1XGOA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 81
structure length 295
sequence length 295
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgoA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgoA01
4FO8A 3IHUA 5CLSA 2M5WA 4MHGA 5D4SA 2PMHA 1O3SA 2EK5A 4M71A 2XAQA 3D0SA 4OMZA 3MCZA 4BNCA 5K5RA 3FM3A 1YTYA 1Z6RA 2XKPA 3N97A 2KIMA 3IU9A 2KKOA 4AD9A 2V3YA 3REOA 3V7RA 2EA4A 2P5KA 3BIPA 3BITA 4A6WA 4PZJA 5FB2A 3MR1A 3ERED 1FSHA 1KA8A 4HXXA 4JBAA 4P9UA 3VOEA 3JSOA 1IXRC 1EV7A 3GWZA 1VTNC 5ILUA 1XDUA 1LEBA 4P96A 3S6BA 2WC2A 3J7AO 3MAJA 3WTSC 3V8KA 2BHCA 4GGGA 2KJCA 1XDSA 4B09A 4HF0A 3GZ5A 2P98A 3ECOA 4U6WA 1XMAA 2ZJ2A 4JUQA 3RDIA 1BN5A 3GFJA 4Y15A 2FSWA 1WBQA 5HS9A 2MH2A 2B3HA 2FXAA 3MQ0A 1KQ9A 2V3ZA 1ONVA 3ISPA 4L0ZB 4IF7A 2Q0OA 1I27A 5CDLA 1AOYA 4S05A 1LJ9A 2HKOA 3I71A 1BM9A 2L3DA 4ON0A 1BI3A 4TV7A 4F7ZA 1K7AA 1WLRA 2HFHA 5HLHA 3GXOA 3KP3A 2Q94A 1B1BA 2BBYA 2VBXA 2GG3A 5ILSA 2ZO4A 4WK8F 5H6QA 4LG0A 3CB6A 3BY6A 2PG4A 2TDXA 4HV6A 3F22A 4RB1A 2GU5A 4FLLA 5E1ZB 3I58A 2QBYA 1ZRCA 3GW2A 4U73A 4E70A 3CUOA 3E6CC 1UHWA 2JPBA 3WTTC 2PI0A 3CO6C 1F9NA 3I0TA 5H20A 1USTA 5E8GA 1KQ0A 1B6AA 3DQVC 1B59A 1FWZA 2PQ8A 2X0LA 4H0EA 5LEKA 1QZYA 3L24A 2CQKA 4ZWUA 2P99A 3HRSA 5LGTA 4PNCA 2FRHA 3VEPA 1R1UA 2A6EF 1LDDA 1FLIA 4DQ2A 2FA5A 1T0FA 2HQRA 4O6JA 4EJOA 1RUOA 1Q1HA 3IRRA 2HOEA 4L9JA 1ZREA 1R1VA 2GG2A 2LKPA 5L3BA 1T39A 1IN7A 4L9NA 1RUNA 2OKNA 5E1XA 4U1BA 3F6OA 1W2MA 4UNOA 2KRFA 2Z5UA 1J59A 1C27A 1PP8F 3H92A 2BHBA 4I0BA 1TQPA 3K69A 4DNCA 3QU6A 4ZZLA 1NHAA 3RIRA 4KM3A 5D5UB 5ICEA 4UV8A 4WXCA 2ADUA 1KQ8A 3DKWA 1A04A 4S2RP 3K1MA 4G8XA 2VT3A 3CUQA 1K78B 1CF7A 1W7PB 3I54A 4A12A 1JE8A 5E18F 2FF4A 5CDVA 3HRUA 4KICA 5J8FA 1S29A 1XB4A 2UXNA 1UHMA 4ZWOA 5FFXA 1YW8A 3CB5A 1TW3A 3C7JA 1O3TA 2Y75A 3I4PA 1YLFA 1R00A 4HF1A 1ZYRF 4CDGA 1LDJA 1FNNA 3I59B 2NNNA 4Q48A 4ENKA 3MX6A 2Q92A 2OAZA 3ZMSA 3IWZA 2QVOA 2DAOA 2NRAC 4RAZA 4GYIA 4U6EA 3PQJA 3HSEA 4G6DA 1XGMA 3T5XA 2E1NA 1FYLA 3P9IA 3RKYA 3ZMTA 2EJRA 2L02A 4OIPF 2RV8A 2F5CA 4KFCA 1OR7A 4XBFA 4KA4A 4RGXA 2CO5A 1HKSA 2Z99A 4LD5A 6PAXA 5CVJA 3MZHA 5TJJA 1LNWA 1XN7A 4YFNF 1ZLJA 1WI9A 1L0OC 3F72A 2NQ7A 2PLYA 2EFNA 3ECHA 3K1NA 1ZG1A 1KU3A 3COAC 1V3FA 2FNPA 4FLIA 1XGOA 4AIHA 2DK5A 4QWQA 2YR2A 2EA2A 5E8IA 5J6XA 1REPC 5BQTA 3LQRA 4GCVA 1MDMB 1HKQA 2R3SA 5AONA 5FFZA 3LFKA 4LLLA 3O6BB 2UXXA 4UUVA 2Y48A 2YU3A 2M30A 3CUQC 3ULQB 3E5UA 2XASA 5LHGA 5D5VB 2MD5A 2IA2A 1ON2A 4OIRF 1ZHFA 1YO5C 3RORA 1SFUA 3CO7C 5DUKA 1KGSA 4HDUA 2ESHA 3CJNA 3ZN1A 5L3FA 3KP2A 3IC7A 3F21A 3L7GA 3LA2A 1QPMA 2PN6A 4ZYDA 4WXDA 1Z1DA 3WE2A 2EV5A 3MFKA 3U1DA 3KETA 1C0WA 1Y0UA 4QLCU 3SXYA 1MJAA 3B02A 1ZRDA 4BHCA 4NQWA 2XKOA 1DPRA 1G6NA 1TLHB 1IN4A 4MATA 3HUGA 2QWWA 4I2OA 3M1EA 2MBFA 2WWYA 5L3GA 5EEGA 2FU4A 3DPLC 3WGGA 3DP7A 3IG4A 5KK1A 2DQRA 1BI1A 2ZFWA 2P6SA 1AWCA 4KMFA 1OPCA 3HSFA 2GU7A 3HHHA 2EVOA 2CSOA 5FCFA 3JTHA 4IECA 5E17F 1H9TA 2RVCA 3RTRA 1WSUA 1MJ9A 1U5TA 2CGPA 3M8FA 3FXUA 4BYYA 1R22A 4G94A 1U3EM 3GZ6A 4HV5A 2O61A 2BE5F 5LRSA 4N9HA 1W5SA 1I5ZA 3E3VA 4RS8A 5K5OA 4FT8A 4OOIA 2DFIA 3JW4A 1XGSA 3EYIA 3NEUA 2H09A 5CNXA 4KMUX 4LB5A 2DBBA 2XGXA 1MDMA 1WN1A 3LAPA 3SQNA 5AIQA 4U7DA 4IRHA 1WY2A 2QQAA 2CYYA 2WTEA 5CDEA 3BWGA 2A07F 2VODA 5D5XB 5HDGA 2H94A 4KIGA 2G9WA 2VC0A 3R60A 3ZN0A 2O03A 4CYDA 2RDPA 2P6TA 3DXJF 1J5YA 4S2TP 2NS0A 3L9FA 2VOOA 1H9GA 5HDNA 1UFMA 4FLJA 4IU6A 3S2WA 2H27A 1SMYF 5DCFA 2XIGA 1SD5A 2OZUA 4BXUA 2PMUA 4HBLA 3V8JA 4YFKF 1Y1NA 1S3JA 3LA7A 3F6VA 4BQAA 2J5OA 2BV6A 4ESBA 3FMSA 4YIFA 4AIJA 1O3QA 5JVTA 3LWFA 2GG5A 1I1GA 1OYYA 1USSA 2QLZA 4LJZF 1KU2A 4EVIA 3TO6A 1KU7A 1Z91A 5DCMA 1WL9A 1KU9A 5FGMA 5HVQC 2AS5F 3PFIA 4D0PA 1YQAA 4WCGA 3BPXA 4FLKA 2O6GE 1SFXA 1F1ZA 1XCVA 3E97A 1U78A 1MGTA 3KP5A 2VT2A 2VC1A 3PKAA 3WU0A 2ZBKA 2L4MA 4NB5A 2V1UA 5IT9Z 3TOBA 4KN7X 2Q96A 4KIFA 2BN7A 4G7ZF 3GFIA 3QP5A 2HKXA 1W5TA 2QM3A 4RGRA 3WTWC 3E6MA 5LRRA 2R7DA 4EM0B 4ESJA 4XSZF 4EJTA 4OIOF 2CG4A 2K02A 4UVBA 3IU7A 4O3MA 1LB2A 1O7FA 4EJVA 1FPQA 5DCMB 2L4AA 3ML6A 3VODA 4HA8A 4FX0A 3RJPA 2HDCA 3I64A 1FSEA 4CO8A 2M1BA 1HKTA 2QQBA 3ROUA 3CTAA 3V8LA 3TO7A 2W25A 3CTZA 3J81Z 3TAVA 4RB2C 1TBXA 5HLIA 2ELHA 3TQNA 4Q4ZF 2PJPA 1S7AA 3K9TA 5CVVA 1C21A 2Q93A 2GXGA 2GG7A 2JSCA 4RGUA 1J75A 3WU1B 4LK1F 5KVRA 4OINF 3M8EA 3BIQA 3E6BA 2GA2A 1XCBA 2ACJA 1IN6A 2IP2A 4I09A 2MC3A 1J7KA 4N0BA 5DV5A 3QPTA 1R7JA 1PV9A 3IU8A 4IKUA 1P2FA 3SFZA 2F2EA 1UB9A 1GHCA 3M7GA 2G7UA 2D1VA 3QPHA 2JT1A 5BMZA 3P9CA 3T1BA 1U5TB 4IRIA 1IXSB 2PBIA 4IRGA 2KIFA 5D6FA 1X3UA 3KLNA 1O57A 2GG9A 1SD6A 1TW2A 1T38A 4HW0A 3EUHA 1IXCA 4U71A 1YW7A 4WX9A 2LF7A 3HYIA 5CVUA 2YX7A 2YPRA 2BWYA 2GQQA 1MZBA 1IW7F 3KP6A 1ODDA 2HOWA 2Q8KA 4PV4A 4IDYA 2A3SA 3DEUA 2FBKA 4CGZA 4OOKA 2DO7A 2DT5A 1YVMA 4IKRA 2DLLA 2V9VA 3HIFA 1WWXA 1WL6A 4U0WA 1M35A 4K2EA 1LEAA 2DQLA 2PEXA 1IRGA 5D5WB 1QNTA 2ISYA 3R61A 4M6YA 3P9KA 3BOQA 1D8KA 1G3YA 1U2WA 2E7XA 2JRTA 1HSTA 2BEOA 2JTVA 2BB7A 4EV0A 2JPCA 2MH9A 4XRFA 5BS6A 3E5XA 4XSXF 3KEQA 4HQEA 4ZYGA 4CICA 3FXRA 4FKCA 1FYMA 5CVIA 3RVAA 1XNZA 3TGNA 2BWSA 4G7HF 