1XGOA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
295
structure length
295
Chain Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 81
structure length 295
sequence length 295
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgoA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgoA01
3REOA 1NHAA 1ZARA 4JBAA 4FLIA 1J5YA 1IW7F 3CUQB 4NHJA 4AD9A 2M8EA 3ECHA 1WI9A 5DV5A 3T1BA 2OZ6A 2QVOA 2Z99A 2XGXA 2BYVE 2FU4A 2RDPA 1P2FA 4HLYA 3ZPLA 3T5XA 4I09A 5LGNA 3IU8A 1Y1NA 4I7HA 4PZJA 3GFIA 2ZMEA 3NQOA 5D5VB 2YPRA 4PV4A 2XAGA 4HDVA 2VC0A 1PV9A 1SD5A 2BH3A 3RDIA 2VT2A 2BB7A 2R7FA 2ZFWA 3HSEA 4U73A 3IWZA 4RAZA 1UFMA 4HX4A 4ZZDA 5BS6A 5HS9A 2WTEA 5JR3A 1SD7A 4EVIA 1UHWA 3ABTA 2IP2A 5CVRA 2X4HA 3W6KB 1W5TA 1T39A 4ZYEA 3ERED 3FX3A 1O3QA 2VN2A 4XRFA 2ZJ2A 4OMYA 3K69A 2MD5A 5ICGA 3BPXA 3LQQA 1BBYA 2YU3A 3JSOA 2B3LA 3CO6C 1BOAA 2P5VA 2G6PA 2CQKA 1B9MA 5FO5A 4GXOA 2KRFA 2ADUA 5DD4A 3FM5A 1FX7A 2QQBA 4ASNA 1SAXA 4I0AA 1G3WA 1YVMA 1ON1A 2ISYA 1KQ9A 5L3EA 2H09A 3I4PA 2A6HF 5CJ9A 2JT1A 3M8EA 2L3DA 2V1XA 2C6YA 4RGRA 4Y13A 4WXHA 2OZUA 4A6VA 1MATA 1O3RA 1M35A 4S05A 1VTNC 2GG7A 5FCFA 2ESHA 2MA3A 3TO7A 2STTA 3DV8A 2P6SA 2HZTA 2VE9A 4YIFA 2LSOA 1OKRA 3DPTA 2DTRA 4IKSA 1RZ4A 4U70A 3HRUA 2WC2A 3C1DA 3MATA 2DW4A 1U5TA 1XD7A 2PMUA 1R22A 2E7XA 1O0XA 3GW2A 3QPHA 5LEJA 1JXSA 2DT5A 5LLQA 1P4AA 1B1BA 1ZGJA 4LMYA 3O6BB 2K86A 4LG0B 3SXYA 4MQVA 2XASA 1DDNA 1I1GA 1YTYA 1B6AA 1ZG1A 3QP6A 2CW0F 1HBXG 3F72A 4IECA 3VOEA 5DYMA 2L4AA 3GVAA 4OOKA 4HQEA 3HYIA 5HLHA 3FMRA 3BZ6A 2YR2A 2FBKA 1R1VA 1H9GA 3FZVA 1KA8A 2DO7A 5HDKA 2Z3YA 3AAFA 4A0XA 2DQRA 2KIMA 3BY6A 3KFWX 4ENJA 1TNTA 5K5OA 2MLKA 3MX6A 4WWCA 2D45A 1BI2A 2A07F 5CVVA 5FD5A 1RUNA 4IKTA 3E6DA 1QXYA 5ICFA 1UHMA 4EJTA 3EYIA 2O03A 2FRHA 1C27A 1FNNA 4HW0A 2GG0A 3L7GA 1HKSA 4IRGA 1T98A 2OU2A 3H92A 4Z2YA 5D6FA 1O7LA 2VT3A 3G3ZA 3BROA 3RYPA 4UUVA 2RQPA 1FY7A 5CDLA 2YSRA 4EM1A 2NYXA 3WGGA 5CLSA 4RB3C 1XGMA 1YG2A 2XAJA 3F22A 2GG3A 5A2QZ 1G3TA 4KN4X 2EA4A 2DQLA 3QAHA 3I64A 1L0OC 2DPDA 1XCVA 1HKTA 3WTZA 1BC7C 2M45A 3TGNA 2EFPA 1KU9A 3HHHA 1EH6A 1R1UA 3TO9A 2BWSA 4N9HA 2DLLA 2Q93A 1U3EM 4FT8A 3T0YA 4IKUA 3RPQA 1PDNC 5DD8A 3N97A 4KFCA 2PG4A 5ILVA 4U69A 2VBWA 2GG8A 3WE2A 3G73A 5D4SA 1E2XA 5ICEA 2Y48A 3R60A 4CXFA 2BE5F 3RIRA 4RGUA 3BWGA 5CYVA 3SQNA 1USTA 6PAXA 5ED4A 4BNCA 4I98B 3B02A 3ZN0A 2H6CA 2QWWA 2EK5A 4LLLA 1STZA 5HLIA 2IVMA 1EH7A 2QBYB 3F8MA 4GO1A 3K1NA 4KMFA 4KYWA 2ETHA 2V79A 1IUYA 2OA4A 1IN7A 4UXNA 4M71A 4EV0A 2FF4A 2GGBA 2BWUA 3IG4A 4N0BA 1BIBA 3ELKA 4R1HA 2HR3A 2GU6A 3QOPA 1PP8F 1JGSA 2E1NA 2L54A 1TQPA 3WG9A 2RC4A 2TDXA 4L0ZB 1OMIA 4HX7A 4A6DA 2BN7A 3WU0A 4P9FA 1BM9A 3I0TA 1PUEE 3HHGA 1ZHFA 3WGHA 1V3FA 1IZ1A 4OU0A 2X0LA 4FLLA 2K4BA 2VBZA 1Y0UA 3CUQC 1WRJA 5K5QA 3P9KA 4L9TA 2JRTA 3F8CA 2HTSA 2IJLA 1S6LA 5D5WB 2ZNYA 1R58A 1JE8A 2BWVA 5CDVA 2XAFA 3WTUC 5H20A 4RGXA 4G7HF 1XN7A 1O57A 2NAZA 3ABUA 3DXJF 3J80Z 2BGCA 3MWMA 1QZZA 1BI1A 2KKOA 3L9FA 4GYIA 1HXDA 5HDGA 4L18B 2G7HA 1Z1DA 3HTUA 3IHUA 2QLZA 2P6TA 4B28A 3DEUA 3ULQB 4RB2C 1YYVA 1Z05A 3PKCA 2PEXA 1HSJA 2O3FA 4IRIA 4IXAA 2VONA 3TDUC 3IKTA 3GZ6A 1XCBA 5BPIA 4RZYA 3VEPA 2F5DA 2GTXA 2JSCA 1A04A 3WU1B 3FWEA 3H3UA 3ML6A 1ZRFA 4IHSA 3RJPA 4PGHA 1Z7UA 2DPUA 1BI3A 3K1PA 5H6RA 5L3CA 2GU7A 2GWRA 2CYYA 3KP5A 2QZ8A 2RV8A 1U6GA 3GZ5A 1J59A 3J81Z 5J8FA 1WLRA 4HQMA 4XSZF 4UNOA 1V4RA 3RKYA 5E8IA 4ENKA 5HS8A 2VOPA 2FNPA 4HZFA 3ECOA 2F5EA 4LK1F 3GLXA 4ZZLA 1GVJA 2FMLA 1OPCA 1OYIA 3I59A 5LEKA 1R5GA 5DCMB 4CYDA 1PP7U 2IPQX 1C21A 3LAPA 4ESJA 2IA1A 4S01A 1J0RA 1Z6TA 2HYGD 5E20A 1WKMA 4IDYA 5HLGA 1FC3A 2UZKA 1B9NA 2PFBA 3C18A 2XAHA 1HQCA 2Q8KA 1USSA 3HRMA 3K1MA 2FBHA 1W7PA 4HA8A 1XGNA 2XRNA 1MJ9A 3F6VA 4A0ZA 1TNSA 3C7JA 4UHTA 5FCHA 4DNCA 3HIFA 2ZO4A 3WTXC 5J8CA 3QP5A 2W24A 2IT0A 3GUDA 2MH9A 3K0LA 1FYKA 3CTZA 5E8GA 4FLKA 1XMAA 3GO5A 3PKBA 3BPVA 2XKOA 3FHZA 1CF7B 4QWQA 4AIKA 1ZRCA 5E17F 4L9JA 3Q9VA 4CICA 2Z5UA 2W84A 1SMYF 2BWWA 4HAMA 2ZBKA 4U7DA 4M9SA 1XSVA 2GU5A 3KZYA 3M8FA 4N9IA 3M9AA 1FSHA 1R00A 1ZLJA 4LJZF 1I5ZA 3CUQA 2AS5F 3E5XA 1RNLA 2HEOA 4WF2A 2DAOA 4MEYF 1FP1D 4OMZA 1Q1HA 3I54A 1K6OA 2ZNZA 2BHBA 1DPRA 3E5UA 3PQJA 4ZYDA 1IN6A 4MATA 3JAMZ 5AONA 5A2QK 3F23A 1FLIA 1F1ZA 1C24A 1I1SA 4EGYA 1S29A 4G6DA 4EM0B 4BYYA 3GFLA 2GG5A 3TKYA 4E70A 4RB0A 2RGVA 3V4GA 2IW5A 5DEQA 4MNUA 4LFUA 1UB9A 2O0YA 3E6BA 4OIQF 4IU6A 3M7GA 4O5VA 1XB4A 1W2MA 4XBFA 2BHAA 5L3GA 4U88A 5CE6A 3GX4X 3R0AA 2CFXA 3BOQA 4I01A 4HF2A 2XROA 4UVBA 1SFEA 4EGZA 1BIAA 2HGCA 1S8NA 3R6SA 3CO7C 4P96A 2P98A 4ESBA 2B0LA 3F6OA 2E7WA 2QQAA 2GZ5A 2LKPA 4RZZA 1IRFA 3H3ZA 5FD6A 1JHHA 3QPTA 2BEOA 3CUOA 2Z33A 1KU7A 4KMUX 3ZMDA 3KZZA 1H9TA 2GA1A 1E17A 3TO6A 2STWA 3FM3A 1FPQA 3DKWA 2Z9OA 3L09A 4LD5A 4FLJA 5KVRA 3P9IA 4FHTA 5FGMA 3ZMTA 1WL6A 4M73A 1BI0A 1DPUA 2G9WA 4ZNGA 4NB5A 3QU3A 2Q94A 5F6FA 4U6EA 2ISZA 4HF1A 3GF2A 4GCVA 1J9IA 1A16A 5JVTA 1SFUA 5CDEA 1YS6A 2XUBA 2MC3A 4UVCA 3B73A 5CVUA 2R7DA 4L5IA 4F7ZA 3WGIA 4U6WA 3PKDA 2EV5A 3MQ0A 2F2EA 2L4MA 4UV9A 4Q47A 4EM2A 5ICCA 1Z91A 2H6BA 4LG0A 3FXQA 1S7OA 2CSOA 1T6SA 2Q0OA 