAZA 5HDNA 4WX9A 4OIPF 1U78A 2GIVA 1HSJA 3KZZA 1HKQA 4U6JA 4FX0A 4G7ZF 2EFNA 2QWWA 3TDZC 2A6HF 1IN5A 3RORA 2DT5A 1KU2A 2VT3A 5TRDA 1K79A 3IU8A 2FU4A 5TJJA 5BMZA 2NQ6A 2FNPA 1LDDA 3TO7A 2M8EA 3FF5A 2LSOA 4HX4A 4AIKA 4JK1X 1ZGJA 4ASNA 1H9GA 4R1HA 1YW7A 2GGBA 1IN7A 2HYFA 3IC7A 3TAVA 5EEGA 1C22A 1TQPA 2LF7A 3JAMZ 3CO6C 2B3LA 4U75A 2FMLA 4I01A 1B6AA 3COAC 2ZCWA 2P9AA 1P2FA 3MAJA 1QPMA 3L9FA 4IDYA 3MEXA 2DK5A 3CUOA 2CW0F 1XGMA 1KU3A 2XV4S 5CDEA 2QQAA 3PKBA 1SD6A 1XSXA 2EV6A 1UCRA 4JBAA 2CO5A 1GXPA 2BWUA 2P98A 3O6BB 1Y0UA 4RGSA 1LQ1A 5LHGA 2F5DA 3I59B 2P5LC 5BQTA 1XGOA 2RGVA 4U0WA 2V3XA 4R8HA 2IA2A 2MD5A 3C3WA 4OOKA 2WWYA 1J59A 5ICCA 4ZZDA 5K5RA 2V3YA 2M87A 2O3FA 1BN5A 2M5WA 4YIIA 2GTXA 2O03A 3FM5A 5LLQA 4Z7MA 2DQLA 3QAHA 1O3SA 5DUKA 5FFXA 1XCVA 3OOPA 2G7HA 5F1RA 4UUVA 4ESFA 3PFIA 5E1WA 2HGCA 3B02A 3QU6A 1ONVA 1MDMA 4HF1A 2G9WA 2H6CA 2W57A 5J6XA 1FZPB 1I27A 3GVAA 1GHCA 2XRNA 3BP8A 4L5JA 4A5MA 4EGZA 3HOTA 2FBHA 3MWMA 3NEUA 3ELKA 2RVCA 4Q5SF 3EUHA 3GLXA 3EYIA 3F72A 5JHUA 4BHBA 5DCMB 4ZYGA 3QRFF 1PP8F 4IHTA 4PGGA 1W7PD 1YJ3A 3IRQA 2Q2EA 4RAYA 2GG8A 1YTYA 2CG4A 2XIGA 4UV9A 3K2ZA 3L7WA 3MR1A 4G94A 1TQMA 1IRFA 3D5LA 4EV0A 4OIOF 1D3YA 3V8KA 5CLSA 1TNSA 3K9TA 1OYYA 4Q4ZF 2F5EA 3VOEA 3FHZA 2X0LA 1ZARA 4EJUA 2QM3A 1B9MA 1ZLJA 3PQJA 1WRJA 4KN4X 4NQWA 4D0PA 3WG9A 2CFXA 5LGUA 1AWCA 5CIKA 4MQ9F 2A61A 2EVMA 2OD5A 3GO5A 1FBSA 2JRTA 5L3CA 1WN1A 1FPQA 2BHCA 2EFPA 4OMZA 5DV5A 3WE2A 3DF8A 3H92A 1XDSA 1HW5A 3FX3A 1RZ4A 3PKDA 5LBQA 4IU6A 3F6OA 4S2RP 2XGXA 1UB9A 4I0BA 3K1PA 5ILSA 4MEYF 2J5OA 3NQOA 2L02A 1ZG3A 3WTTC 2BBYA 1EH7A 5DUIA 1YW9A 3L24A 3TO6A 2IW2A 3NRVA 3TKYA 4UVAA 2XKPA 3LQQA 3IWFA 3CTAA 3ZMTA 1LVAA 2FA5A 1QZZA 2BWYA 5F6FA 1SMTA 4FLIA 3ABTA 2QENA 3MZYA 3WTYC 3TO9A 4HLXA 2M1BA 