2A5YB 1OMIA 2FQ3A 5DUIA 2B3LA 2EFWA 5D8LB 2V1DA 2ZCWA 2QYOA 3I53A 3ZP5A 3CUQB 2VBWA 3T0YA 5JHUA 2EVMA 5HDKA 3FMQA 5ILVA 1CGPA 2FBIA 2E1CA 3AAFA 4R79A 4Q5SF 4R1HA 2QZ8A 2VBZA 1CHMA 3R4KA 1ZGJA 4EJWA 5EEHA 2GZ5A 4OU0A 3QRFF 3VFZA 3H3UA 3Q6DA 4HQMA 4O5VA 4HLXA 3DFGA 5L3DA 1BC7C 3F23A 2EWNA 4I0AA 3G73A 3JAMZ 2ISZA 4YFXF 5FO5A 4EM2A 5F6FA 1BIBA 2MLGA 3D5LA 4HX8A 3U2RA 1TQMA 3WGIA 4U70A 4U88A 3K1PA 2P4WA 1BJAA 3E5QA 1E17A 4A6EA 4XLNF 1PDNC 2L54A 5CJ9A 2EFQA 4EGYA 3O2PE 1IF1A 4B28A 3PKDA 2RNJA 2OQRA 4P9FA 3KE2A 5A2QZ 3QU3A 3TKYA 1QXZA 5BPDA 3EYYA 1HW5A 1U5TC 4M74A 4AIKA 3GFLA 2BHDA 2YX4A 4A6DA 4EGEA 1DPUA 4LGWA 2LDUA 3K0LA 3HRTA 4M73A 1R5HA 3IKTA 3MWMA 2P7VB 4CZZA 1KYZA 1TQIA 2BWWA 1B9MA 2XROA 2EVCA 3HOTA 2A61A 2DTRA 2MLKA 2CFXA 2STWA 2O0YA 1BBYA 1YYVA 1ZARA 4M72A 1MKMA 2P8TA 2F5DA 3JAMK 1H0MA 5FD5A 1ON1A 2BWVA 2H6BA 2ZXJA 1P6RA 1GXPA 5FD6A 2IRFG 3JSPA 3KCCA 4IJAA 4BH9A 5LLQA 3IRQA 4GO1A 3WTYC 5LGUA 3F8MA 1QQIA 1XSXA 2KJBA 5IT9K 5ERIA 3J80Z 4KUMA 3V4GA 2P7CB 3SHFA 5DD8A 3H3ZA 1IUYA 4U6ZA 3HTUA 2GGBA 4I01A 1RIOH 3ZQ7A 3C1DA 1S7OA 4I98B 1YG2A 3F3XA 4IXAA 4PDKA 1A16A 3HTSB 4EGZA 2OQGA 3OV8A 4FHTA 5TRDA 1DP7P 4PGHA 4A5MA 4L9VA 4U6CA 4KN4X 2ZSGA 2QQ9A 2H6CA 1Z7UA 2XRNA 2GAUA 4ZYHA 1BIAA 2CWEA 1U6GA 1XSVA 4QR8A 1TTYA 3T8RA 1YJ3A 3E6DA 5L3CA 2DW4A 4A0ZA 1YS7A 1WRJA 2UZKA 4LK0F 4HAMA 1O0XA 4U7BA 1BI2A 4HDVA 1BI0A 1U8RA 2OBPA 5JI6A 1C23A 4R60A 4LLNA 3VB2A 2RQPA 4L0YB 2VE9A 1T6SA 4HX4A 4L18B 4U0VA 3IL2A 3J80K 2HR3A 3ZMUA 2KIUA 3DPTA 4BAYA 2GWRA 2DI3A 3I59A 3O3KA 2EV6A 1EH8A 1YS6A 2GU4A 4U6JA 2D2WA 5IT3A 4BHPA 3C18A 2VE8A 1R23A 2G7HA 1G3TA 2OZ6A 3L00A 2BWUA 3KZYA 3KZZA 4UV9A 2QUFA 5FLXK 3F8FA 4ESFA 1PP7U 2BHAA 3TB5A 4WXHA 3FF5A 4BHBA 3CDHA 3TO9A 3GX4X 1W7PD 5LGNA 1ZLKA 2RN7A 2K27A 3ZMVA 1FT9A 2X4HA 2IVMA 3ABTA 1R5GA 2K86A 4M9SA 2OA4A 2NQ6A 4UXNA 1G4DA 4RGSA 2FE3A 4ETSA 2IJLA 1IN5A 5F64A 2LF8A 3FMRA 1B9NA 3GUDA 2ZKZA 4ZWPA 1F4KA 3SZPA 1EH6A 1T98A 1GXQA 2RKHA 5E1WA 4EQQA 3NQOA 5CE6A 4I02A 5LHHA 3SZTA 2GU6A 3ABUA 1P92A 4UHTA 2HGCA 3ZMDA 4I7HA 5D8KB 2FEZA 3WTUC 4EMSA 2FMLA 4G6QA 1ZRFA 2HYGD 4WWCA 3WG9A 1FC3A 2LNBA 2FBHA 3BPVA 5E20A 3PKBA 3C3WA 2FNAA 4XLPF 4AVPA 3CLOA 1ZG3A 4A0YA 4P5OA 5K1YA 2M45A 3W6KB 1N51A 1CF7B 1FBUA 4IPAA 3HHGA 1I6XA 1JHHA 1SAXA 3J81K 1ZH5A 2VXZA 2XAGA 3QOPA 3GEZA 4IHTA 4OIQF 4KDPA 2W85A 3Q9VA 2GXBA 4PCQA 2BGCA 5HS8A 2B3KA 1BOAA 2J5PA 4IF4A 3DF8A 4ENMA 1R36A 2GG0A 1JAWA 2GA1A 1T2KA 3L2CA 2GIVA 4YIIA 5DEQA 3GFMA 2P5LC 3BROA 2CW0F 2FOKA 3LQQA 3M9AA 2MA3A 1HSJA 4S04A 1OYWA 4P55A 2V79A 2NNYA 2HWVA 2VBYA 4PGGA 2BWTA 3BZ6A 1SD4A 1KP0A 4ASNA 2L01A 5ICGA 2WV0A 2IA0A 5DDGA 2ESNA 4HZFA 1XMKA 5CIKA 1SMTA 2XHKA 4U76A 2XAFA 1K79A 5E5BA 4GYGA 1HQCA 3GYHX 4HOBA 1R58A 1FYKA 1XD7A 1L3LA 1YIOA 4LLGF 2DK8A 5ICFA 5DD4A 4HX7A 1MD0A 3LA3A 2BH3A 4KT5C 2ZMEB 2XVCA 3FXQA 1TNTA 1ULYA 2EFOA 1RZ4A 4MQ9F 4ZH4F 4ENNA 2DPUA 3LAJA 3F8CA 3FM5A 3U9GA 1G3SA 3IKVA 3PQKA 5L3EA 1IZ1A 2O3FA 2D45A 4RB3C 1IRFA 3BJ6A 2ZNYA 1S6LA 2VOPA 5DYMA 2G6PA 2FMYA 3OOPA 2PFBA 1WKMA 1O3RA 1MATA 1FBQA 3KP7A 4LMYA 1QO0D 4JQFA 4CXFA 1QXYA 3FZVA 1QZZA 4G9YA 4KIBA 3ELKA 2ETHA 2OU2A 2MATA 4HLYA 3K2ZA 1S8NA 4RB0A 3QP6A 2V1XA 3WTXC 3MATA 4IHSA 3B73A 4LG0B 3EDPA 3TDUC 2W24A 4ENJA 1W7PA 5HS7A 1HBXG 2EV0A 1LVAA 1YFHA 1WQ2A 4Y17A 4IVNA 1MJBA 2ZNZA 3R6SA 2QBYB 1E2XA 4Y13A 1BC8C 4KYWA 4U69A 2HYFA 3WODF 2XAHA 4IKTA 3L09A 4MEYF 1FZPB 1K6OA 2IA1A 3BDDA 3RPQA 2HEOA 3IWFA 1ZAOA 4G7OF 4ZYEA 2STTA 3WE3A 2Y0MA 3T8TA 3V7CA 3RYRA 4UVCA 1FP1D 2BWXA 2GGCA 3EQLF 1D8JA 4GXOA 1Z6TA 1GVJA 2Q2EA 2GZWA 2Z33A 2GTXA 1W4MA 1IN8A 1J9IA 3P7NA 4MTDA 1V4RA 1O7LA 3RYPA 5H6RA 3FX3A 3HRMA 3GO5A 3ZPLA 3WTVC 2W84A 5D4RA 2Q95A 2W57A 1J0RA 4Q47A 3HSRA 1KYWA 4MTEA 4Z7MA 4EM1A 2K4BA 2E7WA 4HF2A 3F8BA 3Q9SA 3GLXA 3EETA 3PKCA 2IW2A 1QBJA 4RZYA 1QXWA 1XSDA 2UWMA 4LFUA 3NRVA 3D27A 1Z9CA 4MEXF 2A68F 4U0YA 4WF2A 5LHIA 1LQ1A 4FO7A 1J2XA 4U75A 3PKEA 3L7WA 4JK1X 1C22A 1K78A 1DDNA 4M9XA 2IT0A 4MGRA 5CYVA 3KFWX 4L5IA 5J8CA 4S01A 4L5JA 2M8EA 1QGPA 4A6VA 1D3YA 4R8HA 3JTGA 1F5TA 2HTJA 5JR3A 5AIPA 2HTSA 2Z3YA 1OYIA 4MQVA 2K4JA 1RI7A 2RGVA 3RKWA 2D1HA 3TDZC 1YW9A 4IKSA 1SFEA 2B0LA 1DUXC 5LBQA 4L9TA 2BYVE 2V3XA 1P4XA 4UVAA 1IAWA 5D6EA 2HS5A 1XGNA 2R7FA 3R0JA 2ZMEA 3FWEA 2M87A 4A0XA 3I5UA 1G3WA 3FHZA 5FCHA 2RC4A 4A5NA 1STZA 1HW1A 2QENA 4NHJA 3R0AA 2IPQX 4RGZ1 4EJUA 2NAZA 3KLOA 2OD5A 4AWXB 1FY7A 1JGSA 3V7SA 4YG2F 4M6XA 4HYEA 1ZN2A 3Q5FA 5HLGA 1D5VA 2XV4S 5JFRA 1HXDA 4CHUA 1OKRA 5FLXZ 3BP8A 2COMA 1P4WA 3BJAA 1ZG5A 1JHFA 1SD7A 4OMYA 1R1TA 4ZZDA 2F5EA 3ZMZA 2A6HF 1FX7A 4KNYA 4S00A 4N9IA 2GG8A 3BJOA 2EB7A 3WGHA 3KEOA 1JXSA 3DV8A 3HOSA 4ZNGA 2C6YA 3MZYA 5F1RA 1PUEE 1UCRA 3RPUA 3GVAA 4FUKA 1B4AA 2LSOA 2VN2A 2NYXA 3TOAA 2K7LA 1TNSA 5ICCA 1ZGAA 3F8NA 4M9ZA 1C24A 2AXLA 4MNUA 4LB6B 3QAHA 2HQNA 4A2UA 5ED4A 1LDKB 1HW2A 5HOOA 4RAYA 5CVRA 1W7VA 2O8XA 2P5VA 1Z05A 3G3ZA 2DU9A 3KP4A 3N4MA 2Z9OA 2JZYA 3WTZA 2EFPA 2VONA 3MEXA 2V6CA 3LSTA 4RZZA 2A69F 1FBSA 2HZTA 5K5QA 4Z2YA 5BPIA 1EH7A 5BOXA 3GF2A 3W6JB 2F5FA 1I1SA 1FP2A 4FX4A 3RKXA 4B8XA 2IW5A 1FOKA 5LEJA 1P4AA 3RI4A 1RNLA 2YSRA 5A2QK 2P9AA 2DPDA 2XUBA 2XAJA