3TDZC 4IJAA 5ILUA 3BDDA 4ZYHA 3CB5A 1KU2A 3T8TA 3J80K 2XAQA 1K78B 4U76A 1UCRA 3EYYA 2P7CB 1DUXC 2FQ3A 1LQ1A 3CTAA 3TOBA 3M1EA 1C23A 1CHMA 1FBUA 1FT9A 1KGSA 1WWXA 3KP7A 2BHCA 3K9TA 1T38A 3OOPA 3S6BA 4G6QA 3RTRA 5CVJA 2W25A 4RS8A 2A68F 4CDGA 2K7LA 4DQ2A 5BOXA 3WTVC 4HDUA 3O2PE 1F9NA 4S00A 1KYZA 3BP8A 3L7WA 4KT5C 3ZMUA 3GYHX 1TLHB 1O3SA 1OYYA 1WSUA 2CG4A 2ELHA 4PDKA 4U7BA 4U75A 4MTEA 3J81K 3RVAA 1YLFA 1TBXA 5J6XA 2EWNA 3COAC 4R8HA 1R7JA 3HOSA 4L0YB 3ZQ7A 5BMZA 4TV7A 3C3WA 2IW2A 2BWYA 3RORA 2EVCA 4U6JA 1FSEA 2JPCA 3RKXA 1D3YA 4RB1A 1R5HA 4G7ZF 2EV0A 2GU4A 2BBYA 4LB6B 3KE2A 3L2CA 3CJNA 4CGZA 2ESNA 1KYWA 4WK8F 2BWTA 1MJBA 5CVIA 2HOEA 5K1YA 3LA7A 2K27A 1BJAA 5AIQA 3DPLC 3MFKA 3DP7A 1BN5A 4U71A 2P8TA 1YQAA 2HOWA 4BHCA 1LDKB 4KIFA 5LRSA 2K4JA 2W85A 4R60A 1ZREA 4M6XA 2PJPA 2J5PA 2HQRA 2P99A 1G6NA 4M72A 5DUKA 3RI4A 1MDMB 4S2TP 2D2WA 2QBYA 2VC1A 4LLGF 2NRAC 1K79A 1FZPB 4A6WA 2B3HA 3LAJA 1Z9CA 4KA4A 2VBXA 3IWFA 4A5NA 4IRHA 2FBIA 1XDUA 4U0WA 3JAMK 1MDMA 2RN7A 5L3BA 5CIKA 4ENNA 4I02A 3I58A 3Q5FA 1LB2A 4OINF 2P5LC 3WTSC 1WQ2A 2Q92A 3SFZA 2IA0A 1IXSB 1MGTA 1GXQA 3KP2A 2PMHA 3EETA 1IN4A 4WXDA 2CO5A 3ROUA 4PNCA 2P9AA 2EV6A 1MZBA 2UWMA 5JI6A 4WCGA 2A5YB 4PGGA 2XKPA 4KDPA 3HRTA 2W57A 2O8XA 1IN8A 3I71A 1ON2A 2FEZA 2VBYA 1O3TA 4U6CA 1T0FA 1AOYA 2NNYA 1IF1A 2WV0A 5LGUA 2NQ7A 1I27A 2ZXJA 3HOTA 1HSTA 3Q6DA 2A69F 1GXPA 4Q4ZF 4XLPF 4I0BA 3V7SA 2DFIA 5FLXZ 4ZWUA 2Q2EA 2K02A 2RVCA 1B4AA 1KQ0A 1G4DA 4BH9A 4Z7MA 2IRFG 4G7OF 2A3SA 5E5BA 2QQ9A 3RPUA 4U0VA 3IKVA 1MD0A 2F5CA 2OAZA 3KEOA 4ON0A 3CB6A 4RAYA 3F3XA 4WXCA 1JAWA 4FO7A 1J75A 3BIPA 4QLCU 5HOOA 4ZWPA 3TB5A 1FBQA 3OV8A 3JTHA 4AIJA 1LJ9A 2MH2A 3ZN1A 4XSXF 2EVMA 2CGPA 2Q95A 2D1VA 2OQGA 3KCCA 2HKOA 3E6CC 1FP2A 4A6EA 2WWYA 2P4WA 3PQKA 1ZRDA 2GA2A 3BITA 3RKWA 5IT9Z 4U1BA 4A5MA 5E1XA 3IRRA 2V1DA 3FMSA 3KLNA 3R4KA 3P9CA 5DCMA 1W7VA 3JW4A 2V3YA 3U1DA 2H27A 2GQQA 3HSFA 3V8JA 1H0MA 2DBBA 3LSTA 5L3FA 3TAVA 3DQVC 2ZSGA 3TQNA 5LRRA 3MAJA 1P92A 2G7UA 5JHUA 2PLYA 3HTSB 2AXLA 2XV4S 1FBSA 3W6JB 1ZG3A 4A2UA 4ZH4F 4NQWA 4S2RP 2FNAA 3IRQA 2NNNA 5DUIA 2COMA 4I2OA 1TTYA 2ZMEB 3MCZA 3U2RA 3LQRA 1QQIA 2LDUA 1C22A 1R23A 1RI7A 2Y0MA 3RYRA 5F1RA 2M87A 1C0WA 4MTDA 1CF7A 2Y75A 4ETSA 2UXNA 1I6XA 2GGCA 5DDGA 2FE3A 4BHPA 3ZMVA 2KJBA 4IPAA 3LA2A 4JUQA 4Q48A 2FA5A 2QM3A 1J2XA 4YFKF 3DFGA 4HXXA 2PBIA 2MBFA 5H6QA 3ZMZA 4PCQA 4ENMA 2O6GE 4HF0A 4EJUA 4LB5A 3IC7A 3KETA 2E1CA 1EH8A 3JSPA 2GG9A 1WY2A 1YFHA 2O61A 2DU9A 5E1WA 2LF7A 2BHDA 3SHFA 1IN5A 4RGZ1 5TRDA 4IHTA 1TW3A 5EEGA 3WTYC 4FX0A 3L24A 1OR7A 4EJVA 4G9YA 2ZCWA 3R0JA 1IXRC 2HYFA 1XSDA 1HW2A 2DK5A 2GIVA 3WODF 1XGOA 2FMYA 1R1TA 2RKHA 4HV6A 4KIGA 4L9VA 5E18F 1U78A 4ESFA 3LA3A 1HW5A 4GGGA 3BJOA 4HLXA 1KP0A 1FYLA 4YFXF 4MHGA 3HSRA 1YW8A 5D8LB 3WE3A 1U2WA 3FXRA 2FSWA 1D5VA 1QO0D 5D5UB 2V3XA 2JTVA 2EFOA 4A12A 5TJJA 2L01A 4H0EA 1U5TB 4MEXF 3FMQA 4EJWA 2EFWA 4IVNA 3N4MA 3MZHA 1LVAA 4ZWOA 3PKAA 3V8KA 3NRVA 1XGSA 3O3KA 4AVPA 4HV5A 1D8KA 1QPMA 2VODA 1LDJA 3BIQA 1F5TA 5KK1A 1ODDA 1XSXA 1QGPA 5E1ZB 3I53A 2KIUA 4G8XA 4OIOF 4FX4A 5BQTA 1ZAOA 4HBLA 3D27A 2FXAA 2QYOA 5IT3A 2V6CA 2P7VB 1O7FA 3BJAA 4KM3A 1MJAA 2OQRA 1SFXA 2HFHA 4IKRA 5DCFA 4O6JA 2DI3A 2A61A 2V9VA 3KP4A 3CDHA 5HDNA 1YW9A 4KIBA 1B59A 4BXUA 3J7AO 3GFMA 2Q96A 4FKCA 1XMKA 2HDCA 2GAUA 4LGWA 2BV6A 4FUKA 2RNJA 4B09A 2MATA 3E5QA 1G3YA 3BJ6A 2R3SA 1CGPA 3GXOA 3GEZA 4M74A 1X3UA 2XHKA 1JHFA 3GFJA 1K78A 1R36A 4KUMA 4BHBA 5FLXK 4AWXB 4G94A 1TQIA 3PKEA 3EQLF 3HUGA 1MKMA 1QNTA 2JZYA 3IU7A 1TQMA 2NS0A 1IAWA 1GHCA 1REPC 4CZZA 5D8KB 3VB2A 1ZLKA 2F5FA 1AWCA 4Y17A 3WTTC 3Q9SA 3P7NA 2EB7A 5EEHA 3SZPA 1YJ3A 1RUOA 3QRFF 4UV8A 2DK8A 2QENA 2UXXA 2M30A 2GXBA 2V1UA 1FWZA 4P5OA 5IT9K 3F8FA 1YIOA 4P9UA 3GWZA 1G3SA 3IU9A 1XNZA 5K5RA 2CWEA 2HQNA 2P5KA 3KP3A 5ILSA 4M6YA 4O3MA 4MQ9F 4RGSA 3L00A 4WX9A 4HX8A 1YW7A 1N51A 4LK0F 4A0YA 3F8NA 1XDSA 3E97A 3V7CA 2J5OA 2KJCA 1F4KA 2EVOA 1QZYA 1KQ8A 1SD6A 4KICA 2YX7A 1ZGAA 4M9XA 5FB2A 4CHUA 4OIRF 4Y15A 4KNYA 1FOKA 1ONVA 1W7PD 4UVAA 2LNBA 4JQFA 1YO5C 4BAYA 5LHGA 1KU3A 1L3LA 1ZG5A 4L9NA 2KIFA 3VODA 5LHHA 1ZYRF 3MEXA 1ULYA 2HS5A 1EV7A 4R79A 4K2EA 5JFRA 2VXZA 3D5LA 1LDDA 1LNWA 1SMTA 2OBPA 1BC8C 4Q5SF 3I5UA 2HWVA 4GYGA 3MZYA 1P4WA 4QR8A 2XVCA 3EUHA 1P6RA 4MGRA 3NEUA 3CLOA 1OYWA 4EMSA 1RIOH 2XIGA 2OD5A 2B3KA 5D5XB 2D1HA 3JTGA 2VE8A 3V8LA 1S3JA 5D4RA 4EGEA 2PN6A 4CO8A 2JPBA 5ERIA 5LGTA 2FOKA 3FF5A 3FXUA 5BPDA 3KLOA 3T8RA 5HVQC 2NQ6A 5D6EA 4YG2F 5FFXA 2L02A 3ZP5A 3U9GA 2M1BA 4IF4A 5F64A 1LEAA 2LF8A 3VFZA 1ZH5A 3LWFA 1HW1A 1T2KA 1HKQA 3PFIA 2QUFA 4D0PA 1IRGA 4FO8A 4M9ZA 4IF7A 4HYEA 4U0YA 3V7RA 1P4XA 4YFNF 4B8XA 1LEBA 2ACJA 4L5JA 1WN1A 4S04A 3HRSA 2MLGA 2HTJA 3DF8A 1YS7A 5CNXA 1QBJA 3E3VA 3MR1A 4LLNA 4OOIA 3K2ZA 3E6MA 2H94A 5LHIA 5FFZA 4XLNF 1ZN2A 2VOOA 3ZMSA 1W5SA 1DP7P 1W4MA 4OIPF 1FYMA 1QXWA 1S7AA 3I59B 1IXCA 5LBQA 4EQQA 5HS7A 4ZYGA 1SD4A 4P55A 3EDPA 3F8BA 4KN7X 2M5WA 3TOAA 4JK1X 3KP6A 2EJRA 4YIIA 2YX4A 3SZTA 2GZWA 5AIPA 1QXZA 4EJOA 4AIHA 1TW2A 1W7PB 1D8JA 2PQ8A 3S2WA 3ISPA 1K7AA 3D0SA 2OKNA 3KEQA 2IA2A 3IL2A 1J7KA 2GXGA 2EFQA 3LFKA 3WTWC 4HOBA 1Z6RA 3R61A 2PI0A 4BQAA 1U5TC 1WBQA 4U6ZA 3F21A 2EFNA 2A6EF 1WL9A 2BWXA 2ZKZA 2HKXA 2V3ZA 3QU6A 2GG2A 2EA2A 5L3DA 1U8RA