2JT1A 2VC1A 3L7GA 1YIOA 3I54A 2CQKA 2Z3YA 4IRGA 5CE6A 1ON1A 2OKNA 2R3SA 5IT9Z 3F8CA 1IF1A 2RN7A 2M30A 2STTA 2XAQA 1IN6A 2HS5A 3RKWA 1YYVA 4UV8A 4JUQA 5AIQA 1GVJA 4UXNA 5E20A 1P6RA 1J0RA 1F4KA 3JAMK 3WTVC 1KU9A 4U0VA 5D4RA 5DD8A 4LG0A 1U5TA 2EJRA 4S2TP 2FE3A 2BWWA 2P99A 1WLRA 3EYYA 2YPRA 3O3KA 1OR7A 2GXGA 2W24A 2B3KA 3KP2A 2EA2A 1F1ZA 4I98B 1ZG1A 1ZYRF 4MTEA 1S8NA 5FFZA 3QPTA 4KUMA 3ROUA 1QNTA 4HA8A 4AD9A 2PMHA 1FNNA 1SMYF 2MH2A 3REOA 2H94A 2WC2A 2Q96A 1TLHB 4UVCA 4BXUA 4Y17A 4MEXF 1R58A 2AXLA 1YQAA 3LFKA 3E6CC 1IN8A 2VOPA 2GZ5A 3ABUA 3IU9A 4RB3C 2YSRA 5J8CA 2O6GE 4L9JA 4A6EA 2PEXA 1X3UA 2LNBA 3N4MA 3T8TA 3CUQC 1YO5C 3W6KB 4EJWA 3C18A 4O3MA 4H0EA 4G7HF 1SD5A 4ZNGA 2ETHA 1HXDA 2PI0A 1XSVA 1JHFA 1QXZA 4U7DA 1T98A 2EFOA 4EM1A 4CHUA 3N97A 1IXCA 2NAZA 3K1NA 3I4PA 1TW2A 3CDHA 1U2WA 2ZFWA 4KT5C 4L9TA 3T0YA 1JHHA 4MTDA 2HEOA 1PUEE 5D6EA 5E8IA 1ZH5A 1FOKA 2FXAA 3J80Z 1BC7C 5JFRA 3RKYA 4AIHA 3VB2A 2J5PA 2XAFA 4KIBA 2OAZA 1RIOH 2QQBA 5CDLA 1D8JA 4PNCA 1QXYA 2DK8A 3F8FA 4PV4A 3BIQA 4HOBA 5LEKA 4S04A 4RB2C 4HLYA 2L01A 3SHFA 2IA0A 4NHJA 4N0BA 1SAXA 3ULQB 1R22A 1WWXA 4ESBA 2V1DA 1S7OA 4U70A 2ISYA 4LB5A 1D8KA 2KJCA 1W4MA 2Y75A 3ZN0A 1HQCA 2Q94A 2DAOA 2NYXA 2P8TA 3L00A 3MFKA 1BI3A 4GCVA 2DPDA 1PDNC 4FO7A 5F64A 5FCFA 2OA4A 2V1UA 3F8MA 2MLGA 3GX4X 4FO8A 4ZH4F 3GFJA 2FF4A 2DI3A 1T2KA 1W7PB 4HF2A 4MHGA 5JR3A 2GA1A 2XKOA 4QLCU 3WU1B 3BJAA 2MLKA 4KIFA 3AAFA 1HKSA 1IN4A 1XSDA 3IKVA 5DCFA 4K2EA 4O6JA 3HHHA 2X4HA 2HOWA 4OMYA 1QBJA 3RDIA 4UVBA 3FXRA 2PJPA 1RUOA 1B9NA 2BWVA 5CJ9A 1O57A 1LB2A 2CWEA 1TBXA 5L3BA 5E8GA 1DP7P 3JTGA 1JAWA 2B3HA 1S29A 3TGNA 4P96A 5ILUA 3GWZA 3BJOA 3HYIA 4YFNF 4A6DA 4HDUA 3CLOA 5IT9K 2OU2A 1WL6A 4S00A 3MCZA 3HRTA 1FYLA 1U8RA 1FBUA 2RV8A 3RVAA 4FX4A 1KQ9A 2ZNYA 