chains in the Genus database with same CATH superfamily
2Y9YA 4FO8A 3IHUA 4AUXA 2LY1A 2DDBA 5CLSA 2KP6A 1D5YA 2M5WA 3QYFA 1SANA 4MHGA 5D4SA 3CCJI 3K4JA 2PMHA 3H9GA 1O3SA 2EK5A 4M71A 3ZQIA 1K6YA 3K4CA 4NC8A 2XAQA 3D0SA 3IAS2 4OMZA 3RZOJ 3MCZA 4BNCA 5K5RA 3FM3A 1YTYA 1N78A 3HGYA 1Z6RA 4BDYA 2XKPA 1R4NB 3L2RA 3CCQI 2GOMA 3N97A 2HQ5A 2KIMA 3IU9A 2KKOA 4AD9A 2V3YA 3REOA 3V7RA 2EA4A 3OIPA 2P5KA 3DBLB 3BIPA 2ELKA 2DMPA 3OL4A 3BITA 4BU2A 4A6WA 1GVDA 4PZJA 1MBGA 5FB2A 9ANTA 3MR1A 1ETOA 3ERED 1FSHA 2DYRH 1KA8A 1Y39A 2WY8Q 1Y8QB 3MKLA 4HXXA 2Y31A 4JBAA 2VKEA 3VOEA 4P9UA 1OQYA 3JSOA 1EV7A 1IXRC 1X1BA 3GWZA 4C3HJ 1VTNC 2CJJA 5ILUA 5HNHA 4I6ZA 2M7BA 1XDUA 1LEBA 3K10A 4P96A 2E35A 3S6BA 2WC2A 3J7AO 2ZXWH 3MAJA 3WTSC 4IX7A 1HA8A 3V8KA 1Y1VJ 2OTJI 4ZDOA 2BHCA 1VQ4I 4GGGA 2KJCA 1XDSA 4B09A 4HF0A 2LP0A 2ZXIA 3GZ5A 2P98A 3ECOA 4U6WA 3KX2A 1XMAA 2ZJ2A 2K9SA 4JUQA 4XN3A 3RDIA 2JUCA 1BN5A 3GFJA 1FTZA 4Y15A 2FSWA 3OYJA 3JRFA 1WBQA 1G2HA 4KJZA 4RAFA 3IH2A 5HS9A 2MH2A 2B3HA 2FXAA 5J1YA 5GPCA 1KZHA 2JA8J 3MQ0A 1KQ9A 2V3ZA 1ONVA 3ISPA 4L0ZB 4IF7A 1NTCA 2VQLA 2Q0OA 2EINH 1I27A 4U87A 5CDLA 1AOYA 3G6EI 4NBQA 4S05A 1BL0A 1LJ9A 4CH7A 1I3AA 2HKOA 3I71A 3ZQFA 4QTRA 3L2VA 3IH3A 2L7KA 1BM9A 2L3DA 4ON0A 1BI3A 4TV7A 4F7ZA 1K7AA 1WLRA 2HFHA 1FEXA 5HLHA 4RM2A 4FCYA 3GXOA 2H1LA 4BEHB 1UG0A 3KP3A 1LPQA 2Q94A 2K40A 1BR2A 4F92B 1B1BA 2BBYA 2R7XA 2VBXA 2GG3A 5ILSA 4CCMA 2ZO4A 3PUFA 5J40A 4WK8F 1HF0A 1NG6A 5H6QA 4LG0A 3CB6A 1RPWA 1TWCJ 1NH3A 1HOMA 1I6HJ 3BY6A 3K70C 2PG4A 2TDXA 4QSHA 4HV6A 3F22A 4BJ6C 1JKOC 3GTPJ 1NK3P 4RB1A 1FTTA 2GU5A 4FLLA 3LOCA 2BHZA 3CCVI 2CRGA 3H5NA 1YE9A 5E3OA 5E1ZB 3I58A 2M0CA 1TT0A 1AA7A 2QBYA 2IGMA 1ZRCA 3GW2A 2E2IJ 3BG7A 4U73A 2IGKA 4E70A 1TWHJ 3CUOA 4Y33A 3E6CC 1UHWA 2IGNA 2JPBA 4DJAA 3WTTC 2PI0A 2DMTA 1K4TA 1Q1VA 3CO6C 1F9NA 3I0TA 5J3LA 5H20A 2X6WA 2AO9A 1USTA 5GAHJ 3M07A 5E8GA 1KQ0A 2BW3B 4XONA 2WAFA 1B6AA 2Z2SB 5M5YJ 2VUMJ 2VKVA 4D7MA 3DQVC 4DYCA 1B59A 1FWZA 1WJBA 2PQ8A 2X0LA 1BW6A 3PNVA 4H0EA 5LEKA 1QZYA 3CF5F 3L24A 2CQKA 4ZWUA 2P99A 3WU2C 3HRSA 3KEYA 2A5WA 5LGTA 4PNCA 2FRHA 3VEPA 1XG1A 4PJJA 2B9SA 1R1UA 2BY2A 2A6EF 2EZIA 1IG7A 1JI8A 1LDDA 1FLIA 4DQ2A 4FISA 2MYSA 2FA5A 1T0FA 3HKZA 2HQRA 4UB6C 2I5UA 4HNTA 4XR6A 4O6JA 4B43A 4EJOA 1N77A 1OCTC 1GV5A 1QVTA 1RUOA 1Q1HA 3IRRA 2HOEA 4MFDA 1MH4A 4L9JA 1ZREA 1R1VA 2UUZA 2GG2A 2LKPA 3C2GA 5L3BA 3JRGA 1T39A 4BKXA 4QPOA 3OYIA 1R6RA 5EGOA 2WAQA 4IOCF 1IN7A 3MD2A 4AYBA 4L9NA 1RUNA 5JLXA 3SJMA 4F55A 4ZC3A 2R92J 2OKNA 5E1XA 4E6KG 5K7HA 4C2MJ 4U1BA 2CFOA 3F6OA 5JLWA 1W2MA 4UNOA 2BW3A 2KRFA 2Z5UA 1J59A 2WAQN 1C27A 4UUSB 3H92A 1PP8F 2BHBA 2M2EA 4I0BA 1TQPA 3K69A 4DNCA 3QU6A 3F9KA 4ZZLA 1NHAA 3RIRA 4C3IJ 3JRDA 4KM3A 3J7ZI 5D5UB 3OYEA 1FMWA 4UV8A 4WXCA 2ADUA 1ETYA 5ICEA 3OYFA 2KMUA 3VSLA 1KQ8A 3CC2I 3DKWA 4A3GJ 1A04A 3K4MA 5B1BH 4S2RP 5FJ8J 3K1MA 4G8XA 2VT3A 3CUQA 4D5CA 1K78B 1CF7A 1W7PB 3I54A 4A12A 1JE8A 5E18F 2FF4A 2HOTA 5HLTA 5CDVA 2XB5A 3HRUA 4KICA 5J8FA 1B72A 1S29A 1XB4A 2UXNA 1UHMA 4ZWOA 2LR8A 4BEHA 4GRIA 5F0CA 5FFXA 2VQCA 1QVUA 3ZXSA 1YW8A 3CB5A 1TW3A 3C7JA 4NQWB 2LY9A 3M3YJ 1O3TA 2M9HA 2QGUA 4F93B 2Y75A 3I4PA 2DA1A 1YLFA 5FKOA 1R00A 2G0EA 3ZQLA 2QEXI 4HF1A 5IOYA 3TP0A 1ZYRF 2BVLA 4CDGA 1LDJA 1FNNA 3I59B 2F5VA 2NNNA 4Q48A 4ENKA 3MX6A 3OSFA 2KZGA 2Q92A 1Z7LA 2OAZA 3ZMSA 3S17J 2X1DA 1ZELA 3IWZA 4RAGA 4ITVA 4UUSA 4X0GA 2QVOA 3K7AJ 4AVZA 4XICA 3BCBA 2DAOA 2NRAC 2Q2EB 2VIXA 4RAZA 3Q3SA 4GYIA 3FIWA 2LBFA 4U6EA 1X4OA 3PQJA 3HSEA 4G6DA 1XGMA 3T5XA 2E1NA 3S15J 2LFBA 4NC7A 3OIOA 2HXOA 1FYLA 3P9IA 3RKYA 3ZMTA 2EJRA 2L02A 4OIPF 1ETWA 2RV8A 2F5CA 4KFCA 1OR7A 4XBFA 4KA4A 2DA2A 5E3NA 4RGXA 2CO5A 1HKSA 2Z99A 4LD5A 6PAXA 5CVJA 3MZHA 5TJJA 1LNWA 3ABKH 1XN7A 4YFNF 1ZLJA 3SZGA 1WI9A 2H1KA 1L0OC 3F72A 2NQ7A 2DTZA 1WJFA 3BR0A 2PLYA 2EFNA 3ECHA 2DODA 3K1NA 3K4LA 1KU3A 1ZG1A 3D5RC 3COAC 1V3FA 2FNPA 3JR9A 4FLIA 3DEEA 1XGOA 1SVLA 3S8PA 4AIHA 5FKMA 2DK5A 3K4NA 4QWQA 2YR2A 4LIVA 2EA2A 5E8IA 5J6XA 1MMDA 4CYCB 3FXJA 1REPC 4XRSG 3KYCB 5BQTA 2KDZA 4PK4A 4IO9F 5J4VA 2HXIA 3LQRA 4NDLA 1H89C 1VQ9I 2WA0A 2LVSA 2HDDA 2L0KA 4GCVA 1LFBA 1MDMB 1HKQA 2R3SA 4IOAF 4HEA2 5AONA 5FFZA 1JGGA 3LFKA 4LLLA 1MBEA 3O6BB 1UZCA 1VQ8I 1HC8A 4BXFA 5BNGA 2UXXA 4UUVA 3CCYA 2Y48A 4IHYA 5KAIC 4MLOA 2YU3A 2HVRA 3U1KA 4J01A 2M30A 3CUQC 3ULQB 3E5UA 3VPRA 3OS2A 3ZQHA 4DZJA 2XASA 5LHGA 5D5VB 2NXNB 2MD5A 2L9VA 2IA2A 3X2QH 1ON2A 4OIRF 1ZHFA 1YO5C 3RORA 1SFUA 3CO7C 5DUKA 1KGSA 4HDUA 2ESHA 3CJNA 4PFPA 1ZQ3P 2BVMA 3ZN1A 5L3FA 3FXLA 3KP2A 3IC7A 2E1OA 2EILH 5EG0B 1I3QJ 3BT9A 3PM1A 3H3VK 1ACIA 2W4SA 1RETA 3F21A 3L7GA 3LA2A 5J1RA 1QPMA 2PN6A 4ZYDA 4WXDA 1Z1DA 3WE2A 2EV5A 3MFKA 5C4XJ 1Z21A 3U1DA 5B66C 1ETQA 3KETA 1Y0UA 1C0WA 1RKTA 4I99C 3OS1A 4QLCU 4PJMA 2R5ZB 1R9TJ 1VQKI 4C2UA 3SXYA 2EPFA 3GTGJ 2E5ZA 3BC8A 1MJAA 5IY5H 3OWTA 3B02A 1ZRDA 4BHCA 1OJLA 2BZTA 4NQWA 2XKOA 1X3ZB 5B5EC 4XKVA 4BQNA 1DPRA 4A69C 1G6NA 1TLHB 1IN4A 5F04A 5FKNA 3TMOA 2R7WA 2VPRA 4MATA 2K9LA 2ZB9A 