chains in the Genus database with same CATH superfamily
3REOA 5B1AH 1NHAA 3U1KA 1ZARA 3OYEA 2M4KA 4JBAA 1TL8A 4FLIA 1QZEA 1J5YA 1IW7F 3CUQB 5FLMJ 4NHJA 4AD9A 2EPFA 3OL3A 2AQEA 1WJBA 2M8EA 1YE9A 3ECHA 1JKOC 1WI9A 5DV5A 3T1BA 3OYJA 2OZ6A 2QVOA 2Z99A 2CQQA 2XGXA 3JRGA 2BYVE 2D5VA 2FU4A 3IUOA 2KRHA 2RDPA 1P2FA 2DA5A 2XC7A 3SEZA 3T5XA 2V4JC 4I09A 5LGNA 4HLYA 3ZPLA 1Y1NA 3IU8A 4I7HA 3FDYA 4N4OB 4PZJA 2JQ7A 1JJ6C 3CMYA 3GFIA 4JP0A 3VYUB 2ZMEA 3NQOA 5D5VB 2YPRA 4PV4A 2X51A 2DDBA 2XAGA 2ZXIA 4HDVA 2VC0A 1PV9A 2F4OB 1SD5A 3CCJI 2BH3A 2HI3A 3RDIA 2M7BA 2VT2A 3ZQIA 4NBQA 3CMMA 2BB7A 2R7FA 3BR0A 1A6IA 4IOAF 4CYCA 2KPMA 2ZFWA 3CQZJ 3HSEA 4W1UA 3IWZA 2OF7A 4U73A 2VQLA 2X1CA 1UFMA 2DT6A 4HX4A 4RAZA 4ZZDA 3VYTB 5BS6A 5HS9A 2WTEA 5JR3A 3ZQGA 1SD7A 2VJ5A 2FQ4A 1KZHA 4EVIA 1UHWA 2VQGA 3ABTA 3D5SC 1RRJA 4B47A 2IS2A 2IP2A 2DODA 1WJAA 5CVRA 3HOZJ 2X4HA 3W6KB 1W5TA 3SDGA 3S32A 2GBYA 4V2GA 1S5LC 1T39A 3K4KA 4NC8A 4ZYEA 3ERED 3C2GA 3FX3A 3QYEA 3HG9A 4U87A 1O3QA 3FK6A 2VN2A 3GMEA 4XRFA 2ZJ2A 4IKFA 4M3FA 3IV5A 3G71I 1Y1VJ 4OMYA 3K4CA 3K69A 3BR1A 3L2QA 5LFAA 2MD5A 1X2MA 5ICGA 1Y0NA 2VB6A 3CC2I 3AG2H 1VQMI 1XX5A 3BPXA 3LQQA 1BBYA 2YU3A 4BGDA 3H0DA 3HOWJ 3JSOA 2B3LA 3CO6C 1BOAA 4HG2A 2P5VA 2W4SA 2R7SA 2N8GA 3IP4B 2G6PA 2CQKA 2V9KA 4X6AJ 2WV1A 3LSMA 1B9MA 5FO5A 4GXOA 2R5ZA 2KRFA 2ZXWH 2ADUA 5DD4A 3FM5A 4BU2A 1FX7A 2QQBA 4ASNA 4XNFA 4A3MJ 4A3BJ 1FTZA 4BE1A 1SAXA 3BCBA 1WHUA 1G3WA 4I0AA 1ON1A 1YVMA 2DMUA 2ISYA 4C3JJ 1KQ9A 5L3EA 2R5YA 2RAEA 2KP6A 1MSFC 1ETXA 2GXAA 5J40A 2H09A 3I4PA 2A6HF 5CJ9A 3GZNB 4A3FJ 3ZGKA 1FEXA 2JT1A 3M8EA 2L3DA 2V1XA 2C6YA 4RGRA 4Y13A 3LSHA 4WXHA 2BY1A 2OZUA 1I3QJ 2K5CA 3Q3SA 4A6VA 1MATA 1O3RA 1M35A 3OOUA 5E3MA 4XM3A 2R4GA 4S05A 1OCPA 3CF5F 1VTNC 2GG7A 1W1WE 4UUSB 5FCFA 1MMAA 2ESHA 2MA3A 3TO7A 2HPIA 2STTA 3DV8A 2P6SA 3TL4X 5TISC 2HZTA 5EF6A 1MBEA 1BR2A 3LSJA 2VE9A 4YIFA 3LSPA 2LSOA 1OKRA 1YJNI 4GDFA 1YJWI 1VI0A 4BY7J 3DPTA 3ZRGA 3OYBA 2DTRA 4A3EJ 3FXKA 4IKSA 1YHQI 1RZ4A 2XF5A 3F0CA 4U70A 3HRUA 4FE7A 3JCUC 2WC2A 3C1DA 1MMDA 3K4BA 3CP2A 2DW4A 3MATA 1U5TA 1XD7A 2PMUA 1R22A 4BJTA 2IS4A 2E7XA 1O0XA 3GW2A 3QPHA 5LEJA 1JXSA 2DT5A 5FKNA 2IGKA 5LLQA 1P4AA 3MKLA 4XRSA 1R4MB 2DN0A 1B1BA 4MO7A 3MMYB 1ZGJA 4LMYA 3O6BB 2K86A 4DYRA 4ZJZA 4LG0B 3SXYA 4MQVA 1FJLA 4M3GA 2XASA 1DDNA 4IZZA 4CCNA 2HNHA 1I1GA 3BTCA 3GLLA 1YTYA 1B6AA 1ZG1A 4PFPA 2LY9A 3QP6A 2CW0F 1ZR2A 5HODA 2VJIA 3F72A 1HBXG 4IECA 3VOEA 5DYMA 2L4AA 2QSHX 1YITI 2DMQA 3GVAA 4A3IJ 4OOKA 4HQEA 1GLNA 2VXDA 2W1OA 3FISA 3HYIA 3KYLA 5HLHA 3FMRA 3BZ6A 3QPLA 5GPCA 2YR2A 2FBKA 1R1VA 1N77A 3ONQA 1AKHA 3LMMA 1H9GA 3FZVA 1KA8A 2DO7A 3OIPA 5HDKA 2Z3YA 3PUBA 3AAFA 4A0XA 2DQRA 2KIMA 3BY6A 1BW6A 1JGGA 3KFWX 4ENJA 1I39A 1PUFB 1TNTA 5K5OA 2MLKA 3LSIA 3MX6A 3PSIA 5KAFC 4ZYAA 5K7ZA 4WWCA 2D45A 1BI2A 2A07F 1X58A 5CVVA 5FD5A 4BQOA 1JT0A 1RUNA 4IKTA 3E6DA 1QXYA 5ICFA 2ECCA 1UHMA 4EJTA 5GPAA 1Z3XA 3EYIA 2O03A 1S72I 2FRHA 1D1AA 2QQ8A 3CCUI 1C27A 1FNNA 4HW0A 2GG0A 3L7GA 3OS0A 3G2BA 2OUMA 1HKSA 4IRGA 1T98A 1BJZA 2OU2A 3H92A 3KIOA 1RC9A 4Z2YA 5D6FA 2LD5A 4KJZA 1OFCX 2VL8A 1O7LA 1EA3A 1SEUA 4M3EA 2VT3A 3G3ZA 3PO2J 3BROA 3H1CA 5JLWA 3RYPA 2G0EA 3HGYA 4UUVA 3WG7H 2RQPA 5JHFA 1FY7A 5CDLA 2YSRA 4EM1A 2NYXA 3WGGA 5CLSA 4RB3C 1XGMA 5E79C 5J4VA 1YG2A 2XAJA 3F22A 3S1NJ 2GG3A 5A2QZ 5FRNA 1MMGA 1G3TA 4KN4X 2EA4A 2X6YA 2DQLA 3QAHA 4F92B 3K70C 2WY7Q 3I64A 2CUZA 1L0OC 2CS3A 1XG1A 2OC6A 2DPDA 1XCVA 1WJDA 1HKTA 3WTZA 2X9DA 1BC7C 3GTJJ 2M45A 3TGNA 2EFPA 1KU9A 3HHHA 1EH6A 1Y8QB 3UNGC 5GTHC 1R1UA 1O4XA 3HGGA 4HEA2 3TO9A 2BWSA 4N9HA 2M3AA 2DLLA 1IV6A 1TWFJ 3ASOH 2Q93A 1U3EM 3FBIB 4FT8A 3T0YA 3AL0C 1NTCA 1IDZA 4IKUA 2K85A 2VQCA 2ME6A 4XOTA 5DD8A 3RPQA 3N97A 1H89C 1PDNC 4KFCA 2PG4A 5ILVA 4U69A 4BS9A 3HPHA 2VBWA 3BTLA 2GG8A 3VPRA 3WE2A 3G73A 1XTAA 4PJ0C 2X1EA 4ZTFA 5D4SA 1E2XA 5ICEA 2Y48A 3R60A 1R9TJ 4CXFA 2Y0SN 2BE5F 3RIRA 2WADA 1SVLA 4RGUA 3BWGA 5CYVA 4XKWA 3SQNA 2M2EA 3WHCA 1W36D 5GADJ 4DIQA 1JI8A 5GAHJ 1USTA 6PAXA 5ED4A 2B9SA 4BNCA 4I98B 1W0UA 3B02A 3ZN0A 2H6CA 3G1LA 2QWWA 1Z21A 2EK5A 4PJNA 4LLLA 4UB8C 1STZA 5HLIA 4CA0A 2IVMA 1EH7A 1JTYA 2HDWA 2QBYB 5EZGA 1N25A 3F8MA 4GO1A 3DLAA 3K1NA 1Q1VA 4KMFA 1MNMC 3HB9A 2E5ZA 4NC6A 4KYWA 3G6EI 2ETHA 2V79A 1IUYA 3DU6A 2OA4A 1IN7A 1QHHD 1W36C 4UXNA 4M71A 4EV0A 2Y31A 2FF4A 1VQ8I 2GGBA 2BWUA 3IG4A 4N0BA 1RR8C 4BEHA 2JJ7A 2B63J 1BIBA 3ESWB 3TP3A 3ELKA 4R1HA 2HR3A 1HOMA 1D0XA 3PM1A 3QOPA 1JGSA 5B1BH 1PP8F 2GU6A 2E1NA 4FTHA 3MKYB 2E60A 2L54A 3K4MA 1MBFA 1TQPA 3UR3C 4H4KC 3WG9A 2RC4A 5C4XJ 1ETOA 2TDXA 3I3LA 4L0ZB 3OS2A 4XN3A 1OMIA 4HX7A 4A6DA 4AM3A 2BN7A 1MH3A 1TWHJ 1SVOA 3L1PA 1S7EA 3WU0A 2ELKA 4P9FA 1BM9A 3I0TA 3J7ZI 1IUFA 1PUEE 3HHGA 3HZJA 5M3MJ 1V5GA 4B1RA 1R4NB 1ZHFA 3WGHA 1V3FA 1IZ1A 4OU0A 2X0LA 4FLLA 2K4BA 2QGUA 2VBZA 1Y0UA 3CUQC 3HKZN 1WRJA 5K5QA 2L0KA 3GCMA 3J7AY 3P9KA 4L9TA 2VJ4A 1SFOJ 2JRTA 3F8CA 1LPQA 2HTSA 2IJLA 1S6LA 1LFUP 5FRMA 5D5WB 