3IWZA 1T6SA 1P4WA 5L3FA 2ZSGA 3E6BA 2CSOA 4KN7X 5LHIA 1OKRA 3QP6A 5JVTA 1MJAA 2F5FA 4GYIA 4M72A 2HWVA 2EB7A 2IPQX 1LNWA 2E1CA 1CHMA 2GQQA 1BI0A 4L18B 5DEQA 2HKOA 1DPRA 4LG0B 1U5TB 2EA4A 1P4AA 5J8FA 4HQMA 5E1XA 4N9IA 2Q8KA 4HZFA 2ZBKA 3ERED 2PMUA 4U1BA 1G4DA 3MX6A 3D27A 3K0LA 1K78B 5AIPA 1ZRFA 2FBKA 4FLLA 5FD5A 1IW7F 2BWXA 2BHAA 1XCBA 3FM3A 3KE2A 2GU4A 3DPTA 2ZJ2A 2CYYA 3JSOA 1SFUA 2GU5A 2Q92A 3JTHA 2EWNA 2Z99A 4KICA 2V1XA 1IAWA 4BNCA 2YU3A 1B4AA 4LK1F 5ED4A 4CGZA 3GFLA 3LA3A 4S05A 4RGZ1 4XLPF 4RGUA 4KMFA 2HOEA 1M35A 4KDPA 4OIRF 3GYHX 2GG0A 3RTRA 2L54A 4P9FA 5CVJA 4CICA 4F7ZA 2KRFA 1HW1A 3R60A 2E7WA 3V7CA 1W2MA 4M74A 4FLJA 4U76A 2D45A 3HRSA 2BN7A 5HS7A 4I7HA 3BPXA 4HYEA 2F2EA 2IA1A 3BOQA 5FGMA 3D0SA 2HTSA 3BDDA 3U9GA 2GG5A 3J80K 1XGNA 3BPVA 4E70A 1Z6RA 4BH9A 1PP7U 2R7FA 1KQ8A 5D5UB 4CYDA 4U7BA 5L3DA 2GG2A 2VBZA 3V4GA 4TV7A 2QBYA 4WF2A 3P9IA 2OZ6A 4XLNF 4EMSA 1F9NA 2K86A 3RYRA 4OOIA 2GG7A 2H6BA 4WXHA 1S7AA 2A07F 2VXZA 1C23A 3HSEA 1XNZA 4L9NA 3IG4A 4EJOA 2HQRA 3R4KA 3F23A 4Q47A 3EQLF 1U3EM 2UWMA 1N51A 1CF7B 3KP7A 2EK5A 2IP2A 1SD4A 3LQRA 2P5KA 2D1HA 1R5GA 1OYWA 2FEZA 2KIMA 2A68F 3MQ0A 3RPQA 5H6RA 5D5WB 3HTSB 2HZTA 5D6FA 3R61A 5D8KB 2WTEA 3WTUC 1BIAA 3DP7A 3V7SA 3WGIA 2CGPA 4ZWPA 3I71A 2L3DA 1VTNC 2GU7A 1ZGAA 4I02A 4IKTA 2H09A 4WK8F 2D1VA 3T8RA 2FMYA 5LRSA 4CXFA 5LEJA 4S01A 2PFBA 4ZYHA 2DU9A 4XBFA 4KFCA 3ECHA 3I58A 3RJPA 2JSCA 3G3ZA 4IF4A 4EJVA 2HDCA 2L4MA 3JSPA 4KM3A 1XB4A 4Y13A 5CVRA 3WTXC 2JPCA 2DTRA 4A6VA 4I09A 3E5QA 4OIQF 3FMQA 2VE9A 4UNOA 2W85A 1JGSA 1T39A 4IPAA 3DPLC 3PKCA 4MQVA 4IKRA 4QWQA 2HQNA 5KVRA 4OINF 1ZN2A 1MD0A 5HOOA 3IKTA 3KP6A 1YG2A 5JI6A 1MGTA 3R6SA 4IRIA 2BV6A 3HHGA 1J5YA 1G3WA 5EEHA 4HX8A 2RKHA 1FY7A 1G3TA 1MJ9A 4ZWUA 3W6JB 3BITA 3L2CA 4IHSA 