2F4IA 3HUGA 3JREA 1JUMA 2QWWA 3OMYA 5J4YA 4I2OA 3M1EA 2JA7J 2MBFA 2XF6A 1DGRM 2DCEA 3DBRB 4G12A 2WWYA 3A1YA 2QQ8A 5L3GA 5EEGA 3HOXJ 2FU4A 3DPLC 4UB8C 3WGGA 1JT6A 4MFEA 3DP7A 3PIOF 3IG4A 5KK1A 2MGQA 2DQRA 1BI1A 2ZFWA 2P6SA 1AWCA 1VQNI 3BZKA 3H9QA 2Y9ZA 1SFKA 4KMFA 3WG7H 1OPCA 3HSFA 3M4OJ 2GU7A 2F4OB 3HHHA 1E3OC 1VQ7I 4C30A 2EVOA 2CSOA 5FCFA 3JTHA 3FK7A 2M8GX 4IECA 5E17F 2K3FA 1H9TA 2RVCA 3RTRA 3OY9A 1MJ9A 1WSUA 4LIUA 1U5TA 2MSYA 3HL2A 2CGPA 1IV6A 1VNDA 3M8FA 3RZDJ 3FXUA 3OIQA 2ZXHA 1V55H 1WH5A 3ONQA 4BYYA 1R22A 5IYDJ 4G94A 1U3EM 3GZ6A 4DGWB 4HV5A 1D1AA 2HNHA 2OCCH 5FROA 2O61A 2WADA 2BE5F 2VL8A 5LRSA 4N9HA 1W5SA 1I5ZA 3E3VA 1CQTA 4RS8A 5K5OA 4FT8A 4C3JJ 4OOIA 2DFIA 3JW4A 5KAFC 1XGSA 4XKCA 1GLNA 3EYIA 3NEUA 2H09A 4V2FA 5CNXA 4QPQA 4PFOA 4KMUX 3QYBA 1W0UA 4LB5A 2DBBA 4CCJA 5EDNA 4M3EA 2XF7A 2XGXA 2KPMA 1LVKA 1MDMA 4D5FA 4XKWA 3LAPA 1WN1A 5IP9J 2Z16A 3SQNA 3U21A 5AIQA 4U7DA 1FOWA 4IRHA 1WY2A 1UELB 2XDVA 3ERMA 3PNTA 3W2AA 4AIDA 2QQAA 2CS3A 2CYYA 2WTEA 5CDEA 3BWGA 2A07F 3QPLA 4OAYA 2VODA 5D5XB 5HDGA 2H94A 3HOZJ 3BR1A 2CUEA 2NVQJ 3J7YJ 3HJEA 2XGEA 4KIGA 2AQFA 1LE8B 1GDTA 2HI3A 2G9WA 2OC6A 2VC0A 2XC7A 3FBIB 3R60A 3DKXA 4XOTA 2O03A 3ZN0A 5GPAA 4CYDA 2RDPA 3HB9A 2K85A 3ZGKA 2P6TA 4BQQA 5IOZA 3DXJF 1J5YA 4J19A 4S2TP 2NS0A 3L9FA 2VOOA 1X58A 1H9GA 5HDNA 1UFMA 3H0GJ 4FLJA 4IU6A 4JX6A 2BY1A 3S2WA 3PIPF 3F0CA 1SMYF 2H27A 5DCFA 1YRNA 1VFCA 2XIGA 3HXLA 2EZLA 2VKDA 1TC3C 1TP4A 1P7IA 1SD5A 2OZUA 4BXUA 2PMUA 4HBLA 3V8JA 1Y1WJ 4YFKF 2BOLA 1Y1NA 1S3JA 3LA7A 2GXAA 3F6VA 2R5YA 1YOVB 4BQAA 2J5OA 2K9MA 3HC7A 1ETKA 2VJJA 4ANJA 2BV6A 4ESBA 2CQQA 3KIOA 3FMSA 4YIFA 4AIJA 1RC9A 3EUAA 2BXYA 4ABZA 4B4CA 1O3QA 5JVTA 3LWFA 2GG5A 1I1GA 2AQEA 5M5WJ 1OYYA 1USSA 2JWTA 2QLZA 2R7OA 4LJZF 1KU2A 3I56I 4EVIA 5C4JJ 3TO6A 1KU7A 1MNEA 1Y8RB 2DA7A 1RR7A 4YELA 1Z91A 3GMEA 1IRXA 5F1JA 5DCMA 2IBDA 1WL9A 1KU9A 5FGMA 5HVQC 4M6VA 2AS5F 3PFIA 4D0PA 1LE8A 1YQAA 4WCGA 3BPXA 4FLKA 2O6GE 1FOYA 1SFXA 1F1ZA 1XCVA 3E97A 1U78A 3FKJA 1MGTA 2YUSA 3CDIA 3KP5A 3HOYJ 2VT2A 2VC1A 2X51A 3MKYB 3PKAA 3WU0A 2ZBKA 3ESWB 5EGOB 3GTMJ 2L4MA 4NB5A 4GDFA 1IV8A 3BG6A 3E1SA 3QYEA 2FX0A 2V1UA 4E7IA 3TOBA 5IT9Z 4KN7X 2Q96A 4KIFA 2E2HJ 2BN7A 4G7ZF 4A3CJ 3GFIA 3GTLJ 3BZCA 3QP5A 1ZTRA 2HKXA 1W5TA 1X1CA 1X4PA 2QM3A 4HSRA 4RGRA 3WTWC 4A3IJ 3E6MA 5LRRA 2R7DA 4B3AA 4A3JJ 4F91B 2LD5A 4ZJZA 2F48A 2KFDA 4EM0B 4XM3A 1F36A 2CU7A 1APLC 2VPLA 4ESJA 4XSZF 4EJTA 3CLQA 4OIOF 2Z1DA 2CG4A 2K02A 1T33A 2HYJA 4UVBA 3IU7A 1OLTA 1VQPI 4O3MA 1OCCH 1LB2A 1O7FA 1E0EA 1W1WE 5KCMA 1FPQA 4EJVA 1YHQI 3OYMA 5DCMB 5C3EJ 2L4AA 3ML6A 3VODA 4HA8A 2ZJPF 3H35A 4FX0A 3KYDB 3RJPA 2HDCA 3I64A 1FSEA 4CO8A 2M1BA 1HKTA 2QQBA 1LUJB 3ROUA 3CTAA 3V8LA 4HRIA 1ETVA 3TO7A 4YEJA 2W25A 3CTZA 3J81Z 4BS9A 3TAVA 3S1MJ 2VI6A 4RB2C 1TBXA 1JKQC 5HLIA 1T0FC 1HDPA 2ELHA 3TQNA 4Q4ZF 3M1CA 5GAEJ 2PJPA 1S7AA 1MMGA 3K9TA 5CVVA 1PYVA 1C21A 4XL9A 2BY3A 2E60A 4IHVA 1R71A 2Q93A 1LFPA 2GXGA 2GG7A 2JSCA 1JTYA 2LG4A 4FETA 2DYSH 4RGUA 1J75A 4II3A 2VASA 2IEKA 3H36A 3WU1B 3OYBA 1GV2A 4LK1F 2ECCA 5KVRA 4OINF 3M8EA 4E7ZA 1S9HA 3BIQA 1QRYA 3UKGA 3E6BA 1OR7C 1ENHA 2M4GA 2GA2A 3SEQA 2OV7A 1XCBA 2ACJA 1IN6A 2IP2A 4I09A 2MC3A 1J7KA 4N0BA 5DV5A 5F0HA 2MD0A 4N4NB 3BLYA 3QPTA 1R7JA 1PV9A 4BL0B 3IU8A 4IKUA 3OYGA 1P2FA 1G8XA 2PMZN 4RM3A 3SFZA 3TW6A 2F2EA 3GCMA 2EIMH 1UB9A 1GHCA 2OJED 2X9DA 5EZHA 3M7GA 3ZQCA 2G7UA 3W6VA 2D1VA 1JUSA 3QPHA 5GADJ 2E1MC 3N05A 3W2VA 2JT1A 2R7VA 5BMZA 4FE4A 3P9CA 3T1BA 1U5TB 2HOAA 2PMZA 2KISA 4IRIA 4XIDA 1IXSB 2PBIA 3FDYA 4IRGA 4YIRX 1WZ2A 2XPWA 2LREA 3CMEI 1JJ6C 5GAGJ 3DPUA 1TT5B 2KIFA 2W82A 5D6FA 1X3UA 3KLNA 1O57A 4IHXA 2X6OA 2GG9A 1SD6A 1TW2A 1T38A 4HW0A 3J7AY 3EUHA 1T08B 1IXCA 1YW7A 4U71A 3LSRA 4WX9A 2LF7A 1WVRA 3HYIA 5CVUA 1R4MB 3AL0C 3LNQA 4X6AJ 2YX7A 4RBOA 2YPRA 2BWYA 1TWFJ 2GQQA 1MZBA 1IW7F 2EZHA 1HLVA 1SFOJ 4AM3A 3KP6A 5KNLA 4XLHA 4Y3OA 5IYCJ 2WBMA 1ODDA 1U8BA 2E2JJ 2HOWA 2Q8KA 4PV4A 4PSWA 4XLEA 3GTKJ 5M5XJ 4IDYA 3I4NJ 2A3SA 3DEUA 4FQGA 2FBKA 4CGZA 4OOKA 2DO7A 2LH9A 2DT5A 5DM6F 1YVMA 4IKRA 2DLLA 2V9VA 4CUGA 3HIFA 1WWXA 2IAIA 3BR3A 4BUPA 1WL6A 4U0WA 1M35A 4K2EA 4NUBA 1LEAA 2LOOA 5FKLA 2DQLA 2PEXA 3FXKA 1J09A 2JA5J 5EJCA 5D5WB 1IRGA 1QNTA 2ISYA 3S3NA 3R61A 4M6YA 3LL7A 3P9KA 2HDWA 3MVPA 2XRLA 4A3EJ 3BOQA 3PSIA 1D8KA 1G3YA 2Y2ZA 1U2WA 2E7XA 2JRTA 1HSTA 2BEOA 2JTVA 3I9V2 2OUMA 3QOEA 2NVTJ 2BB7A 4EV0A 4B48A 1N75A 2JPCA 2MH9A 3EUHC 4XRFA 3L2UA 3BTJA 5BS6A 3BG5A 3E5XA 5B3SH 2COBA 2A6TA 3KEQA 4XSXF 4HQEA 4ZYGA 4CICA 3FXRA 1OCOH 1X19A 4FKCA 1ZR2A 2TRTA 1QHGA 1FYMA 2L7FP 5CVIA 5JHFA 1XNZA 3RVAA 4XQFA 3HM5A 3TGNA 2BWSA 4G7HF 2A5YB 1WCMJ 2FUG2 2CH0A 1MH3A 1OMIA 2FQ3A 5DUIA 4RDUA 3FHNA 1WPKA 2O8KA 1S7EA 2B3LA 2EFWA 5D8LB 2V1DA 2ZCWA 2QYOA 3I53A 5HODA 3IV5A 3ZQQA 3K4KA 3ZP5A 4PUSA 1K61A 3CUQB 2VBWA 5EF6A 1IO2A 3MZ8A 3T0YA 1V5GA 5JHUA 2EVMA 1ZK8A 3L2QA 2F6CA 5HDKA 3FMQA 5ILVA 1CGPA 2FBIA 2E1CA 2IS4A 3AAFA 4R79A 3RKQA 4Q5SF 3QODA 3QQAA 4R1HA 1MIJA 3G2BA 2QZ8A 2VBZA 1CHMA 1U9OA 3GLLA 3R4KA 3AG1H 4LOCA 2L2OA 1FOXA 2LMDA 3H1CA 1ZGJA 4E4HA 4EJWA 