2ZNYA 1R58A 1JE8A 1X1BA 2BWVA 1IJWC 4W97A 2QKMB 5FKLA 5CDVA 2XAFA 3D1NI 2CUFA 3WTUC 5H20A 5F0HA 3I55I 4RGXA 2ZC2A 4G7HF 1V55H 2IBDA 1XN7A 1O57A 2NAZA 3ABUA 1SAUA 3DXJF 4M6VA 2MG4A 3BLYA 2Z2SB 2LFBA 5H2FC 3J80Z 1W0TA 2BGCA 3MWMA 1WJ5A 1QZZA 4BJ6C 1BI1A 2CV2A 2KKOA 3L9FA 3S14J 3VYRB 2JA2A 2Q2EB 1HXDA 3H35A 3NAUA 4GYIA 2M0CA 5HDGA 5C3EJ 4L18B 2G7HA 3AFHA 1Z1DA 1UZCA 2HU9A 1PJRA 5B66C 3HTUA 3IHUA 2QLZA 4XONA 2MYSA 2P6TA 4B28A 2DA3A 3H9QA 3DEUA 3BTIA 2M4GA 3GTKJ 2WB1N 2LP0A 1IC8A 2HQ5A 3ULQB 2V6EA 3J7YJ 3CZ6A 1YYVA 4RB2C 4JX5A 3CMAI 3HJEA 1Z05A 2ID3A 2WAQN 4UB6C 3PKCA 1UMQA 2PEXA 2JUGA 4BKXA 1HSJA 2O3FA 4MIMA 4IRIA 4IXAA 2PMZA 3AL0B 5EG0A 2VONA 3TDUC 4V2FA 3IKTA 3GZ6A 1XCBA 3V42A 5BPIA 3H5NA 4RZYA 4HSRA 3VEPA 2F5DA 2GTXA 2JSCA 1A04A 3S2DJ 1T95A 4XIDA 3IH2A 4M3DA 2BVLA 3WU1B 2JA5J 3FWEA 3H3UA 1G8XA 3ML6A 1ZRFA 4IHSA 3RJPA 4PGHA 4JYKA 1Z7UA 2DPUA 1BI3A 3K1PA 4GFBA 5H6RA 5L3CA 3QOEA 5J1YA 2GU7A 2ECBA 2GWRA 2CYYA 2X6OA 3KP5A 3HOYJ 3PSFA 2QZ8A 1VQOI 3BR5A 2RV8A 3H9GA 1U6GA 3GZ5A 1SANA 1J59A 3J81Z 3NWSA 2K40A 4PUSA 5J8FA 1WLRA 4HQMA 4I76A 1QVUA 3I9V2 3HM5A 4XSZF 3TMOA 3JREA 2BY3A 4UNOA 1V4RA 2LY1A 3RKYA 5E8IA 4ENKA 1FTTA 2KZVA 5HS8A 1LVKA 2VOPA 2FNPA 4HZFA 3ECOA 4A3JJ 2F5EA 4LK1F 3GLXA 4ZZLA 4IX7A 1GVJA 2WA0A 2FMLA 1OPCA 1OYIA 3I59A 5LEKA 1R5GA 3RZDJ 5DCMB 4CYDA 1PP7U 2IPQX 1C21A 4YELA 3LAPA 4ESJA 2IA1A 4LIVA 4S01A 1J0RA 2LG4A 1Z6TA 2HYGD 2DT7B 2HOSA 5E20A 1WKMA 3CP8A 4I6ZA 4IDYA 5HLGA 2JA8J 1FC3A 2UZKA 1U0JA 1B9NA 5E3LA 2PFBA 3C18A 4FCYA 2XAHA 1HQCA 2Q8KA 2HVRA 1USSA 3HRMA 3K1MA 2EIJH 2FBHA 4BQQA 1W7PA 4D7MA 2QEXI 4HA8A 3BG9A 5GP9A 5F0CA 4NQWB 1XGNA 1ETQA 3OSFA 2XRNA 1MJ9A 1LUJB 2F4MB 3F6VA 5C4JJ 2Y30A 4A0ZA 1YRNA 1TNSA 3C7JA 4UHTA 5FCHA 4DNCA 3HIFA 2ZO4A 4A3CJ 1ACIA 3WTXC 3E0JB 5J8CA 3QP5A 2W24A 2IT0A 3GUDA 1JT6A 2MH9A 3K0LA 1FYKA 3CTZA 5E8GA 1MNEA 4FLKA 4DOZA 1XMAA 2LBFA 3GO5A 3PKBA 4CCJA 3BPVA 5IP9J 2XKOA 3FHZA 1CF7B 2CQ7A 4QWQA 2K3FA 4AIKA 1ZRCA 5E17F 1APLC 2ZSHB 3K7AJ 4L9JA 3Q9VA 3ZCOA 3RQIA 4CICA 2Z5UA 2W84A 1SMYF 4BUPA 4E7JA 1OCCH 2IS6A 2BWWA 4HAMA 2ZBKA 1LFBA 2E5NA 4M9SA 4U7DA 4E7KA 1JJ8C 1XSVA 3AG4H 3FXOA 3KZYA 3M8FA 3M9AA 4N9IA 4A3LJ 2GU5A 1FSHA 1R00A 1ZLJA 4LJZF 1I5ZA 3CUQA 1JUSA 2AS5F 2KMUA 3E5XA 1RNLA 4MFEA 2JRMA 1UHSA 2HEOA 4WF2A 2RNGA 2DAOA 1K6YA 4MEYF 4UY8I 1FOYA 1FP1D 4BE2A 4OMZA 1Q1HA 3QYFA 2QKLB 1SFKA 3JRAA 1YIJI 3I54A 2FJ1A 2ZNZA 3IH4A 1K6OA 1Y56A 2UV1A 2BHBA 1DPRA 4I99C 4BBSJ 3E5UA 3PQJA 1TP4A 1ETYA 4ZYDA 1IN6A 2H8WA 2L2OA 2P81A 2X6WA 4Y7NJ 2NS8A 3CLQA 4MLOA 2DFHA 2XPUA 2HPMA 4MATA 2BW3B 2LY2A 3JAMZ 2LLKA 2WAFA 4HPQA 5AONA 5F08A 5A2QK 1B8IB 1BL0A 3F23A 3DBRB 3FXLA 5M5YJ 3S3OA 5FLVA 1F1ZA 5EEAA 1FLIA 1C24A 4AYBA 4EGYA 1S29A 1I1SA 4G6DA 4EM0B 3BZKA 2LKXA 2E2IJ 1R49A 3FKIJ 4BYYA 3GFLA 4CCLA 2GG5A 2E2HJ 4B44A 3TKYA 4E70A 2ZJQF 2VASA 4C30A 2NVQJ 4RB0A 2RGVA 2MW8A 3SYTA 3V4GA 2IW5A 1VFCA 5DEQA 3S1RJ 4MNUA 3WHBA 4LFUA 1ETWA 4FASD 2DJNA 1UB9A 2HOAA 4G12A 2O0YA 3E6BA 4EEFG 5JLXA 3S3MA 3OYGA 4OIQF 4IU6A 1RKTA 4DJAA 4BY1J 3M7GA 1TWCJ 2L5QA 4A93J 3S8PA 1SVMA 1Z0XA 2NOGA 1LE8B 4O5VA 1XB4A 4RAGA 1W2MA 4XBFA 4DYCA 2BHAA 4D7NA 5L3GA 4U88A 5CE6A 1S9HA 1Y1WJ 3GX4X 3R0AA 2KZGA 2MABA 3DEEA 2CFXA 2XSDC 3BOQA 1RPWA 3PNYA 4I01A 4A69C 4HF2A 2XROA 4UVBA 1A36A 1X19A 1SFEA 5GAEJ 4EGZA 1HF0A 1BIAA 2HGCA 5IOZA 3CD6I 4P1WA 3S16J 1S8NA 3GTOJ 2FUG2 5KHDA 3R6SA 3CO7C 4P96A 4II2A 1XPXA 2NXNB 2P98A 4ESBA 2B0LA 3F6OA 2E7WA 3VDXA 5F04A 2QQAA 1A35A 2LKPA 2DYSH 3CCVI 2GZ5A 4RZZA 3JRBA 1IRFA 2F48A 3H3ZA 5FD6A 1JHHA 3QPTA 2BEOA 3CUOA 2Z33A 2MC4A 4KMUX 1MBGA 3C2BA 3ZMDA 3OS1A 3KZZA 1KU7A 4E7LA 1H9TA 2ZFUA 4E7SA 2GA1A 1E17A 3TO6A 2STWA 1FMWA 3B6AA 4BXXJ 3FM3A 2GM4A 1FPQA 3DKWA 2Z9OA 2B7EA 2DMPA 3L09A 2O7OA 2K9QA 4LD5A 5KAIC 4FLJA 2CMPA 5KVRA 1VNDA 3P9IA 4FHTA 5FGMA 3ZMTA 1WL6A 4M73A 1BI0A 5CPRB 1DPUA 2G9WA 4QPQA 3PNTA 4ZNGA 4KITB 4NB5A 4BE0A 3OR2C 4CCKA 3QU3A 4UUSA 2Q94A 5F6FA 1MW7A 3OYIA 2JMWA 3W2AA 4RLFA 4U6EA 3BR2A 1QPIA 4IQ4A 2L7FP 2ISZA 4HF1A 3GF2A 1EJ9A 3HPGA 4GCVA 1J9IA 1A16A 2QA4I 5JVTA 3MZ8A 1SFUA 5CDEA 1YS6A 2M8GX 3H5AA 2VKHA 2XUBA 4FETA 2MC3A 4IOCF 4B3AA 4UVCA 5EGOB 2JA7J 2CQNA 3B73A 5CVUA 4NUBA 2E35A 2R7DA 2LMDA 3M1CA 4L5IA 4F7ZA 3WGIA 3E1SA 4U6WA 3PKDA 5EDNA 1FMVA 4FQGA 2EV5A 2EZLA 3MQ0A 2F2EA 4C2UA 2L4MA 4Y4RA 4UV9A 4XOPA 2JVGA 4Q47A 4PJMA 4EM2A 1OCTC 2PX9A 1X1DA 5ICCA 5M3FJ 1Z91A 3ABKH 1I6HJ 2H6BA 3H36A 4XMYA 4LG0A 1Z3YA 3FXQA 3M3YJ 4BBRJ 1S7OA 2CSOA 2HYJA 1T6SA 5K7HA 4ZC3A 3M4OJ 2Q0OA 3TDZC 4IJAA 5ILUA 1GUUA 3BDDA 4ZYHA 3DTEA 3CB5A 4OAYA 2LOOA 2VQHA 1KU2A 3T8TA 3J80K 2XAQA 2XAUA 1K78B 3GTMJ 4U76A 1UCRA 1MBHA 3EYYA 1DUXC 2P7CB 2FQ3A 1LQ1A 3CTAA 3TOBA 3M1EA 1Z7LA 1CGPA 2TRTA 1C23A 2EILH 2K9SA 1CHMA 3OYNA 1FBUA 1FT9A 2R7OA 1KGSA 4DBRA 1WWXA 3KP7A 2BHCA 4Y33A 3K9TA 5CQGA 1T38A 3HUGB 3OOPA 3S6BA 4G6QA 2R7UA 4BACA 3RTRA 5CVJA 3W2WA 2DOEA 2W25A 4RS8A 1PUFA 2BHZA 1RESA 2A68F 4CDGA 3G4SI 2K7LA 4DQ2A 5BOXA 3WTVC 4HDUA 4CZCA 4XR6A 3CCQI 3O2PE 5IP6A 1F9NA 1T0FC 1KYZA 3BP8A 3HEFA 3L7WA 4S00A 4KT5C 3ZMUA 3LNQA 3RPUD 4JX4A 1TLHB 