1XGOA

Methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
295
structure length
295
Chain Sequence
b'MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Crystal structure of methionine aminopeptidase from hyperthermophile, Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Aminopeptidase
total genus 81
structure length 295
sequence length 295
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1997-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xgoA02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1xgoA01
1VTNC 5ICFA 3I64A 4WK8F 3GX4X 3Q9SA 3FM5A 1PP8F 3CTZA 4G6DA 5LBQA 1OYWA 1H9GA 1WL6A 2V1DA 4AD9A 1MJBA 3LA7A 4ETSA 4MGRA 2VBYA 4AIJA 3BJOA 2K02A 2QYOA 1N51A 1KYZA 5L3CA 3WG9A 2VOOA 3EYIA 1KGSA 4B09A 4ZWOA 2FBIA 2XAGA 2DPUA 4U6JA 2LKPA 3WTYC 3C1DA 2FOKA 3P9CA 2Q92A 3FF5A 5E1WA 5EEGA 3FXUA 4OINF 3GLXA 4PGHA 2QQ9A 5E8GA 1QZYA 3RKYA 3PQKA 4ZNGA 3MAJA 3H3ZA 1LEAA 2G6PA 2XROA 2A68F 2BWVA 3ERED 4I7HA 4DNCA 4HX4A 3CO7C 3QU6A 3ABTA 1SFEA 3FMRA 4L9NA 4IRHA 3NRVA 4ZH4F 3NQOA 3K0LA 2DO7A 1QNTA 2E7WA 1I27A 5E5BA 2HYGD 4RAYA 3VEPA 1P4AA 3KLNA 5CYVA 1TNTA 2V9VA 4N0BA 4CO8A 4WXDA 2BYVE 2GGBA 3V7CA 4KIGA 2RV8A 4KYWA 1U6GA 2Y0MA 1YG2A 4RB0A 4I2OA 5DEQA 3TQNA 2BWWA 2GZ5A 3KP4A 4U69A 2EB7A 1BBYA 5L3EA 1IN8A 1KQ8A 1FY7A 4MQ9F 5LHGA 3J7AO 2HDCA 2M87A 1RZ4A 2A6EF 1QXYA 1U5TC 3CUOA 2W24A 5LRSA 3DFGA 5DD8A 4U75A 2EJRA 2HS5A 2ELHA 3QAHA 5DCMA 1ZG3A 5FD5A 4HF2A 5K5OA 3IWZA 4FHTA 3QU3A 2PMHA 4KMUX 3ZMUA 4A2UA 4EM0B 1ZLJA 3I0TA 1J59A 2ZKZA 4R8HA 1B4AA 3T8TA 4HQMA 3C18A 4NQWA 5AONA 3I5UA 2DK5A 1QXZA 2WV0A 2KIUA 2CG4A 2IA0A 2P7VB 3HRMA 1AOYA 2K4JA 1FSEA 1O3QA 1KU3A 1C24A 3P7NA 1NHAA 4HYEA 2EFNA 2B0LA 2IJLA 4Y17A 1HKSA 2MH2A 4ASNA 4BHCA 3Q5FA 2PMUA 4E70A 1I5ZA 5LGUA 2EK5A 2STTA 2VONA 4U71A 1JAWA 4JK1X 1ZARA 2GG9A 1W7PB 2XHKA 1FYLA 3H92A 5TJJA 2ZNYA 3CB6A 2H6BA 4CGZA 3P9KA 2FBHA 3AAFA 2BHAA 1QBJA 1S7OA 4KIBA 2Y75A 1O3RA 2H6CA 4Q4ZF 2HR3A 4OMZA 2CW0F 5DCMB 2NRAC 3ZQ7A 3F8CA 3KP3A 1HW2A 3KZZA 5BS6A 1T98A 4P9FA 4RB3C 2L02A 2P98A 4G8XA 1STZA 1BOAA 3TB5A 1E2XA 3V7RA 2DU9A 1U2WA 1WL9A 4IKTA 1O3SA 