5EEHA 4M3DA 2XPUA 2GZ5A 4OU0A 3RPUD 2X48A 3W2WA 3I55I 3QRFF 4E7SA 3VFZA 2YS9A 3H3UA 5DTDA 3Q6DA 4CSWA 3PSFA 4HQMA 1T8IA 2BXZA 4O5VA 2HOSA 4HLXA 4BJTA 3DFGA 1BR4A 1FIPA 3Q0VA 5L3DA 1W36D 1BC7C 3F23A 2EWNA 4I0AA 2ID6A 3OYCA 3GBGA 3G73A 1U9NA 3JAMZ 2ISZA 1WI3A 2DOFA 2GBYA 3BG9A 4YFXF 2IS2A 5FO5A 4EM2A 3PL8A 2R7TA 2W7NA 5F6FA 1BIBA 2MLGA 3D5LA 4HX8A 3AKZA 3U2RA 1W0TA 4D9JA 1TQMA 1U0JA 3DU6A 3WGIA 2L7MP 4U70A 2Q1ZB 3OSGA 4U88A 4HNUA 3K1PA 2QKLB 5M3MJ 2P4WA 1BJAA 4ZTJA 2K5CA 3E5QA 2V7FA 2XF5A 3OYDA 1E17A 3W3CA 3RQ4A 3CF2A 4B44A 4A6EA 4XLNF 1RR8C 1MW7A 3GTJJ 3EUKL 3KYLA 1PDNC 2L54A 5CJ9A 2EFQA 3DWLE 4CA0A 4EGYA 3O2PE 3BR2A 3HG9A 1IF1A 4B28A 3PKDA 2ZSHB 4KITB 1YJNI 5K7ZA 2RNJA 2OQRA 4P9FA 1MMNA 3KE2A 5A2QZ 3QU3A 1HCRA 2CW8A 1RRJA 1K4SA 2XB0X 4XMYA 3TKYA 1QXZA 5BPDA 5DS9A 1YJ9I 2JVGA 3EYYA 1HW5A 1U5TC 4M74A 4AIKA 4A93J 2V4JC 5DM7F 3GFLA 2BHDA 3TBIA 2YX4A 4XKBA 4A6DA 3FXMA 4CCOA 4EGEA 5CQGA 4DZPA 1DPUA 3B6AA 4LGWA 2LDUA 3K0LA 3HRTA 4M73A 1R5HA 3IKTA 1XS9A 3A01A 3MWMA 4B47A 2P7VB 4CZZA 1KYZA 1TQIA 2BWWA 1B8IA 1B9MA 2XROA 2EVCA 1QHHD 3HOTA 2A61A 1ZR4A 1DP3A 1POGA 2DTRA 1I50J 2MLKA 2CFXA 3DTKA 2DFFA 2STWA 3A0BC 1A36A 4F3QA 2LYCA 2O0YA 3AL0B 1BBYA 1YYVA 1ZARA 4M72A 3CCSI 1MKMA 1OCRH 2P8TA 3FKIJ 2F5DA 3ZR8X 3JAMK 1H0MA 5FD5A 2L9SA 2LKSA 4BE1A 2CV1A 1ON1A 2BWVA 2H6BA 2ZXJA 1TZLA 1P6RA 2CW7A 1K83J 1GXPA 5FD6A 2FJ1A 3S3OA 2IRFG 1UMQA 3JSPA 1V5FA 3KCCA 4IJAA 4BH9A 5LLQA 3IRQA 4GO1A 3WTYC 5LGUA 3F8MA 1IGNA 1QQIA 1XSXA 2KJBA 5CQEA 5LFAA 5IT9K 5ERIA 3J80Z 3VYUB 4KUMA 3V4GA 4XNFA 2P7CB 3SHFA 5DD8A 1RESA 3H3ZA 4B3XA 1IUYA 4U6ZA 3HTUA 3CCMI 4I01A 2GGBA 3GTQJ 1RIOH 3NARA 3ZQ7A 3C1DA 3NWTA 2R5ZA 1S7OA 4BY7J 4I98B 2LK2A 1YG2A 3F3XA 4IXAA 4PDKA 1WHUA 5LD2C 1A16A 3HTSB 3C2BA 2FD5A 2EH3A 4EGZA 2N8GA 1B8IB 1PJRA 2OQGA 2DJIA 3OV8A 4FHTA 4IEJA 3O8HA 3CC7I 2TCTA 5TRDA 2V1NA 1DP7P 2HVQA 4PGHA 4RLFA 4A5MA 1M1EB 3NWSA 2E71A 4L9VA 4U6CA 1QPIA 3GZNB 4KN4X 3QWLA 2ZSGA 2QQ9A 2H6CA 5IPAA 1Z7UA 2X1EA 1MSFC 2XRNA 2QSHX 2YU9J 2GAUA 4ZYHA 1HDDC 3JRAA 1BIAA 2CWEA 2NOJB 1U6GA 1XSVA 4XLFA 4QR8A 1TTYA 2DA4A 3K70D 5J47A 3T8RA 1A5JA 5EZGA 3QPSA 4GFBA 1YJ3A 4AU7A 3E6DA 5L3CA 1T95A 2DW4A 4BY1J 4A0ZA 4A3FJ 1UHSA 1YS7A 2ME0A 4JYKA 3CC4I 2RNGA 1WRJA 2UZKA 4LK0F 1BW5A 5TGTA 2A05A 4HAMA 3FBNB 2KT0A 4KT6A 1O0XA 2LTPA 4JX4A 4H4KC 1I39A 4U7BA 1BI2A 4HDVA 1BI0A 1U8RA 2OBPA 1YIJI 3PNYA 3V42A 5JI6A 1X2MA 1C23A 4R60A 4LLNA 3VB2A 2RQPA 2VJ4A 4L0YB 2VE9A 1Y56A 1T6SA 4HX4A 4D7NA 1XPXA 4L18B 5E79C 3L2WA 2OPTA 4U0VA 3IL2A 3HOVJ 2KRCA 3J80K 2HR3A 2KZVA 3ZMUA 4AYBN 3LSGA 5B1AH 5KHDA 4A3DJ 2KIUA 3OL3A 2Y30A 3DPTA 4BAYA 2X6XA 1OISA 2Y69H 2GWRA 1FMVA 4PJNA 2DI3A 3I59A 3O3KA 2EV6A 1AKHB 1EH8A 1V54H 2Y0SN 1YS6A 2GU4A 3KZIC 4FTHA 4U6JA 2QSGX 2D2WA 2I10A 4BE2A 3CJRB 4HPQA 4Z6YA 5IT3A 4BHPA 2WB1N 3C18A 2VE8A 4XRSA 2FQ4A 1R23A 2G7HA 1G3TA 3A02A 5C44J 2OZ6A 3L00A 4DYQA 2E36A 2BWUA 3KZYA 4X1EA 5IP6A 2XSDC 3MN2A 4PSXA 3KZZA 4UV9A 2QUFA 5GTHC 4UY8I 5FLXK 2BHYA 2MG4A 3F8FA 4YRVA 4ESFA 1PP7U 4MIMA 2BHAA 3TB5A 4CCKA 4WXHA 3FF5A 2B7EA 1X3WB 2ID3A 4BHBA 4DIQA 3CDHA 3TO9A 3GX4X 1W7PD 5LGNA 1ZLKA 2E19A 4BDZA 1MMSA 2RN7A 2K27A 2XSJC 3ZMVA 1Z0XA 1FT9A 2DOEA 2X4HA 3ABTA 2IVMA 1R5GA 2K86A 4M9SA 2OA4A 1VZ0A 2JK3A 2VXDA 3CP8A 3EPZA 3LSHA 1RKWA 2JSPA 2NQ6A 4UXNA 3ZOBA 3PO2J 3MKZA 1G4DA 4RGSA 2CQXA 2FE3A 3PUBA 4ETSA 2IJLA 4IHWA 1IN5A 2V9PA 5F64A 5F27A 2LF8A 3FMRA 5J1UA 1B9NA 1G59A 1JTXA 3GUDA 1WJAA 1Z3YA 2ZKZA 3JRHA 3JRCA 4ZWPA 1F4KA 4E7LA 2L9NA 3SZPA 1EH6A 2O9LA 2IXSA 1T98A 2DFHA 1GXQA 2RKHA 5E1WA 4EQQA 4BE0A 1LFUP 2V26A 3NQOA 5CE6A 4JX5A 4I02A 4XN0A 5LHHA 3SZTA 3LSMA 2BY0A 2GU6A 4OWRB 3ABUA 1P92A 1W36C 4UHTA 3CCLI 2QCOA 2HGCA 3VDXA 3ZMDA 2DJNA 1OCPA 4I7HA 1EJ9A 2IS6A 5D8KB 3CMAI 2FEZA 1E3HA 3WTUC 2GLOA 4EMSA 1IC8A 2FMLA 2XPVA 4JP0A 4G6QA 1PUFA 1ZRFA 2HYGD 3FISA 4XLCA 3ASOH 3WG9A 1FC3A 4WWCA 1MNDA 2LNBA 3LMMA 2FBHA 3BPVA 3CCEI 5E20A 4Y4RA 2QF7A 4XLAA 1OCZH 3C3WA 2FNAA 4XLPF 3PKBA 3VWBA 1IDZA 3CDLA 4AVPA 3CESA 2P0WA 2JA6J 3DKYA 2X6YA 2DA5A 3CLOA 2JQ7A 1ZG3A 3S32A 4A0YA 4P5OA 5GTIC 4S0HB 4II2A 2M45A 5K1YA 4BBSJ 3W6KB 5EG0A 3L1PA 1N51A 1CF7B 1X1AA 1FBUA 4A3MJ 4IPAA 3HHGA 2E1MB 3ABMH 4XRMA 1I6XA 1JHHA 1SAXA 2NVXJ 3E0JB 3J81K 3DCFA 4DW6A 1ORKA 1P7JA 1ZH5A 2VXZA 2JUGA 2XAGA 3A01B 3G1LA 2IGOA 1X2NA 4UUTA 2HPMA 3QOPA 3GEZA 1DU6A 4IHTA 2KQRA 1TL8A 4OIQF 4KDPA 2L5QA 2W85A 3Q9VA 3CCUI 3SDGA 4MO7A 5F08A 5IP7J 1JKPC 2GXBA 4PCQA 2BGCA 5HS8A 3PJRA 2I8DA 2B3KA 1BOAA 2J5PA 2XGCA 1YX5A 4BACA 5FKKA 4XORA 4IF4A 3S2DJ 3PFYA 3UNGC 3TL4X 3DF8A 4ENMA 1R36A 2GG0A 1VQ6I 1XMXA 2NVYJ 1JAWA 2AHQA 2AXTC 4PJ0C 2GA1A 1T2KA 3L2CA 4HSTA 3DTEA 2GIVA 4M3GA 1XC5A 3P5JA 4YIIA 5F0FA 4F52A 4EATA 3IUOA 2VJ5A 5DEQA 4A3LJ 3GFMA 2P5LC 1SVOA 2EQRA 3BROA 4KISA 2CW0F 1MBJA 2FOKA 2LC2A 3LQQA 3M9AA 3TW7A 2MA3A 5EYRA 3G4SI 3TP3A 1HSJA 1LKXA 2DN0A 4S04A 2WV1A 4BXXJ 1OYWA 2KHMA 1UAAA 4P55A 2DT7B 1KONA 1WGXA 2V79A 3K2AA 1A31A 2NNYA 2HWVA 1JT0A 3H9JA 2VBYA 4PGGA 2BWTA 2EZKA 2MABA 3BZ6A 1SD4A 1KP0A 4ASNA 2L01A 5ICGA 3M8JA 2WV0A 2IA0A 5DDGA 2ESNA 2M34A 