1YW8A 5D5XB 2EVOA 4WXCA 1C21A 1EV7A 3F8BA 2LF8A 4DQ2A 4L0ZB 1QXWA 4L0YB 2PN6A 4FLKA 1OPCA 3GZ5A 3I59A 2BE5F 2F5CA 5FO5A 1MZBA 1UHMA 1R36A 3LSTA 5ERIA 4EGEA 5HS8A 5HLIA 1CGPA 3CJNA 1EH8A 3E97A 2P7CB 2VN2A 5FCHA 2TDXA 2KKOA 3DEUA 1C0WA 2MA3A 4KNYA 3V8JA 2Z5UA 1FX7A 1E2XA 2E1NA 1LEBA 1BC8C 2ESNA 2ZMEA 4PGHA 4A0XA 1YS6A 1IZ1A 1YFHA 4KA4A 3M9AA 4R79A 1S3JA 2QVOA 1IXSB 1P4XA 1QZYA 3F8NA 1E17A 1BOAA 5K5QA 1W5SA 1C24A 2NS0A 3BJ6A 4RB1A 2GGCA 4RGXA 2XASA 3P9CA 4L9VA 5HDKA 1MDMB 4CDGA 4IKSA 2A5YB 4U71A 1ULYA 5BPDA 4EM2A 1V4RA 1K6OA 4LMYA 1D5VA 4OU0A 2P6TA 1KQ0A 3ZMVA 3WE3A 3LAPA 1J9IA 4U6WA 4FHTA 3G73A 3ECOA 2Y0MA 3M1EA 3Q9SA 1ZREA 3V8LA 2A6EF 2DFIA 3F22A 3WGHA 1GXQA 3FXQA 4HBLA 2STWA 3BIPA 4LK0F 5DD4A 2QUFA 1J75A 5DYMA 1HW2A 1UHWA 5BOXA 2COMA 1K7AA 1SD7A 2HKXA 2Z9OA 1IRGA 1SFXA 3U2RA 5D4SA 4RB0A 3RPUA 3VFZA 1ODDA 2RC4A 1BM9A 1T38A 3GF2A 1USTA 4LJZF 3WTZA 1FC3A 4RZZA 3BROA 5FLXZ 2XAHA 5D5VB 1BBYA 1C27A 4ENNA 5E18F 4A6WA 4I2OA 1ZAOA 2DQRA 4M6YA 1BI2A 2ELHA 4KMUX 2ACJA 4LGWA 3U1DA 2XAJA 1FWZA 3LA7A 1B59A 2E7XA 2GU6A 3RKXA 2VE8A 4LLGF 1FSHA 1LJ9A 3IHUA 5L3GA 2OBPA 1JE8A 2EV0A 2UXXA 1ZG5A 2VODA 1U5TC 3DFGA 1WI9A 4U69A 3HOSA 5H20A 3J7AO 1G3SA 1FP1D 4YFKF 5HVQC 2W84A 4M71A 1XD7A 5LRRA 3WGGA 2XAGA 4HF0A 1R5HA 1Z1DA 3MATA 2PQ8A 4B09A 2GWRA 3HSRA 3GZ6A 4BAYA 2A69F 1PV9A 4CZZA 2MC3A 3SXYA 3PKAA 2FBIA 3JW4A 4DNCA 1HSTA 4BQAA 3WTSC 1J2XA 4AWXB 3O2PE 4B8XA 2V3ZA 2OQGA 1I1GA 1TW3A 3V7RA 4A12A 1DPUA 3QP5A 4XSZF 1TTYA 1J7KA 2D2WA 2UZKA 1G3YA 2LDUA 2MATA 2VC0A 5HLHA 2QQ9A 1TQIA 2EV5A 3KCCA 2G6PA 3E6DA 3IRRA 3C7JA 5BPIA 3R0JA 1KP0A 3KEQA 1XMAA 5A2QZ 4PZJA 2PG4A 3ZMDA 2PLYA 1WSUA 4LLNA 1WL9A 1FYKA 3RIRA 4PDKA 2O61A 2Q0OA 3LAJA 2BHBA 4ENKA 2UXNA 2XHKA 5E17F 1I1SA 2IRFG 4M9ZA 3WODF 3EETA 