3X2QH 3GYHX 2L9RA 3JR9A 1Y8RB 2JN6A 1OYYA 1O3SA 4HNVA 1OCZH 1WSUA 2R7VA 2CG4A 3K6GA 2ELHA 4PDKA 1TT0A 4U7BA 4U75A 2M9HA 4X1EA 4NNJA 4IO9F 4MTEA 3J81K 3RVAA 3ZQHA 1YLFA 4CCOA 1TBXA 1T8IA 2A5WA 2Y2ZA 5J6XA 2EWNA 3COAC 4Y52J 5DS9A 2Y9ZA 3HXLA 4R8HA 1R7JA 3IAM2 3HOSA 2CU7A 3A4CA 3JRFA 4L0YB 5B5EC 3ZQ7A 2BVMA 5BMZA 1G59A 2HXIA 4TV7A 3HDDA 3C3WA 2IW2A 3OYMA 4ZDLA 2CH0A 1H88C 4RA2A 2BWYA 2EVCA 3A0HC 4U6JA 3RORA 4V19K 4ITVA 1FSEA 2JPCA 3ZR8X 3L2WA 3RKXA 1WJFA 4AU7A 1D3YA 4RB1A 2EZKA 1H8AC 9ANTA 2BOLA 1R5HA 4G7ZF 2EV0A 2VJJA 2GU4A 2BBYA 1ORKA 2XSJC 4LB6B 2CW8A 3KE2A 3W6VA 2L9SA 3L2CA 3CJNA 1ZK8A 4AVZA 4CGZA 2K3PA 1X4OA 4RAFA 1RR7A 1KONA 5B3SH 2ESNA 1KYWA 4WK8F 3OYAA 1QA6A 1K83J 4Z6YA 4IHXA 2BWTA 3KEYA 1MJBA 4XK4A 3BT9A 2IGMA 4IL6C 1B72B 3PIPF 5CVIA 1IDYA 2HOEA 5K1YA 1K61A 1FOXA 3LA7A 2K27A 1BJAA 4GRIA 1BA5A 5AIQA 2MSYA 4HSTA 3DPLC 3I4MJ 3MFKA 1Z67A 3FK7A 3ZQLA 2YU9J 2I10A 1VZ0A 3DP7A 1BN5A 4B48A 4U71A 4FE4A 2P8TA 1ZKGA 1YQAA 3GTLJ 1YX5A 3QYBA 2HOWA 2XPWA 3KZIC 4BHCA 1HLVA 2LTPA 1LDKB 4KIFA 3S15J 5LRSA 2K4JA 2M7AA 2W85A 4R60A 3W3CA 2KISA 1ZREA 1JTXA 3IAS2 4M6XA 2V1NA 2RREA 3S1MJ 2PJPA 2J5PA 2VPRA 2E71A 2HQRA 1ZTRA 2P99A 1G6NA 1EKEA 4M72A 5DUKA 3RI4A 4AUXA 1MDMB 4S2TP 2D2WA 1TWAJ 4DZJA 4NDLA 2QBYA 2VC1A 3L2RA 2L7ZA 2Z16A 5J47A 3EPZA 2ZXHA 4LLGF 2NRAC 3FHNA 3S93A 1K79A 1FZPB 4A6WA 1DGWY 2B3HA 2E19A 3G1OA 3LAJA 2ZJRF 1Z9CA 4KA4A 2VBXA 5FKKA 3IWFA 4A5NA 2CUEA 5J1UA 3K4LA 4XKBA 3CC7I 4IRHA 2XF6A 1NK2P 2HDDA 2FBIA 3M07A 1XDUA 2AHQA 3ZQCA 4U0WA 3JAMK 1MDMA 2L7KA 2RN7A 5L3BA 5CIKA 4ENNA 3QQAA 4I02A 2F4IA 4N4NB 3I58A 4XRSG 3Q5FA 1LB2A 2R92J 4OINF 4D5FA 5LD2C 2H1KA 2P5LC 3WTSC 1WQ2A 2Q92A 3SFZA 2IA0A 1IXSB 1MGTA 3CJTB 1GXQA 5FJ8J 1U8BA 3KP2A 2PJRB 1UG2A 5E3OA 2PMHA 3EETA 1BR1A 1M1EB 3BG7A 1IN4A 4HNUA 1QHGA 2ZMEC 2GOMA 3E7LA 3HC7A 2CO5A 4WXDA 3ROUA 4PNCA 2P9AA 2EV6A 3H0GJ 1MZBA 4ZDPA 4L5EA 2UWMA 5JI6A 3DCFA 4WCGA 2A5YB 1XMXA 4PGGA 2XKPA 2H1LA 3QODA 2E34A 1X1PA 3HRTA 4KDPA 2W57A 2O8XA 1IN8A 4XICA 3I71A 1ON2A 1WJCA 5F1JA 2O8KA 2FEZA 3OSGA 2VBYA 1O3TA 4U6CA 1T0FA 5M5WJ 1AOYA 5F27A 1W5CC 2NNYA 4LG3A 3ZQQA 1IRZA 3OY9A 3BG5A 5HNFA 2DA4A 4PFOA 1IF1A 1VQ5I 2WV0A 5LGUA 2NQ7A 1T08B 5CQEA 1I27A 2ZXJA 3HOTA 1HSTA 3A0BC 3Q6DA 2A69F 1I50J 2E1MB 1BOBA 1GXPA 3S1QJ 4Q4ZF 1WH7A 3N05A 4XLPF 3AKZA 2R7ZJ 3MVPA 4I0BA 3V7SA 2BXZA 3I56I 4RM3A 2DFIA 5FLXZ 4ZWUA 2WAQA 2Q2EA 2K02A 2CRGA 1B4AA 1KQ0A 2RVCA 4BH9A 1G4DA 4Z7MA 2IRFG 4G7OF 1RKWA 2A3SA 1OJLA 3BZCA 2QQ9A 1QRYA 4G6TB 5HNHA 3L2VA 4ZTJA 5E5BA 2PMZN 1WJEA 3RPUA 3BG3A 4U0VA 4XLEA 3A01B 3IKVA 2OTJI 2VKDA 1OR7C 1MD0A 2ZB9A 3DPUA 4A3DJ 2F5CA 2DA7A 2OAZA 3KEOA 2KT0A 4E4HA 4ON0A 3OR1C 4FISA 4II3A 3CB6A 4RAYA 3F3XA 4WXCA 2CUJA 4AIDA 1Y39A 3IH3A 1JAWA 2FOWA 1J75A 4FO7A 3BIPA 3LFUA 4QLCU 4ZDOA 4AC0A 5HOOA 4C2TA 3NWTA 3JRCA 1IG7A 4ZWPA 3MD2A 3TB5A 2IGOA 1FBQA 1OCOH 2EZIA 3OV8A 3JTHA 4AIJA 1LJ9A 2EINH 3OYKA 2MH2A 3ZN1A 4XSXF 2EVMA 2XGDA 2OCEA 2CGPA 2Q95A 2D1VA 4BXFA 3A1YA 2OQGA 3CJRB 1D1CA 3KCCA 1T56A 2HKOA 2X1DA 3E6CC 1FP2A 2L9NA 2R7QA 4A6EA 1ITYA 2WWYA 2P4WA 3PQKA 1ZRDA 2GA2A 3FBNB 3BITA 3RKWA 2DFFA 5IT9Z 1RETA 5TGTA 5IP7J 1K4SA 4U1BA 1MBKA 4A5MA 1UAAA 1HC8A 1JUPA 1HDDC 3A2KA 5E1XA 3IRRA 2V1DA 3FMSA 2NOJB 3KLNA 3R4KA 3P9CA 5DCMA 1W7VA 2IXSA 3JW4A 2V3YA 3U1DA 2H27A 2GQQA 3HSFA 3V8JA 1H0MA 1N75A 2DBBA 2GIZA 4RM2A 4A3GJ 2X48A 3LSTA 2X85A 3K10A 1AHDP 5L3FA 3TAVA 4JOMA 3DQVC 2ZSGA 2Y69H 5LRRA 3TQNA 3MAJA 4LIUA 5J1RA 4QTRA 3U21A 2Q1ZB 3JRIA 1P92A 2G7UA 5JHUA 4D1QA 2CV1A 2PLYA 3HTSB 2AXLA 2XV4S 1ETKA 2KIQA 1ZQ3P 1E3HA 1FBSA 1OISA 3W6JB 1NG7A 1ZG3A 4YEJA 4A2UA 4RDUA 3RZOJ 2JSPA 4XRMA 4ZH4F 3RQ4A 2MGQA 4NQWA 4S2RP 2KDZA 5IYCJ 4B43A 1WFXA 2FNAA 2JK3A 3IRQA 2NNNA 5DUIA 2COMA 1T33A 1TTYA 4YRVA 4I2OA 2ZMEB 4X0GA 2WBMA 3MCZA 3U2RA 3PUFA 3LQRA 1QQIA 2IGNA 2LDUA 3EUKL 1C22A 1JKPC 5IOYA 1R23A 1RI7A 2Y0MA 3RYRA 2VUMJ 2A05A 5F1RA 2M0MA 1AA7A 2M87A 4CYCB 1C0WA 4KISA 3LSRA 4HRIA 3CCLI 3DKXA 3GTPJ 5KNLA 1WGXA 3ZQFA 4MTDA 3S2HJ 1CF7A 2Y75A 4ETSA 2UXNA 4E7HA 3O8GA 1I6XA 2KHMA 2GGCA 2MFZA 5DDGA 2FE3A 3ERMA 4BHPA 1VQNI 3ZMVA 2KJBA 4IPAA 2LVSA 2R93J 3GTQJ 4PJJA 3LA2A 4JUQA 2RQQA 2NVYJ 4Q48A 2E1OA 2FA5A 2QM3A 1J2XA 4YFKF 2VKEA 3DFGA 1ZGWA 4HXXA 2K9MA 2MBFA 2PBIA 2UUZA 3MKWB 4M3BA 3OYCA 2X6XA 5H6QA 3VSKA 3ZMZA 4PCQA 2OPTA 2XDVA 4ENMA 1R5ID 1X1CA 2O6GE 4HF0A 2JUCA 4AYBN 2DOAA 4EJUA 4LB5A 1ERDA 4BL0B 2BW3A 3KX2A 3IC7A 3KETA 1B8IA 4E7IA 2E1CA 4PSXA 5BNGA 1EH8A 3JSPA 1A5JA 1Z77A 5FROA 3AG1H 1P7IA 2GG9A 3SFIA 2L7MP 1WY2A 4EATA 3DEWA 1YFHA 2O61A 1OLTA 2DU9A 2F5VA 4JX6A 1R71A 2DMNA 2WAEA 5E1WA 2LF7A 2BHDA 3SHFA 1IN5A 4RGZ1 2R5ZB 3BQZA 1X3ZB 5TRDA 4IHTA 1TW3A 5EEGA 3WTYC 4FX0A 3L24A 1OR7A 4EJVA 4G9YA 1E3OC 2ZCWA 3R0JA 1IXRC 2HYFA 1XSDA 2R7TA 1HW2A 1MBJA 2DK5A 2NS7A 1JUMA 3BC8A 2GIVA 3WODF 2CFOA 1XGOA 2FMYA 2R5YB 3TEDA 1SC7A 1G2HA 4QSHA 1R1TA 3DKYA 1MMNA 2RKHA 4HV6A 1LE8A 3OIQA 4KIGA 4L9VA 1HA8A 5E18F 2TCTA 4ESFA 1U78A 1JKQC 3LA3A 2HXOA 3ZOBA 3SDBA 1HW5A 4GGGA 4D5CA 1GT0C 1N78A 3BJOA 4HLXA 3FIWA 1FYLA 1KP0A 4YFXF 4MHGA 1WI3A 3HSRA 1YW8A 4XLHA 