1VI0A 4HZFA 1XMKA 5CIKA 1SMTA 2XHKA 3OYAA 4U76A 4DYRA 2XAFA 2HU9A 4BGDA 1K79A 5E5BA 4CYCA 4GYGA 2NS7A 5FLMJ 2DXIA 1HQCA 3GYHX 1WJCA 1WFXA 3IH4A 5CPRB 2KIQA 4HOBA 1R58A 1R49A 1XD7A 2E5NA 2PX9A 1FYKA 3BTLA 3A03A 1L3LA 1YIOA 4IQ4A 2VB6A 4LLGF 2K3PA 2DK8A 5ICFA 2LKXA 2H8RA 4I76A 5DD4A 3JRBA 3NAUA 3CCRI 3C2HA 4HX7A 1MD0A 4DOZA 3LA3A 4LG3A 4OAZA 3O8GA 2BH3A 1UJ8A 4V19K 4KT5C 4ZTFA 4J00A 5M3FJ 1N25A 2ZMEB 2XVCA 3ZQGA 3FXQA 4FE7A 3OYHA 3BR6A 1TNTA 1SC7A 1QA6A 1ULYA 2EFOA 1RZ4A 4LITA 3VYRB 2ECBA 5GP9A 4MQ9F 4ZH4F 3DU5A 4ENNA 2DPUA 3LAJA 3F8CA 3FM5A 3U9GA 1G3SA 3GTOJ 3IKVA 3PQKA 2Y0SA 3B6CA 5L3EA 1IZ1A 2O3FA 3OS0A 2D45A 1QU3A 1YRNB 4RB3C 1IRFA 4ZYAA 1NK2P 3BJ6A 2ZNYA 1S6LA 2NS8A 2VOPA 5DYMA 1AKHA 2G6PA 2FMYA 3OOPA 5E3MA 3H0DA 2ZJRF 3D5SC 4RLQA 2PFBA 1WKMA 2X85A 1O3RA 1BA5A 1MATA 5FRMA 3I3LA 1FBQA 3KP7A 3CP2A 3LSKA 4LMYA 4W97A 1QO0D 1WJDA 4JQFA 4DBRA 3BG3A 4P1WA 4CXFA 1QXYA 2DDAA 3FZVA 2M0MA 3D1NI 3S3MA 3BTCA 1QZZA 4G9YA 4KIBA 1VF9A 1PVEA 3ELKA 2ETHA 4ZDPA 4AC0A 2OU2A 2MATA 4HLYA 3K2ZA 2VLAA 2P81A 4PJLA 4IZZA 4M3FA 1MBHA 1S8NA 4W1UA 4RB0A 3QP6A 2LY2A 3WHBA 2V1XA 3E7LA 1WH7A 5E3LA 3WTXC 3KPHA 1DQUA 3MATA 1P9QC 4IHSA 3B73A 4Y7NJ 4LG0B 4RMNA 2ELJA 1D0ZA 3H5RA 3EDPA 3TDUC 2W24A 4ENJA 2KL4A 2ZC2A 1W7PA 5HS7A 3UR3C 2EV0A 1HBXG 3VSKA 1FIAA 2WAEA 1JKRC 1LVAA 2NVUB 1YFHA 2ICWG 2JA2A 2WY7Q 1WQ2A 2X1CA 4Y17A 4IVNA 1MJBA 4FASD 2ZNZA 3R6SA 2QBYB 1E2XA 4Y13A 4Y52J 1BC8C 4KYWA 2O5RA 2V9KA 2HZDA 4E7HA 3DLLF 2R7ZJ 4U69A 2HYFA 3WODF 2XAHA 1D0XA 4IKTA 2ZJQF 1VQ5I 1WJEA 3L09A 4MEYF 1FZPB 1K6OA 2IA1A 3OOUA 2EIKH 3BDDA 2O7OA 3AG2H 3RPQA 4EEFG 2HEOA 3IWFA 1ZAOA 2RAEA 4G7OF 4ZYEA 2STTA 3WE3A 1A6QA 2Y0MA 3T8TA 3V7CA 3BTIA 3LSJA 3RYRA 1A6IA 2CQ7A 4UVCA 1PUFB 1FP1D 2BWXA 2R4GA 1W5CC 5H2FC 4DBQA 2GGCA 3EQLF 1D8JA 1X1PA 4GXOA 1D0YA 1Z6TA 5HNFA 1GVJA 2Q2EA 2GZWA 2Z33A 2GTXA 1OFCX 1W4MA 2LBFB 2XGDA 2ZSIB 2HVSA 1IN8A 3DTIA 1J9IA 3P7NA 1IRZA 4MTDA 1GUUA 1V4RA 1MBFA 2DFEA 1O7LA 3A0HC 4CCLA 3RYPA 1EF4A 1DU0A 5H6RA 3FX3A 3HRMA 3GO5A 3ZPLA 3FK6A 3WTVC 1H88C 2W84A 3IAM2 2D5VA 1QZEA 5D4RA 2CQNA 2L9RA 2Q95A 2W57A 1J0RA 4Q47A 3HSRA 4E7KA 1KYWA 2QKMB 1E3PA 3TEDA 3MKWB 1BR1A 3FXOA 4MTEA 2HQAA 4Z7MA 3HKZN 4EM1A 2K4BA 3OR1C 2R0QC 1DGWY 2E7WA 4HF2A 3F8BA 3Q9SA 3GLXA 3EETA 1XTAA 3PKCA 3BQZA 2R5YB 2IW2A 1QBJA 4RZYA 1YI2I 2MW8A 1QXWA 3HEFA 3SDBA 1R5ID 1XSDA 3BCAA 2UWMA 3ABLH 4LFUA 3NRVA 1D1CA 3D27A 1T56A 1Z9CA 4MEXF 2A68F 4U0YA 4WF2A 2M7AA 1Z3XA 3AFHA 3RQIA 3JCUC 1SVMA 5LHIA 1LQ1A 4FO7A 3CMYA 1J2XA 4U75A 3PKEA 2ZMEC 3L7WA 2JVHA 4JK1X 1C22A 1K78A 1YJWI 1FJLA 1DDNA 4M9XA 2IT0A 3CD6I 1Z77A 4MGRA 5CYVA 5FLVA 3KFWX 4L5IA 5J8CA 4L5EA 4S01A 2GOXB 4E7JA 4N4OB 3K6GA 4L5JA 2MC4A 3OYNA 2M8EA 1QGPA 1ZKGA 4A6VA 3SEZA 1D3YA 4R8HA 4NNJA 3JTGA 2VQGA 2JRMA 2HTJA 5JR3A 3RCOA 1VQOI 1F5TA 2WB1A 5AIPA 2DT6A 2QSFX 2HTSA 3H5AA 3G71I 1X1DA 4XK4A 2Z3YA 1OYIA 4XOPA 4MQVA 4RA2A 4HNVA 1O4XA 2K4JA 2RREA 1RI7A 4ZDLA 3WHCA 2RGVA 3RKWA 2D1HA 3TDZC 1ITYA 4C9YA 1YW9A 4IKSA 2DMUA 1SFEA 3HZJA 3OYLA 1Z67A 3ASNH 3IP4B 2B0LA 1MMAA 3Q0WA 1DUXC 5LBQA 4L9TA 3S14J 3HBLA 3LSPA 1S72I 1NG7A 1BJZA 3G1OA 2BYVE 2V3XA 3K4BA 1P4XA 4NC6A 4UVAA 2ME6A 3LFUA 1IAWA 5D6EA 1Y0NA 2HS5A 2JN6A 3CZ6A 2PJRA 3S93A 1ZGWA 2L7ZA 1XGNA 2R7FA 1F43A 3R0JA 2ZMEA 3AG4H 3JRIA 3FWEA 1XX5A 2M87A 4A0XA 3ZRGA 4CCNA 2V6EA 3MMYB 3I5UA 1G3WA 2CV2A 3A4CA 3FHZA 5FCHA 2RC4A 4A3BJ 4A5NA 1STZA 2OTLI 1HW1A 2QENA 3RSNA 3SFIA 3CMMA 2JJ7A 2K9NA 3HPHA 3DEWA 1MNMC 4NHJA 3R0AA 2IPQX 2W48A 1MBKA 4RGZ1 4EJUA 2NAZA 3A2KA 3KLOA 4C2TA 2OD5A 4AWXB 1FY7A 1JGSA 2CV0A 3V7SA 4YG2F 4M6XA 5TISC 1VQMI 2QA4I 3HOWJ 4HYEA 1ZN2A 3Q5FA 5HLGA 3AG3H 2MFZA 3S16J 2R7SA 1D5VA 2XV4S 2M3AA 5JFRA 1Y6IA 1SEUA 2R7RA 1ETXA 2GIZA 2VQHA 3S1QJ 1HXDA 4CHUA 2DA3A 1V5EA 1OKRA 5FLXZ 3BP8A 2W00A 1MSEC 2COMA 3HPGA 1P4WA 2F4MB 2DOAA 3BJAA 2R93J 4A3KJ 1ZG5A 1JHFA 2LRDA 1SD7A 3S1RJ 4OMYA 1R1TA 4ZZDA 2DMQA 2VJIA 5EEAA 1ERDA 2F5EA 3ZMZA 4G6TB 2A6HF 2H8WA 1FX7A 4KNYA 5FRNA 1EKEA 4S00A 4N9IA 3ZCOA 3BJOA 2GG8A 2EB7A 3WGHA 3PO3J 2DA6A 3KEOA 1JXSA 5IYBJ 3HDDA 3DV8A 1VQLI 3HOSA 2VKHA 4ZNGA 3CJQB 2C6YA 3DBHB 3MZYA 5F1RA 3CJTB 1PUEE 1UCRA 2M4KA 3RPUA 2JMWA 2NOGA 4B1RA 3GVAA 1YITI 4FUKA 1B4AA 2LSOA 2OF7A 2VN2A 3LSIA 2NYXA 3TOAA 2K7LA 2ZFUA 2FOWA 3OR2C 1TNSA 5ICCA 4BQOA 1ZGAA 3SYTA 3F8NA 4M9ZA 2KLOA 2W1OA 4IL6C 2EIJH 1C24A 2AXLA 4MNUA 3HOUJ 3DLAA 4LB6B 2RQQA 3QAHA 2HQNA 4IQJA 3HGGA 1IJWC 4A2UA 5ED4A 1LDKB 2KRHA 1HW2A 1A35A 3CQZJ 5HOOA 1YX3A 4RAYA 1TWAJ 2EBIA 5CVRA 1W7VA 1EA3A 4M3BA 1AHDP 2CUFA 2O8XA 2P5VA 1Z05A 3G3ZA 2DU9A 2IS1A 3KP4A 5CKTA 1JJ8C 3G1MA 2KDOA 3BR5A 3N4MA 1SAUA 2Z9OA 2LLKA 3HUGB 2JZYA 3WTZA 2EFPA 2UV1A 2VONA 3MEXA 1AU7A 2V6CA 3OYKA 3LSTA 4BJ5C 5K7FA 2CUZA 4IKFA 4RZZA 2A69F 4D1QA 1FBSA 2R7QA 1H8AC 2HZTA 5K5QA 4Z2YA 5BPIA 3I4MJ 1S5LC 1BOBA 4BBRJ 1EH7A 5BOXA 4V2GA 3VYSB 1WJ5A 3GF2A 3W6JB 3S2HJ 2PJRB 2R7UA 3Q0UA 2F5FA 1I1SA 2B63J 5JVGF 1IDYA 1FP2A 1UG2A 1JUPA 2DMNA 4FX4A 2CMPA 3RKXA 4QIWN 4CZCA 2E34A 2CUJA 1D1BA 4B8XA 1IUFA 3BQYA 2IW5A 4JOMA 1TWGJ 1B72B 1FOKA 5LEJA 1P4AA 4HG2A 2XAUA 3RI4A 2OCEA 1RNLA 1GT0C 3VYTB 2YSRA 5A2QK 2P9AA 3S1NJ 2HPIA 2GM4A 2DPDA 2XUBA 2K9QA 2XAJA