4A2UA 1B1BA 3IL2A 1IUYA 4KYWA 4YIFA 2GG3A 2ZKZA 4ENJA 1RUNA 4IRHA 4GO1A 2OZUA 3HTUA 2Z33A 2BWSA 2V9VA 2IJLA 4PCQA 4EVIA 4HAMA 2VBYA 2ISZA 1REPC 3ML6A 1FLIA 1S6LA 2GZWA 5BS6A 3QPHA 2K27A 3GUDA 3RYPA 3K1MA 3I53A 3ZMZA 4MNUA 2RQPA 2QLZA 5AONA 1R7JA 2ZMEB 3ISPA 4LLLA 2GG9A 2YR2A 2VT2A 3F6VA 3ZQ7A 3DXJF 4WCGA 5ICGA 1Z91A 3KEOA 1ZRCA 4EGYA 4BYYA 2K7LA 4WXDA 5ILVA 1R23A 1ON2A 4ENMA 3TDUC 3M7GA 4NB5A 4P55A 5HS9A 3C1DA 3GW2A 3M8EA 4ESJA 1Z9CA 1BJAA 1LDKB 2BEOA 2NNYA 3J81Z 1UFMA 1FP2A 5K1YA 2DBBA 4A5NA 2KJBA 1V3FA 3I0TA 4G6QA 4ETSA 5LGNA 4U73A 1YLFA 2BYVE 2Q93A 4M73A 1XMKA 3I5UA 4CO8A 3CUQA 3E6MA 1XN7A 3MZHA 1H0MA 4Q48A 1G6NA 1WQ2A 2C6YA 2K4JA 3LA2A 4LFUA 5CVIA 5LGTA 2G7UA 3R0AA 4L5IA 1O3QA 4GXOA 5FLXK 2IW5A 3T5XA 1IXRC 1XDUA 2QZ8A 3QU3A 4Y15A 3KFWX 4G8XA 1KYZA 1L0OC 1ZLKA 3CB6A 2O0YA 4XSXF 1W7PA 1FBQA 4IECA 2WV0A 1WBQA 2DO7A 4FT8A 4G7OF 2MH9A 3PQKA 2NNNA 5K5OA 2VONA 1TNTA 4FUKA 3H3UA 1JXSA 3E5XA 3E5UA 3FXUA 4RS8A 2DLLA 2Y48A 1O0XA 3KP3A 3HSFA 3DKWA 2K02A 4IVNA 5KK1A 2KIFA 1BI1A 1W5TA 4JQFA 1DUXC 2EVCA 4HDVA 1WKMA 2OQRA 2JZYA 3CO7C 5CVVA 1NHAA 4IF7A 2BWTA 2FNAA 3SQNA 1O7FA 4IKUA 2FRHA 1Z05A 4LB6B 3BZ6A 3IU7A 1Z6TA 5D8LB 2VOOA 2ZO4A 3HUGA 4N9HA 2AS5F 2HYGD 4A0ZA 4EQQA 2ADUA 3SZTA 2L4AA 1MJBA 4O5VA 4YFXF 3I64A 3PKEA 1R1VA 4RGRA 4HV5A 2ZNZA 3B73A 3HRMA 2V6CA 5A2QK 1HBXG 2NQ7A 3BY6A 1SFEA 4P5OA 4UHTA 3ZN1A 5LHHA 1KYWA 2DW4A 2FSWA 4U6CA 2GA2A 4IJAA 3SZPA 3GXOA 5E1ZB 3FMSA 3FZVA 1I6XA 3CB5A 3FWEA 2LKPA 3F3XA 1K78A 1DDNA 2RNJA 4M9XA 4A0YA 2BH3A 3ZMUA 1EH6A 2HTJA 1Q1HA 1I5ZA 2FOKA 4BHPA 2P4WA 4P9UA 5ICEA 3S6BA 4U6ZA 3P9KA 5E5BA 5CVUA 1YVMA 4ON0A 5ICFA 4RZYA 3TB5A 3Q5FA 4HXXA 1KA8A 1L3LA 4MGRA 5CNXA 1USSA 3KP5A 4GGGA 2W25A 1W7VA 2VBWA 2R7DA 1FSEA 2IVMA 4U6EA 2KIUA 2BHDA 1O3RA