1NK3P 5D8LB 3WE3A 1U2WA 3FXRA 2FSWA 2ELJA 3WU2C 1D5VA 4IHWA 1V54H 2Y9YA 5J4YA 2O9LA 2BHYA 1DGRM 3PJRA 1BW5A 1QO0D 5D5UB 2XB0X 2JTVA 3S17J 2R7XA 2V3XA 1XC5A 2EFOA 2FD5A 5CKTA 4A12A 2M34A 3LSGA 5TJJA 2L01A 2LC2A 4H0EA 2YS9A 3AG3H 3PIOF 1U5TB 4J19A 4MEXF 3FMQA 1DU0A 4EJWA 3JRDA 2EFWA 4J00A 4C9YA 4E6KG 1QU3A 4IVNA 3N4MA 3MZHA 1LVAA 4ZWOA 3CDLA 4DZPA 5FKMA 3PKAA 3V8KA 1WCMJ 2HVSA 1WVRA 3NRVA 2R0QC 1XGSA 4XLCA 3O3KA 4AVPA 2BY0A 2YUSA 4HV5A 2DCEA 3CCYA 1D8KA 1QPMA 2VODA 2GOXB 1LDJA 3LL7A 3BIQA 1F5TA 5KK1A 1ODDA 1XSXA 3C2HA 3ZXSA 1QGPA 4C3IJ 5E1ZB 3DWLE 4S0HB 3I53A 2I8DA 2KIUA 1D0YA 4G8XA 4OIOF 4FX4A 5BQTA 2I5UA 1ZAOA 4HBLA 3D27A 3UKGA 1ENHA 2FXAA 2EH3A 2QYOA 4D9JA 5IT3A 2V9PA 3TP0A 3MKZA 2V6CA 2P7VB 1V5FA 1O7FA 3BJAA 4KM3A 1MJAA 5DTDA 1HCRA 4CCMA 2OQRA 1SFXA 2HFHA 2JWTA 1A6QA 1GDTA 4J01A 1AKHB 4IKRA 5DCFA 4O6JA 2DI3A 2A61A 2LK2A 5EGOA 3HOXJ 2V9VA 3Q0VA 4F55A 3KP4A 3CDHA 1TWGJ 1E0EA 3DTIA 5HDNA 3K2AA 1YW9A 2XF7A 4KIBA 1B59A 3A03A 4BXUA 1U9OA 2HQAA 3J7AO 3GFMA 3EUHC 2Q96A 4FKCA 1YX3A 1XMKA 1VQ9I 5EJCA 2HDCA 4C3HJ 2DFEA 2GAUA 2ZSIB 1YJ9I 4LGWA 2BV6A 3CC4I 4FUKA 2EIMH 1F36A 2F6CA 2V26A 2RNJA 1U9NA 4F93B 4B09A 2MATA 3CCRI 3E5QA 1G3YA 2EZHA 2QCOA 3BJ6A 3OYFA 2AO9A 2R3SA 1AU7A 3GXOA 3GEZA 1YOVB 3OYLA 1X3WB 2XGEA 3K4JA 5EZHA 2QF7A 4M74A 2EIKH 1X3UA 2XHKA 1JHFA 3GFJA 1P9QC 2AQFA 3L2UA 1K78A 1R36A 4KUMA 4BHBA 5FLXK 4AWXB 3ABLH 1TT5B 3RKQA 3OYDA 4XKCA 3FXJA 5EYRA 3OL4A 4G94A 1TQIA 2W48A 1E3PA 3PKEA 2KL4A 2NVUB 1LFPA 3EQLF 3BQYA 4IHYA 3HUGA 4DYQA 1MKMA 1OQYA 1QNTA 3TW7A 2JZYA 5J3LA 1TQMA 3IU7A 2DA6A 2NS0A 3SJMA 2A6TA 1IAWA 1GHCA 1REPC 2LH9A 3K70D 4CZZA 2VLAA 5D8KB 2IAIA 3VB2A 1ZLKA 1UELB 4CSWA 2CV0A 2F5FA 3GTGJ 2W82A 3CF2A 1AWCA 5IYBJ 1ETVA 4Y17A 5IY5H 3WTTC 3Q9SA 3P7NA 4F3QA 4HNTA 1UJ8A 2EB7A 5EEHA 2KDOA 1MIJA 2HVQA 3SZPA 3VSLA 3VWBA 1ZELA 4B3XA 1YJ3A 4F52A 1RUOA 3CCEI 1WZ2A 2R7RA 3QRFF 2CQXA 4UV8A 5C44J 2DK8A 4BJ5C 2E1MC 2QENA 1JKRC 1QVTA 2UXXA 3EUAA 2M30A 2GXBA 3MN2A 5M5XJ 2V1UA 1ZR4A 4XLFA 4A3KJ 4XL9A 4PJLA 1FWZA 2LKSA 4P5OA 5IT9K 2LYCA 3I4NJ 3F8FA 2ME0A 1YIOA 3FXMA 4B4CA 4P9UA 3DU5A 3GWZA 1G3SA 2LR8A 3VYSB 3IU9A 3DTKA 5K7FA 2E2JJ 1XNZA 1J09A 4CUGA 5K5RA 2CWEA 2HQNA 2P5KA 3KP3A 5ILSA 3H3VK 2VIXA 4M6YA 3SEQA 4O3MA 4MQ9F 3G1MA 5IYDJ 3PFYA 4RGSA 3L00A 3W2VA 4WX9A 2DOFA 4E7ZA 4HX8A 4MFDA 1YW7A 1N51A 4LK0F 4A0YA 3F8NA 3O8HA 2Y0SA 1XDSA 2NVXJ 3E97A 3V7CA 4PK4A 4BQNA 2OJED 4NC7A 2J5OA 2QSGX 2KJCA 2W7NA 2FX0A 1F4KA 1QZYA 2EVOA 1IV8A 3KYDB 4IQJA 2L9VA 1KQ8A 2JVHA 1SD6A 4KICA 1MNDA 2YX7A 1ZGAA 4M9XA 5FB2A 4CHUA 2K9LA 4OIRF 1VQ6I 1NG6A 5F0FA 3S3NA 2DA2A 1GVDA 4Y15A 4KNYA 3F9KA 1WPKA 1PYVA 3QWLA 1FOKA 1ONVA 1W7PD 4UVAA 2LNBA 4JQFA 2DMTA 1B72A 5GTIC 1VF9A 1VQPI 1YO5C 4BEHB 4BAYA 5LHGA 5DM7F 2P0WA 2KFDA 3OIOA 3OMYA 1KU3A 2IS1A 2VKVA 1L3LA 4OWRB 4XN0A 4L9NA 2KIFA 2COBA 3VODA 1ZG5A 1A31A 2MD0A 4QIWN 3KPHA 2DYRH 5LHHA 1ZYRF 3MEXA 1ULYA 2HS5A 1EV7A 4R79A 4K2EA 4ABZA 5JFRA 5HLTA 1D1BA 3SZGA 2JA6J 2VXZA 3D5LA 3CESA 3HOVJ 1D5YA 5FKOA 4C2MJ 1LDDA 3D5RC 1LNWA 4Y3OA 1SMTA 2OBPA 1VQ4I 1BC8C 4Q5SF 3I5UA 4XLAA 2ID6A 2HWVA 3BG6A 4GYGA 1TC3C 3MZYA 1P4WA 3PO3J 4QR8A 2OCCH 4IEJA 1Y6IA 2ZJPF 4F91B 2XVCA 3EUHA 3KYCB 2IEKA 1R6RA 1P6RA 4MGRA 3NEUA 3CLOA 5JVGF 1OYWA 2OTLI 4EMSA 1FIPA 3M8JA 1RIOH 2XIGA 2OD5A 2HZDA 2B3KA 1IGNA 5D5XB 2D1HA 3JTGA 2KRCA 1FIAA 3B6CA 1LKXA 2W00A 3Q0WA 3TW6A 4CH7A 2LRDA 2VE8A 3CDIA 3RSNA 3V8LA 1FOWA 3FKJA 3HKZA 2VPLA 1S3JA 1IRXA 5D4RA 4EGEA 3JRHA 2PN6A 4CO8A 1XS9A 4KT6A 2JPBA 3BCAA 1YI2I 5ERIA 3K4NA 5LGTA 2FOKA 3FF5A 1GV5A 1CQTA 3OWTA 3FXUA 5BPDA 3KLOA 3T8RA 5HVQC 2NQ6A 5D6EA 5KCMA 3CMEI 5GAGJ 3GBGA 4YG2F 5FFXA 2DJIA 5IPAA 2PJRA 3RCOA 2WY8Q 2L02A 3ZP5A 3OYHA 3U9GA 2M1BA 4IF4A 3DBHB 4ANJA 3A02A 5F64A 1LEAA 1BR4A 2LF8A 1X2NA 3PL8A 2E36A 3H9JA 3VFZA 1ZH5A 3CJQB 4XQFA 3LWFA 1HW1A 1T2KA 1HKQA 3PFIA 2QUFA 5EG0B 2GLOA 4D0PA 1GV2A 1V5EA 1IRGA 2WB1A 3CCSI 1K4TA 4FO8A 4M9ZA 2HOTA 1OCRH 3DBLB 4IF7A 2CJJA 4HYEA 4U0YA 3V7RA 2LREA 1P4XA 4YFNF 1HDPA 1F43A 4B8XA 1LEBA 2EBIA 2ACJA 4L5JA 3BTJA 1WN1A 4S04A 3HRSA 2MLGA 1MMSA 2HTJA 3DF8A 1YS7A 2DDAA 3HBLA 1X4PA 4RMNA 3CCMI 5CNXA 1QBJA 3E3VA 4XORA 3MR1A 2H8RA 4DBQA 4RBOA 1DU6A 2O5RA 1I3AA 4LLNA 4OOIA 1MH4A 3K2ZA 3E6MA 2XRLA 1X1AA 2H94A 4UUTA 5LHIA 5FFZA 2KLOA 2Z1DA 4XLNF 4BDZA 3BR6A 1ZN2A 2VOOA 2EQRA 3ZMSA 1W5SA 5E3NA 3LSKA 1DP7P 3A01A 1P7JA 1W4MA 2ICWG 4DW6A 2XB5A 4OIPF 1FYMA 1IO2A 2R7WA 1QXWA 1S7AA 3ABMH 3I59B 1IXCA 2DA1A 2CW7A 1EF4A 5LBQA 1UG0A 4EQQA 1MSEC 2NVTJ 5HS7A 4RLQA 4ZYGA 1SD4A 4P55A 3LOCA 2BXYA 2XGCA 2OV7A 3EDPA 3F8BA 3NARA 4KN7X 2M5WA 3TOAA 4JK1X 3KP6A 3DLLF 2QSFX 2EJRA 4YIIA 2YX4A 2AXTC 3SZTA 4YIRX 3PNVA 2GZWA 5AIPA 3BR3A 4EJOA 1QXZA 2KQRA 4AIHA 1TW2A 4LOCA 3ASNH 1NH3A 2BZTA 3Q0UA 4QPOA 1W7PB 1D8JA 2PQ8A 3S2WA 4PSWA 3ISPA 3H5RA 1D0ZA 1DQUA 2VI6A 1VQ7I 1K7AA 3D0SA 4DGWB 2OKNA 1YRNB 3KEQA 2DTZA 1VQKI 2V7FA 4BDYA 2IA2A 2BY2A 3IL2A 1J7KA 4LITA 3TBIA 2GXGA 2DXIA 2EFQA 1DP3A 1WH5A 3LFKA 3WTWC 1TZLA 4HOBA 1Z6RA 3R61A 2PI0A 4BQAA 4XKVA 1U5TC 1WBQA 4U6ZA 3F21A 2EFNA 5DM6F 2A6EF 3P5JA 1WL9A 2K9NA 2LBFB 2BWXA 1VQLI 1POGA 2ZKZA 3HOUJ 3QPSA 2HKXA 1PVEA 4OAZA 4IHVA 2V3ZA 3QU6A 2GG2A 2EA2A 5L3DA 1U8RA 3HL2A 2XPVA