chains in the Genus database with same CATH topology
4FO8A 3IHUA 5CLSA 2M5WA 4MHGA 5D4SA 2PMHA 1O3SA 2EK5A 4M71A 2XAQA 3D0SA 4OMZA 3MCZA 4BNCA 5K5RA 3FM3A 1YTYA 1Z6RA 2XKPA 3N97A 2KIMA 3IU9A 2KKOA 4AD9A 2V3YA 3REOA 3V7RA 2EA4A 2P5KA 3BIPA 3BITA 4A6WA 4PZJA 5FB2A 3MR1A 3ERED 1FSHA 1KA8A 4HXXA 4JBAA 4P9UA 3VOEA 3JSOA 1IXRC 1EV7A 3GWZA 1VTNC 5ILUA 1XDUA 1LEBA 4P96A 3S6BA 2WC2A 3J7AO 3MAJA 3WTSC 3V8KA 2BHCA 4GGGA 2KJCA 1XDSA 4B09A 4HF0A 3GZ5A 2P98A 3ECOA 4U6WA 1XMAA 2ZJ2A 4JUQA 3RDIA 1BN5A 3GFJA 4Y15A 2FSWA 1WBQA 5HS9A 2MH2A 2B3HA 2FXAA 3MQ0A 1KQ9A 2V3ZA 1ONVA 3ISPA 4L0ZB 4IF7A 2Q0OA 1I27A 5CDLA 1AOYA 4S05A 1LJ9A 2HKOA 3I71A 1BM9A 2L3DA 4ON0A 1BI3A 4TV7A 4F7ZA 1K7AA 1WLRA 2HFHA 5HLHA 3GXOA 3KP3A 2Q94A 1B1BA 2BBYA 2VBXA 2GG3A 5ILSA 2ZO4A 4WK8F 5H6QA 4LG0A 3CB6A 3BY6A 2PG4A 2TDXA 4HV6A 3F22A 4RB1A 2GU5A 4FLLA 5E1ZB 3I58A 2QBYA 1ZRCA 3GW2A 4U73A 4E70A 3CUOA 3E6CC 1UHWA 2JPBA 3WTTC 2PI0A 3CO6C 1F9NA 3I0TA 5H20A 1USTA 5E8GA 1KQ0A 1B6AA 3DQVC 1B59A 1FWZA 2PQ8A 2X0LA 4H0EA 5LEKA 1QZYA 3L24A 2CQKA 4ZWUA 2P99A 3HRSA 5LGTA 4PNCA 2FRHA 3VEPA 1R1UA 2A6EF 1LDDA 1FLIA 4DQ2A 2FA5A 1T0FA 2HQRA 4O6JA 4EJOA 1RUOA 1Q1HA 3IRRA 2HOEA 4L9JA 1ZREA 1R1VA 2GG2A 2LKPA 5L3BA 1T39A 1IN7A 4L9NA 1RUNA 2OKNA 5E1XA 4U1BA 3F6OA 1W2MA 4UNOA 2KRFA 2Z5UA 1J59A 1C27A 1PP8F 3H92A 2BHBA 4I0BA 1TQPA 3K69A 4DNCA 3QU6A 4ZZLA 1NHAA 3RIRA 4KM3A 5D5UB 5ICEA 4UV8A 4WXCA 2ADUA 1KQ8A 3DKWA 1A04A 4S2RP 3K1MA 4G8XA 2VT3A 3CUQA 1K78B 1CF7A 1W7PB 3I54A 4A12A 1JE8A 5E18F 2FF4A 5CDVA 3HRUA 4KICA 5J8FA 1S29A 1XB4A 2UXNA 1UHMA 4ZWOA 5FFXA 1YW8A 3CB5A 1TW3A 3C7JA 1O3TA 2Y75A 3I4PA 1YLFA 1R00A 4HF1A 1ZYRF 4CDGA 1LDJA 1FNNA 3I59B 2NNNA 4Q48A 4ENKA 3MX6A 2Q92A 2OAZA 3ZMSA 3IWZA 2QVOA 2DAOA 2NRAC 4RAZA 4GYIA 4U6EA 3PQJA 3HSEA 4G6DA 1XGMA 3T5XA 2E1NA 1FYLA 3P9IA 3RKYA 3ZMTA 2EJRA 2L02A 4OIPF 2RV8A 2F5CA 4KFCA 1OR7A 4XBFA 4KA4A 4RGXA 2CO5A 1HKSA 2Z99A 4LD5A 6PAXA 5CVJA 3MZHA 5TJJA 1LNWA 1XN7A 4YFNF 1ZLJA 1WI9A 1L0OC 3F72A 2NQ7A 2PLYA 2EFNA 3ECHA 3K1NA 1ZG1A 1KU3A 3COAC 1V3FA 2FNPA 4FLIA 1XGOA 4AIHA 2DK5A 4QWQA 2YR2A 2EA2A 5E8IA 5J6XA 1REPC 5BQTA 3LQRA 4GCVA 1MDMB 1HKQA 2R3SA 5AONA 5FFZA 3LFKA 4LLLA 3O6BB 2UXXA 4UUVA 2Y48A 2YU3A 2M30A 3CUQC 3ULQB 3E5UA 2XASA 5LHGA 5D5VB 2MD5A 2IA2A 1ON2A 4OIRF 1ZHFA 1YO5C 3RORA 1SFUA 3CO7C 5DUKA 1KGSA 4HDUA 2ESHA 3CJNA 3ZN1A 5L3FA 3KP2A 3IC7A 3F21A 3L7GA 3LA2A 1QPMA 2PN6A 4ZYDA 4WXDA 1Z1DA 3WE2A 2EV5A 3MFKA 3U1DA 3KETA 1C0WA 1Y0UA 4QLCU 3SXYA 1MJAA 3B02A 1ZRDA 4BHCA 4NQWA 2XKOA 1DPRA 1G6NA 1TLHB 1IN4A 4MATA 3HUGA 2QWWA 4I2OA 3M1EA 2MBFA 2WWYA 5L3GA 5EEGA 2FU4A 3DPLC 3WGGA 3DP7A 3IG4A 5KK1A 2DQRA 1BI1A 2ZFWA 2P6SA 1AWCA 4KMFA 1OPCA 3HSFA 2GU7A 3HHHA 2EVOA 2CSOA 5FCFA 3JTHA 4IECA 5E17F 1H9TA 2RVCA 3RTRA 1WSUA 1MJ9A 1U5TA 2CGPA 3M8FA 3FXUA 4BYYA 1R22A 4G94A 1U3EM 3GZ6A 4HV5A 2O61A 2BE5F 5LRSA 4N9HA 1W5SA 1I5ZA 3E3VA 4RS8A 5K5OA 4FT8A 4OOIA 2DFIA 3JW4A 1XGSA 3EYIA 3NEUA 2H09A 5CNXA 4KMUX 4LB5A 2DBBA 2XGXA 1MDMA 1WN1A 3LAPA 3SQNA 5AIQA 4U7DA 4IRHA 1WY2A 2QQAA 2CYYA 2WTEA 5CDEA 3BWGA 2A07F 2VODA 5D5XB 5HDGA 2H94A 4KIGA 2G9WA 2VC0A 3R60A 3ZN0A 2O03A 4CYDA 2RDPA 2P6TA 3DXJF 1J5YA 4S2TP 2NS0A 3L9FA 2VOOA 1H9GA 5HDNA 1UFMA 4FLJA 4IU6A 3S2WA 2H27A 1SMYF 5DCFA 2XIGA 1SD5A 2OZUA 4BXUA 2PMUA 4HBLA 3V8JA 4YFKF 1Y1NA 1S3JA 3LA7A 3F6VA 4BQAA 2J5OA 2BV6A 4ESBA 3FMSA 4YIFA 4AIJA 1O3QA 5JVTA 3LWFA 2GG5A 1I1GA 1OYYA 1USSA 2QLZA 4LJZF 1KU2A 4EVIA 3TO6A 1KU7A 1Z91A 5DCMA 1WL9A 1KU9A 5FGMA 5HVQC 2AS5F 3PFIA 4D0PA 1YQAA 4WCGA 3BPXA 4FLKA 2O6GE 1SFXA 1F1ZA 1XCVA 3E97A 1U78A 1MGTA 3KP5A 2VT2A 2VC1A 3PKAA 3WU0A 2ZBKA 2L4MA 4NB5A 2V1UA 5IT9Z 3TOBA 4KN7X 2Q96A 4KIFA 2BN7A 4G7ZF 3GFIA 3QP5A 2HKXA 1W5TA 2QM3A 4RGRA 3WTWC 3E6MA 5LRRA 2R7DA 4EM0B 4ESJA 4XSZF 4EJTA 4OIOF 2CG4A 2K02A 4UVBA 3IU7A 4O3MA 1LB2A 1O7FA 4EJVA 1FPQA 5DCMB 2L4AA 3ML6A 3VODA 4HA8A 4FX0A 3RJPA 2HDCA 3I64A 1FSEA 4CO8A 2M1BA 1HKTA 2QQBA 3ROUA 3CTAA 3V8LA 3TO7A 2W25A 3CTZA 3J81Z 3TAVA 4RB2C 1TBXA 5HLIA 2ELHA 3TQNA 4Q4ZF 2PJPA 1S7AA 3K9TA 5CVVA 1C21A 2Q93A 2GXGA 2GG7A 2JSCA 4RGUA 1J75A 3WU1B 4LK1F 5KVRA 4OINF 3M8EA 3BIQA 3E6BA 2GA2A 1XCBA 2ACJA 1IN6A 2IP2A 4I09A 2MC3A 1J7KA 4N0BA 5DV5A 3QPTA 1R7JA 1PV9A 3IU8A 4IKUA 1P2FA 3SFZA 2F2EA 1UB9A 1GHCA 3M7GA 2G7UA 2D1VA 3QPHA 2JT1A 5BMZA 3P9CA 3T1BA 1U5TB 4IRIA 1IXSB 2PBIA 4IRGA 2KIFA 5D6FA 1X3UA 3KLNA 1O57A 2GG9A 1SD6A 1TW2A 1T38A 4HW0A 3EUHA 1IXCA 4U71A 1YW7A 4WX9A 2LF7A 3HYIA 5CVUA 2YX7A 2YPRA 2BWYA 2GQQA 1MZBA 1IW7F 3KP6A 1ODDA 2HOWA 2Q8KA 4PV4A 4IDYA 2A3SA 3DEUA 2FBKA 4CGZA 4OOKA 2DO7A 2DT5A 1YVMA 4IKRA 2DLLA 2V9VA 3HIFA 1WWXA 1WL6A 4U0WA 1M35A 4K2EA 1LEAA 2DQLA 2PEXA 1IRGA 5D5WB 1QNTA 2ISYA 3R61A 4M6YA 3P9KA 3BOQA 1D8KA 1G3YA 1U2WA 2E7XA 2JRTA 1HSTA 2BEOA 2JTVA 2BB7A 4EV0A 2JPCA 2MH9A 4XRFA 5BS6A 3E5XA 4XSXF 3KEQA 4HQEA 4ZYGA 4CICA 3FXRA 4FKCA 1FYMA 5CVIA 3RVAA 1XNZA 3TGNA 2BWSA 4G7HF 2A5YB 1OMIA 2FQ3A 5DUIA 2B3LA 2EFWA 5D8LB 2V1DA 2ZCWA 2QYOA 3I53A 3ZP5A 3CUQB 2VBWA 3T0YA 5JHUA 2EVMA 5HDKA 3FMQA 5ILVA 1CGPA 2FBIA 2E1CA 3AAFA 4R79A 4Q5SF 4R1HA 2QZ8A 2VBZA 1CHMA 3R4KA 1ZGJA 4EJWA 5EEHA 2GZ5A 4OU0A 3QRFF 3VFZA 3H3UA 3Q6DA 4HQMA 4O5VA 4HLXA 3DFGA 5L3DA 1BC7C 3F23A 2EWNA 4I0AA 3G73A 3JAMZ 2ISZA 4YFXF 5FO5A 4EM2A 5F6FA 1BIBA 2MLGA 3D5LA 4HX8A 3U2RA 1TQMA 3WGIA 4U70A 4U88A 3K1PA 2P4WA 1BJAA 3E5QA 1E17A 4A6EA 4XLNF 1PDNC 2L54A 5CJ9A 2EFQA 4EGYA 3O2PE 1IF1A 4B28A 3PKDA 2RNJA 2OQRA 4P9FA 3KE2A 5A2QZ 3QU3A 3TKYA 1QXZA 5BPDA 3EYYA 1HW5A 1U5TC 4M74A 4AIKA 3GFLA 2BHDA 2YX4A 4A6DA 4EGEA 1DPUA 4LGWA 2LDUA 3K0LA 3HRTA 4M73A 1R5HA 3IKTA 3MWMA 2P7VB 4CZZA 1KYZA 1TQIA 2BWWA 1B9MA 2XROA 2EVCA 3HOTA 2A61A 2DTRA 2MLKA 2CFXA 2STWA 2O0YA 1BBYA 1YYVA 1ZARA 4M72A 1MKMA 2P8TA 2F5DA 3JAMK 1H0MA 5FD5A 1ON1A 2BWVA 2H6BA 2ZXJA 1P6RA 1GXPA 5FD6A 2IRFG 3JSPA 3KCCA 4IJAA 4BH9A 5LLQA 3IRQA 4GO1A 3WTYC 5LGUA 3F8MA 1QQIA 1XSXA 2KJBA 5IT9K 5ERIA 3J80Z 4KUMA 3V4GA 2P7CB 3SHFA 5DD8A 3H3ZA 1IUYA 4U6ZA 3HTUA 2GGBA 4I01A 1RIOH 3ZQ7A 3C1DA 1S7OA 4I98B 1YG2A 3F3XA 4IXAA 4PDKA 1A16A 3HTSB 4EGZA 2OQGA 3OV8A 4FHTA 5TRDA 1DP7P 4PGHA 4A5MA 4L9VA 4U6CA 4KN4X 2ZSGA 2QQ9A 2H6CA 1Z7UA 2XRNA 2GAUA 4ZYHA 1BIAA 2CWEA 1U6GA 1XSVA 4QR8A 1TTYA 3T8RA 1YJ3A 3E6DA 5L3CA 2DW4A 4A0ZA 1YS7A 1WRJA 2UZKA 4LK0F 4HAMA 1O0XA 4U7BA 1BI2A 4HDVA 1BI0A 1U8RA 2OBPA 5JI6A 1C23A 4R60A 4LLNA 3VB2A 2RQPA 4L0YB 2VE9A 1T6SA 4HX4A 4L18B 4U0VA 3IL2A 3J80K 2HR3A 3ZMUA 2KIUA 3DPTA 4BAYA 2GWRA 2DI3A 3I59A 3O3KA 2EV6A 1EH8A 1YS6A 2GU4A 4U6JA 2D2WA 5IT3A 4BHPA 3C18A 2VE8A 1R23A 2G7HA 1G3TA 2OZ6A 3L00A 2BWUA 3KZYA 3KZZA 4UV9A 2QUFA 5FLXK 3F8FA 4ESFA 1PP7U 2BHAA 3TB5A 4WXHA 3FF5A 4BHBA 3CDHA 3TO9A 3GX4X 1W7PD 5LGNA 1ZLKA 2RN7A 2K27A 3ZMVA 1FT9A 2X4HA 2IVMA 3ABTA 1R5GA 2K86A 4M9SA 2OA4A 2NQ6A 4UXNA 1G4DA 4RGSA 2FE3A 4ETSA 2IJLA 1IN5A 5F64A 2LF8A 3FMRA 1B9NA 3GUDA 2ZKZA 4ZWPA 1F4KA 3SZPA 1EH6A 1T98A 1GXQA 2RKHA 5E1WA 4EQQA 3NQOA 5CE6A 4I02A 5LHHA 3SZTA 2GU6A 3ABUA 1P92A 4UHTA 2HGCA 3ZMDA 4I7HA 5D8KB 2FEZA 3WTUC 4EMSA 2FMLA 4G6QA 1ZRFA 2HYGD 4WWCA 3WG9A 1FC3A 2LNBA 2FBHA 3BPVA 5E20A 3PKBA 3C3WA 2FNAA 4XLPF 4AVPA 3CLOA 1ZG3A 4A0YA 4P5OA 5K1YA 2M45A 3W6KB 1N51A 1CF7B 1FBUA 4IPAA 3HHGA 1I6XA 1JHHA 1SAXA 3J81K 1ZH5A 2VXZA 2XAGA 3QOPA 3GEZA 4IHTA 4OIQF 4KDPA 2W85A 3Q9VA 2GXBA 4PCQA 2BGCA 5HS8A 2B3KA 1BOAA 2J5PA 4IF4A 3DF8A 4ENMA 1R36A 2GG0A 1JAWA 2GA1A 1T2KA 3L2CA 2GIVA 4YIIA 5DEQA 3GFMA 2P5LC 3BROA 2CW0F 2FOKA 3LQQA 3M9AA 2MA3A 1HSJA 4S04A 1OYWA 4P55A 2V79A 2NNYA 2HWVA 2VBYA 4PGGA 2BWTA 3BZ6A 1SD4A 1KP0A 4ASNA 2L01A 5ICGA 2WV0A 2IA0A 5DDGA 2ESNA 4HZFA 1XMKA 5CIKA 1SMTA 2XHKA 4U76A 2XAFA 1K79A 5E5BA 4GYGA 1HQCA 3GYHX 4HOBA 1R58A 1FYKA 1XD7A 1L3LA 1YIOA 4LLGF 2DK8A 5ICFA 5DD4A 4HX7A 1MD0A 3LA3A 2BH3A 4KT5C 2ZMEB 2XVCA 3FXQA 1TNTA 1ULYA 2EFOA 1RZ4A 4MQ9F 4ZH4F 4ENNA 2DPUA 3LAJA 3F8CA 3FM5A 3U9GA 1G3SA 3IKVA 3PQKA 5L3EA 1IZ1A 2O3FA 2D45A 4RB3C 1IRFA 3BJ6A 2ZNYA 1S6LA 2VOPA 5DYMA 2G6PA 2FMYA 3OOPA 2PFBA 1WKMA 1O3RA 1MATA 1FBQA 3KP7A 4LMYA 1QO0D 4JQFA 4CXFA 1QXYA 3FZVA 1QZZA 4G9YA 4KIBA 3ELKA 2ETHA 2OU2A 2MATA 4HLYA 3K2ZA 1S8NA 4RB0A 3QP6A 2V1XA 3WTXC 3MATA 4IHSA 3B73A 4LG0B 3EDPA 3TDUC 2W24A 4ENJA 1W7PA 5HS7A 1HBXG 2EV0A 1LVAA 1YFHA 1WQ2A 4Y17A 4IVNA 1MJBA 2ZNZA 3R6SA 2QBYB 1E2XA 4Y13A 1BC8C 4KYWA 4U69A 2HYFA 3WODF 2XAHA 4IKTA 3L09A 4MEYF 1FZPB 1K6OA 2IA1A 3BDDA 3RPQA 2HEOA 3IWFA 1ZAOA 4G7OF 4ZYEA 2STTA 3WE3A 2Y0MA 3T8TA 3V7CA 3RYRA 4UVCA 1FP1D 2BWXA 2GGCA 3EQLF 1D8JA 4GXOA 1Z6TA 1GVJA 2Q2EA 2GZWA 2Z33A 2GTXA 1W4MA 1IN8A 1J9IA 3P7NA 4MTDA 1V4RA 1O7LA 3RYPA 5H6RA 3FX3A 3HRMA 3GO5A 3ZPLA 3WTVC 2W84A 5D4RA 2Q95A 2W57A 1J0RA 4Q47A 3HSRA 1KYWA 4MTEA 4Z7MA 4EM1A 2K4BA 2E7WA 4HF2A 3F8BA 3Q9SA 3GLXA 3EETA 3PKCA 2IW2A 1QBJA 4RZYA 1QXWA 1XSDA 2UWMA 4LFUA 3NRVA 3D27A 1Z9CA 4MEXF 2A68F 4U0YA 4WF2A 5LHIA 1LQ1A 4FO7A 1J2XA 4U75A 3PKEA 3L7WA 4JK1X 1C22A 1K78A 1DDNA 4M9XA 2IT0A 4MGRA 5CYVA 3KFWX 4L5IA 5J8CA 4S01A 4L5JA 2M8EA 1QGPA 4A6VA 1D3YA 4R8HA 3JTGA 1F5TA 2HTJA 5JR3A 5AIPA 2HTSA 2Z3YA 1OYIA 4MQVA 2K4JA 1RI7A 2RGVA 3RKWA 2D1HA 3TDZC 1YW9A 4IKSA 1SFEA 2B0LA 1DUXC 5LBQA 4L9TA 2BYVE 2V3XA 1P4XA 4UVAA 1IAWA 5D6EA 2HS5A 1XGNA 2R7FA 3R0JA 2ZMEA 3FWEA 2M87A 4A0XA 3I5UA 1G3WA 3FHZA 5FCHA 2RC4A 4A5NA 1STZA 1HW1A 2QENA 4NHJA 3R0AA 2IPQX 4RGZ1 4EJUA 2NAZA 3KLOA 2OD5A 4AWXB 1FY7A 1JGSA 3V7SA 4YG2F 4M6XA 4HYEA 1ZN2A 3Q5FA 5HLGA 1D5VA 2XV4S 5JFRA 1HXDA 4CHUA 1OKRA 5FLXZ 3BP8A 2COMA 1P4WA 3BJAA 1ZG5A 1JHFA 1SD7A 4OMYA 1R1TA 4ZZDA 2F5EA 3ZMZA 2A6HF 1FX7A 4KNYA 4S00A 4N9IA 2GG8A 3BJOA 2EB7A 3WGHA 3KEOA 1JXSA 3DV8A 3HOSA 4ZNGA 2C6YA 3MZYA 5F1RA 1PUEE 1UCRA 3RPUA 3GVAA 4FUKA 1B4AA 2LSOA 2VN2A 2NYXA 3TOAA 2K7LA 1TNSA 5ICCA 1ZGAA 3F8NA 4M9ZA 1C24A 2AXLA 4MNUA 4LB6B 3QAHA 2HQNA 4A2UA 5ED4A 1LDKB 1HW2A 5HOOA 4RAYA 5CVRA 1W7VA 2O8XA 2P5VA 1Z05A 3G3ZA 2DU9A 3KP4A 3N4MA 2Z9OA 2JZYA 3WTZA 2EFPA 2VONA 3MEXA 2V6CA 3LSTA 4RZZA 2A69F 1FBSA 2HZTA 5K5QA 4Z2YA 5BPIA 1EH7A 5BOXA 3GF2A 3W6JB 2F5FA 1I1SA 1FP2A 4FX4A 3RKXA 4B8XA 2IW5A 1FOKA 5LEJA 1P4AA 3RI4A 1RNLA 2YSRA 5A2QK 2P9AA 2DPDA 2XUBA