chains in the Genus database with same CATH topology
3REOA 1NHAA 1ZARA 4JBAA 4FLIA 1J5YA 1IW7F 3CUQB 4NHJA 4AD9A 2M8EA 3ECHA 1WI9A 5DV5A 3T1BA 2OZ6A 2QVOA 2Z99A 2XGXA 2BYVE 2FU4A 2RDPA 1P2FA 4HLYA 3ZPLA 3T5XA 4I09A 5LGNA 3IU8A 1Y1NA 4I7HA 4PZJA 3GFIA 2ZMEA 3NQOA 5D5VB 2YPRA 4PV4A 2XAGA 4HDVA 2VC0A 1PV9A 1SD5A 2BH3A 3RDIA 2VT2A 2BB7A 2R7FA 2ZFWA 3HSEA 4U73A 3IWZA 4RAZA 1UFMA 4HX4A 4ZZDA 5BS6A 5HS9A 2WTEA 5JR3A 1SD7A 4EVIA 1UHWA 3ABTA 2IP2A 5CVRA 2X4HA 3W6KB 1W5TA 1T39A 4ZYEA 3ERED 3FX3A 1O3QA 2VN2A 4XRFA 2ZJ2A 4OMYA 3K69A 2MD5A 5ICGA 3BPXA 3LQQA 1BBYA 2YU3A 3JSOA 2B3LA 3CO6C 1BOAA 2P5VA 2G6PA 2CQKA 1B9MA 5FO5A 4GXOA 2KRFA 2ADUA 5DD4A 3FM5A 1FX7A 2QQBA 4ASNA 1SAXA 4I0AA 1G3WA 1YVMA 1ON1A 2ISYA 1KQ9A 5L3EA 2H09A 3I4PA 2A6HF 5CJ9A 2JT1A 3M8EA 2L3DA 2V1XA 2C6YA 4RGRA 4Y13A 4WXHA 2OZUA 4A6VA 1MATA 1O3RA 1M35A 4S05A 1VTNC 2GG7A 5FCFA 2ESHA 2MA3A 3TO7A 2STTA 3DV8A 2P6SA 2HZTA 2VE9A 4YIFA 2LSOA 1OKRA 3DPTA 2DTRA 4IKSA 1RZ4A 4U70A 3HRUA 2WC2A 3C1DA 3MATA 2DW4A 1U5TA 1XD7A 2PMUA 1R22A 2E7XA 1O0XA 3GW2A 3QPHA 5LEJA 1JXSA 2DT5A 5LLQA 1P4AA 1B1BA 1ZGJA 4LMYA 3O6BB 2K86A 4LG0B 3SXYA 4MQVA 2XASA 1DDNA 1I1GA 1YTYA 1B6AA 1ZG1A 3QP6A 2CW0F 1HBXG 3F72A 4IECA 3VOEA 5DYMA 2L4AA 3GVAA 4OOKA 4HQEA 3HYIA 5HLHA 3FMRA 3BZ6A 2YR2A 2FBKA 1R1VA 1H9GA 3FZVA 1KA8A 2DO7A 5HDKA 2Z3YA 3AAFA 4A0XA 2DQRA 2KIMA 3BY6A 3KFWX 4ENJA 1TNTA 5K5OA 2MLKA 3MX6A 4WWCA 2D45A 1BI2A 2A07F 5CVVA 5FD5A 1RUNA 4IKTA 3E6DA 1QXYA 5ICFA 1UHMA 4EJTA 3EYIA 2O03A 2FRHA 1C27A 1FNNA 4HW0A 2GG0A 3L7GA 1HKSA 4IRGA 1T98A 2OU2A 3H92A 4Z2YA 5D6FA 1O7LA 2VT3A 3G3ZA 3BROA 3RYPA 4UUVA 2RQPA 1FY7A 5CDLA 2YSRA 4EM1A 2NYXA 3WGGA 5CLSA 4RB3C 1XGMA 1YG2A 2XAJA 3F22A 2GG3A 5A2QZ 1G3TA 4KN4X 2EA4A 2DQLA 3QAHA 3I64A 1L0OC 2DPDA 1XCVA 1HKTA 3WTZA 1BC7C 2M45A 3TGNA 2EFPA 1KU9A 3HHHA 1EH6A 1R1UA 3TO9A 2BWSA 4N9HA 2DLLA 2Q93A 1U3EM 4FT8A 3T0YA 4IKUA 3RPQA 1PDNC 5DD8A 3N97A 4KFCA 2PG4A 5ILVA 4U69A 2VBWA 2GG8A 3WE2A 3G73A 5D4SA 1E2XA 5ICEA 2Y48A 3R60A 4CXFA 2BE5F 3RIRA 4RGUA 3BWGA 5CYVA 3SQNA 1USTA 6PAXA 5ED4A 4BNCA 4I98B 3B02A 3ZN0A 2H6CA 2QWWA 2EK5A 4LLLA 1STZA 5HLIA 2IVMA 1EH7A 2QBYB 3F8MA 4GO1A 3K1NA 4KMFA 4KYWA 2ETHA 2V79A 1IUYA 2OA4A 1IN7A 4UXNA 4M71A 4EV0A 2FF4A 2GGBA 2BWUA 3IG4A 4N0BA 1BIBA 3ELKA 4R1HA 2HR3A 2GU6A 3QOPA 1PP8F 1JGSA 2E1NA 2L54A 1TQPA 3WG9A 2RC4A 2TDXA 4L0ZB 1OMIA 4HX7A 4A6DA 2BN7A 3WU0A 4P9FA 1BM9A 3I0TA 1PUEE 3HHGA 1ZHFA 3WGHA 1V3FA 1IZ1A 4OU0A 2X0LA 4FLLA 2K4BA 2VBZA 1Y0UA 3CUQC 1WRJA 5K5QA 3P9KA 4L9TA 2JRTA 3F8CA 2HTSA 2IJLA 1S6LA 5D5WB 2ZNYA 1R58A 1JE8A 2BWVA 5CDVA 2XAFA 3WTUC 5H20A 4RGXA 4G7HF 1XN7A 1O57A 2NAZA 3ABUA 3DXJF 3J80Z 2BGCA 3MWMA 1QZZA 1BI1A 2KKOA 3L9FA 4GYIA 1HXDA 5HDGA 4L18B 2G7HA 1Z1DA 3HTUA 3IHUA 2QLZA 2P6TA 4B28A 3DEUA 3ULQB 4RB2C 1YYVA 1Z05A 3PKCA 2PEXA 1HSJA 2O3FA 4IRIA 4IXAA 2VONA 3TDUC 3IKTA 3GZ6A 1XCBA 5BPIA 4RZYA 3VEPA 2F5DA 2GTXA 2JSCA 1A04A 3WU1B 3FWEA 3H3UA 3ML6A 1ZRFA 4IHSA 3RJPA 4PGHA 1Z7UA 2DPUA 1BI3A 3K1PA 5H6RA 5L3CA 2GU7A 2GWRA 2CYYA 3KP5A 2QZ8A 2RV8A 1U6GA 3GZ5A 1J59A 3J81Z 5J8FA 1WLRA 4HQMA 4XSZF 4UNOA 1V4RA 3RKYA 5E8IA 4ENKA 5HS8A 2VOPA 2FNPA 4HZFA 3ECOA 2F5EA 4LK1F 3GLXA 4ZZLA 1GVJA 2FMLA 1OPCA 1OYIA 3I59A 5LEKA 1R5GA 5DCMB 4CYDA 1PP7U 2IPQX 1C21A 3LAPA 4ESJA 2IA1A 4S01A 1J0RA 1Z6TA 2HYGD 5E20A 1WKMA 4IDYA 5HLGA 1FC3A 2UZKA 1B9NA 2PFBA 3C18A 2XAHA 1HQCA 2Q8KA 1USSA 3HRMA 3K1MA 2FBHA 1W7PA 4HA8A 1XGNA 2XRNA 1MJ9A 3F6VA 4A0ZA 1TNSA 3C7JA 4UHTA 5FCHA 4DNCA 3HIFA 2ZO4A 3WTXC 5J8CA 3QP5A 2W24A 2IT0A 3GUDA 2MH9A 3K0LA 1FYKA 3CTZA 5E8GA 4FLKA 1XMAA 3GO5A 3PKBA 3BPVA 2XKOA 3FHZA 1CF7B 4QWQA 4AIKA 1ZRCA 5E17F 4L9JA 3Q9VA 4CICA 2Z5UA 2W84A 1SMYF 2BWWA 4HAMA 2ZBKA 4U7DA 4M9SA 1XSVA 2GU5A 3KZYA 3M8FA 4N9IA 3M9AA 1FSHA 1R00A 1ZLJA 4LJZF 1I5ZA 3CUQA 2AS5F 3E5XA 1RNLA 2HEOA 4WF2A 2DAOA 4MEYF 1FP1D 4OMZA 1Q1HA 3I54A 1K6OA 2ZNZA 2BHBA 1DPRA 3E5UA 3PQJA 4ZYDA 1IN6A 4MATA 3JAMZ 5AONA 5A2QK 3F23A 1FLIA 1F1ZA 1C24A 1I1SA 4EGYA 1S29A 4G6DA 4EM0B 4BYYA 3GFLA 2GG5A 3TKYA 4E70A 4RB0A 2RGVA 3V4GA 2IW5A 5DEQA 4MNUA 4LFUA 1UB9A 2O0YA 3E6BA 4OIQF 4IU6A 3M7GA 4O5VA 1XB4A 1W2MA 4XBFA 2BHAA 5L3GA 4U88A 5CE6A 3GX4X 3R0AA 2CFXA 3BOQA 4I01A 4HF2A 2XROA 4UVBA 1SFEA 4EGZA 1BIAA 2HGCA 1S8NA 3R6SA 3CO7C 4P96A 2P98A 4ESBA 2B0LA 3F6OA 2E7WA 2QQAA 2GZ5A 2LKPA 4RZZA 1IRFA 3H3ZA 5FD6A 1JHHA 3QPTA 2BEOA 3CUOA 2Z33A 1KU7A 4KMUX 3ZMDA 3KZZA 1H9TA 2GA1A 1E17A 3TO6A 2STWA 3FM3A 1FPQA 3DKWA 2Z9OA 3L09A 4LD5A 4FLJA 5KVRA 3P9IA 4FHTA 5FGMA 3ZMTA 1WL6A 4M73A 1BI0A 1DPUA 2G9WA 4ZNGA 4NB5A 3QU3A 2Q94A 5F6FA 4U6EA 2ISZA 4HF1A 3GF2A 4GCVA 1J9IA 1A16A 5JVTA 1SFUA 5CDEA 1YS6A 2XUBA 2MC3A 4UVCA 3B73A 5CVUA 2R7DA 4L5IA 4F7ZA 3WGIA 4U6WA 3PKDA 2EV5A 3MQ0A 2F2EA 2L4MA 4UV9A 4Q47A 4EM2A 5ICCA 1Z91A 2H6BA 4LG0A 3FXQA 1S7OA 2CSOA 1T6SA 2Q0OA 3TDZC 4IJAA 5ILUA 3BDDA 4ZYHA 3CB5A 1KU2A 3T8TA 3J80K 2XAQA 1K78B 4U76A 1UCRA 3EYYA 2P7CB 1DUXC 2FQ3A 1LQ1A 3CTAA 3TOBA 3M1EA 1C23A 1CHMA 1FBUA 1FT9A 1KGSA 1WWXA 3KP7A 2BHCA 3K9TA 1T38A 3OOPA 3S6BA 4G6QA 3RTRA 5CVJA 2W25A 4RS8A 2A68F 4CDGA 2K7LA 4DQ2A 5BOXA 3WTVC 4HDUA 3O2PE 1F9NA 4S00A 1KYZA 3BP8A 3L7WA 4KT5C 3ZMUA 3GYHX 1TLHB 1O3SA 1OYYA 1WSUA 2CG4A 2ELHA 4PDKA 4U7BA 4U75A 4MTEA 3J81K 3RVAA 1YLFA 1TBXA 5J6XA 2EWNA 3COAC 4R8HA 1R7JA 3HOSA 4L0YB 3ZQ7A 5BMZA 4TV7A 3C3WA 2IW2A 2BWYA 3RORA 2EVCA 4U6JA 1FSEA 2JPCA 3RKXA 1D3YA 4RB1A 1R5HA 4G7ZF 2EV0A 2GU4A 2BBYA 4LB6B 3KE2A 3L2CA 3CJNA 4CGZA 2ESNA 1KYWA 4WK8F 2BWTA 1MJBA 5CVIA 2HOEA 5K1YA 3LA7A 2K27A 1BJAA 5AIQA 3DPLC 3MFKA 3DP7A 1BN5A 4U71A 2P8TA 1YQAA 2HOWA 4BHCA 1LDKB 4KIFA 5LRSA 2K4JA 2W85A 4R60A 1ZREA 4M6XA 2PJPA 2J5PA 2HQRA 2P99A 1G6NA 4M72A 5DUKA 3RI4A 1MDMB 4S2TP 2D2WA 2QBYA 2VC1A 4LLGF 2NRAC 1K79A 1FZPB 4A6WA 2B3HA 3LAJA 1Z9CA 4KA4A 2VBXA 3IWFA 4A5NA 4IRHA 2FBIA 1XDUA 4U0WA 3JAMK 1MDMA 2RN7A 5L3BA 5CIKA 4ENNA 4I02A 3I58A 3Q5FA 1LB2A 4OINF 2P5LC 3WTSC 1WQ2A 2Q92A 3SFZA 2IA0A 1IXSB 1MGTA 1GXQA 3KP2A 2PMHA 3EETA 1IN4A 4WXDA 2CO5A 3ROUA 4PNCA 2P9AA 2EV6A 1MZBA 2UWMA 5JI6A 4WCGA 2A5YB 4PGGA 2XKPA 4KDPA 3HRTA 2W57A 2O8XA 1IN8A 3I71A 1ON2A 2FEZA 2VBYA 1O3TA 4U6CA 1T0FA 1AOYA 2NNYA 1IF1A 2WV0A 5LGUA 2NQ7A 1I27A 2ZXJA 3HOTA 1HSTA 3Q6DA 2A69F 1GXPA 4Q4ZF 4XLPF 4I0BA 3V7SA 2DFIA 5FLXZ 4ZWUA 2Q2EA 2K02A 2RVCA 1B4AA 1KQ0A 1G4DA 4BH9A 4Z7MA 2IRFG 4G7OF 2A3SA 5E5BA 2QQ9A 3RPUA 4U0VA 3IKVA 1MD0A 2F5CA 2OAZA 3KEOA 4ON0A 3CB6A 4RAYA 3F3XA 4WXCA 1JAWA 4FO7A 1J75A 3BIPA 4QLCU 5HOOA 4ZWPA 3TB5A 1FBQA 3OV8A 3JTHA 4AIJA 1LJ9A 2MH2A 3ZN1A 4XSXF 2EVMA 2CGPA 2Q95A 2D1VA 2OQGA 3KCCA 2HKOA 3E6CC 1FP2A 4A6EA 2WWYA 2P4WA 3PQKA 1ZRDA 2GA2A 3BITA 3RKWA 5IT9Z 4U1BA 4A5MA 5E1XA 3IRRA 2V1DA 3FMSA 3KLNA 3R4KA 3P9CA 5DCMA 1W7VA 3JW4A 2V3YA 3U1DA 2H27A 2GQQA 3HSFA 3V8JA 1H0MA 2DBBA 3LSTA 5L3FA 3TAVA 3DQVC 2ZSGA 3TQNA 5LRRA 3MAJA 1P92A 2G7UA 5JHUA 2PLYA 3HTSB 2AXLA 2XV4S 1FBSA 3W6JB 1ZG3A 4A2UA 4ZH4F 4NQWA 4S2RP 2FNAA 3IRQA 2NNNA 5DUIA 2COMA 4I2OA 1TTYA 2ZMEB 3MCZA 3U2RA 3LQRA 1QQIA 2LDUA 1C22A 1R23A 1RI7A 2Y0MA 3RYRA 5F1RA 2M87A 1C0WA 4MTDA 1CF7A 2Y75A 4ETSA 2UXNA 1I6XA 2GGCA 5DDGA 2FE3A 4BHPA 3ZMVA 2KJBA 4IPAA 3LA2A 4JUQA 4Q48A 2FA5A 2QM3A 1J2XA 4YFKF 3DFGA 4HXXA 2PBIA 2MBFA 5H6QA 3ZMZA 4PCQA 4ENMA 2O6GE 4HF0A 4EJUA 4LB5A 3IC7A 3KETA 2E1CA 1EH8A 3JSPA 2GG9A 1WY2A 1YFHA 2O61A 2DU9A 5E1WA 2LF7A 2BHDA 3SHFA 1IN5A 4RGZ1 5TRDA 4IHTA 1TW3A 5EEGA 3WTYC 4FX0A 3L24A 1OR7A 4EJVA 4G9YA 2ZCWA 3R0JA 1IXRC 2HYFA 1XSDA 1HW2A 2DK5A 2GIVA 3WODF 1XGOA 2FMYA 1R1TA 2RKHA 4HV6A 4KIGA 4L9VA 5E18F 1U78A 4ESFA 3LA3A 1HW5A 4GGGA 3BJOA 4HLXA 1KP0A 1FYLA 4YFXF 4MHGA 3HSRA 1YW8A 5D8LB 3WE3A 1U2WA 3FXRA 2FSWA 1D5VA 1QO0D 5D5UB 2V3XA 2JTVA 2EFOA 4A12A 5TJJA 2L01A 4H0EA 1U5TB 4MEXF 3FMQA 4EJWA 2EFWA 4IVNA 3N4MA 3MZHA 1LVAA 4ZWOA 3PKAA 3V8KA 3NRVA 1XGSA 3O3KA 4AVPA 4HV5A 1D8KA 1QPMA 2VODA 1LDJA 3BIQA 1F5TA 5KK1A 1ODDA 1XSXA 1QGPA 5E1ZB 3I53A 2KIUA 4G8XA 4OIOF 4FX4A 5BQTA 1ZAOA 4HBLA 3D27A 2FXAA 2QYOA 5IT3A 2V6CA 2P7VB 1O7FA 3BJAA 4KM3A 1MJAA 2OQRA 1SFXA 2HFHA 4IKRA 5DCFA 4O6JA 2DI3A 2A61A 2V9VA 3KP4A 3CDHA 5HDNA 1YW9A 4KIBA 1B59A 4BXUA 3J7AO 3GFMA 2Q96A 4FKCA 1XMKA 2HDCA 2GAUA 4LGWA 2BV6A 4FUKA 2RNJA 4B09A 2MATA 3E5QA 1G3YA 3BJ6A 2R3SA 1CGPA 3GXOA 3GEZA 4M74A 1X3UA 2XHKA 1JHFA 3GFJA 1K78A 1R36A 4KUMA 4BHBA 5FLXK 4AWXB 4G94A 1TQIA 3PKEA 3EQLF 3HUGA 1MKMA 1QNTA 2JZYA 3IU7A 1TQMA 2NS0A 1IAWA 1GHCA 1REPC 4CZZA 5D8KB 3VB2A 1ZLKA 2F5FA 1AWCA 4Y17A 3WTTC 3Q9SA 3P7NA 2EB7A 5EEHA 3SZPA 1YJ3A 1RUOA 3QRFF 4UV8A 2DK8A 2QENA 2UXXA 2M30A 2GXBA 2V1UA 1FWZA 4P5OA 5IT9K 3F8FA 1YIOA 4P9UA 3GWZA 1G3SA 3IU9A 1XNZA 5K5RA 2CWEA 2HQNA 2P5KA 3KP3A 5ILSA 4M6YA 4O3MA 4MQ9F 4RGSA 3L00A 4WX9A 4HX8A 1YW7A 1N51A 4LK0F 4A0YA 3F8NA 1XDSA 3E97A 3V7CA 2J5OA 2KJCA 1F4KA 2EVOA 1QZYA 1KQ8A 1SD6A 4KICA 2YX7A 1ZGAA 4M9XA 5FB2A 4CHUA 4OIRF 4Y15A 4KNYA 1FOKA 1ONVA 1W7PD 4UVAA 2LNBA 4JQFA 1YO5C 4BAYA 5LHGA 1KU3A 1L3LA 1ZG5A 4L9NA 2KIFA 3VODA 5LHHA 1ZYRF 3MEXA 1ULYA 2HS5A 1EV7A 4R79A 4K2EA 5JFRA 2VXZA 3D5LA 1LDDA 1LNWA 1SMTA 2OBPA 1BC8C 4Q5SF 3I5UA 2HWVA 4GYGA 3MZYA 1P4WA 4QR8A 2XVCA 3EUHA 1P6RA 4MGRA 3NEUA 3CLOA 1OYWA 4EMSA 1RIOH 2XIGA 2OD5A 2B3KA 5D5XB 2D1HA 3JTGA 2VE8A 3V8LA 1S3JA 5D4RA 4EGEA 2PN6A 4CO8A 2JPBA 5ERIA 5LGTA 2FOKA 3FF5A 3FXUA 5BPDA 3KLOA 3T8RA 5HVQC 2NQ6A 5D6EA 4YG2F 5FFXA 2L02A 3ZP5A 3U9GA 2M1BA 4IF4A 5F64A 1LEAA 2LF8A 3VFZA 1ZH5A 3LWFA 1HW1A 1T2KA 1HKQA 3PFIA 2QUFA 4D0PA 1IRGA 4FO8A 4M9ZA 4IF7A 4HYEA 4U0YA 3V7RA 1P4XA 4YFNF 4B8XA 1LEBA 2ACJA 4L5JA 1WN1A 4S04A 3HRSA 2MLGA 2HTJA 3DF8A 1YS7A 5CNXA 1QBJA 3E3VA 3MR1A 4LLNA 4OOIA 3K2ZA 3E6MA 2H94A 5LHIA 5FFZA 4XLNF 1ZN2A 2VOOA 3ZMSA 1W5SA 1DP7P 1W4MA 4OIPF 1FYMA 1QXWA 1S7AA 3I59B 1IXCA 5LBQA 4EQQA 5HS7A 4ZYGA 1SD4A 4P55A 3EDPA 3F8BA 4KN7X 2M5WA 3TOAA 4JK1X 3KP6A 2EJRA 4YIIA 2YX4A 3SZTA 2GZWA 5AIPA 1QXZA 4EJOA 4AIHA 1TW2A 1W7PB 1D8JA 2PQ8A 3S2WA 3ISPA 1K7AA 3D0SA 2OKNA 3KEQA 2IA2A 3IL2A 1J7KA 2GXGA 2EFQA 3LFKA 3WTWC 4HOBA 1Z6RA 3R61A 2PI0A 4BQAA 1U5TC 1WBQA 4U6ZA 3F21A 2EFNA 2A6EF 1WL9A 2BWXA 2ZKZA 2HKXA 2V3ZA 3QU6A 2GG2A 2EA2A 5L3DA