3ULQB 5JFRA 4I98B 4P96A 3WTTC 1QGPA 3FZVA 4CZZA 2GGCA 3MCZA 2WC2A 2CQKA 5TRDA 4OOIA 4HA8A 3I4PA 3DQVC 5L3FA 1TBXA 1Z7UA 3HIFA 2L4MA 3TO7A 2XRNA 4GO1A 4HF1A 1S3JA 3FWEA 2M45A 1YQAA 4UVBA 3ROUA 3K1MA 2GTXA 4RAZA 3V7SA 4BYYA 1LDKB 4IF4A 3RIRA 1TNSA 3GYHX 1Z91A 2ZO4A 1TTYA 3IWFA 1F1ZA 4HW0A 2FXAA 1GVJA 4AIHA 4KM3A 3CUQA 3V8KA 1Q1HA 2Z5UA 2QLZA 3F21A 5JI6A 1ZGJA 1FBQA 1C0WA 3MZYA 1J0RA 3QOPA 3SHFA 3GFIA 4L18B 5CDEA 2HQNA 5ILVA 2Z9OA 2X0LA 4KN7X 1Z1DA 2XVCA 3IKVA 3RPQA 4Z7MA 3CLOA 4EVIA 3I59A 2ZMEA 4WCGA 1D8JA 1C23A 4ZZDA 5DUKA 3CUQC 3BDDA 1ONVA 4XRFA 2XUBA 3F8FA 5JR3A 2RC4A 3GFMA 1Z6TA 2IRFG 1I1GA 4P9UA 1MGTA 4HXXA 3QP5A 4FT8A 3L09A 3I53A 4IRIA 2GU6A 2P5VA 1HSTA 1R5GA 2F5DA 2O03A 1H9TA 4MTDA 2K86A 2R7DA 3ECHA 1Y1NA 2CSOA 2GXGA 3S2WA 2ISYA 2BGCA 2QWWA 1XGMA 3LQRA 2DPDA 1YW9A 3U1DA 4U6CA 1R7JA 3JSPA 5ICGA 5D5UB 5LGNA 4S04A 3LFKA 1G3WA 3EETA 4OU0A 5D6EA 3WTVC 1CF7B 4ZWPA 4Z2YA 2O3FA 1GXPA 2GWRA 3FXRA 1F5TA 2X4HA 3IC7A 1ON2A 1MZBA 4JUQA 1IXCA 4G6QA 2YU3A 2DAOA 4L0YB 3L2CA 4EGEA 2A6HF 2FMLA 4GGGA 2O8XA 1PV9A 2HZTA 3C7JA 4KN4X 2FBKA 2UXNA 2IW2A 4Y15A 1R23A 2ETHA 1S7AA 3T8RA 2D2WA 2BWYA 3WGGA 2HKXA 1HW5A 4OOKA 2R7FA 3QP6A 2Q2EA 1O0XA 3F8MA 3M1EA 1G6NA 5L3GA 2ZCWA 1XGNA 2UXXA 4ESJA 4I09A 1XDUA 2IP2A 3RYRA 4UNOA 2KKOA 4IVNA 3KLOA 1DPRA 4I02A 5A2QZ 2GG7A 3U9GA 4OIOF 4IXAA 2G7UA 4HX8A 1F9NA 1QPMA 2D1VA 4PV4A 3KEQA 1XN7A 2B3LA 3K9TA 2EFQA 4RZYA 3SXYA 3L7WA 2FNPA 5DCFA 5BPDA 3EDPA 3HRUA 1BM9A 4HV6A 2BBYA 2F2EA 5IT9K 2AXLA 2VE8A 2HTSA 4L5IA 1V4RA 2A5YB 2P5LC 3R0JA 2EV6A 3IHUA 4U1BA 3TDZC 4IDYA 2EFPA 2Y48A 4KT5C 2GXBA 3RKXA 3V4GA 1FPQA 4U7BA 1LJ9A 3TKYA 2CYYA 4RGSA 4OIQF 4MQVA 5CLSA 3F6VA 3EYYA 4YG2F 2A69F 1J9IA 1YIOA 2P4WA 3B73A 1XMKA 3J80K 3VODA 2PN6A 1U78A 1R22A 3LWFA 1RUOA 4FO8A 4MEYF 1FNNA 3IKTA 4YFXF 1TQIA 1S8NA 4AVPA 2O61A 4HZFA 4GXOA 2L01A 1WN1A 4Y13A 4FLJA 4GCVA 3P9IA 2GU7A 1IF1A 5KK1A 1K79A 2MA3A 5CVJA 1XSDA 2HOWA 2VT3A 2W57A 3E3VA 3HSEA 5ILUA 2NNYA 3FMSA 2HEOA 1SMTA 1IAWA 4CDGA 3EQLF 4RGUA 4BXUA 2BWUA 4FKCA 3GEZA 4WX9A 3ECOA 1YO5C 4XLNF 3D27A 2VE9A 1W5SA 2XKPA 2DQRA 5D5WB 3HOSA 1EH6A 1MDMA 4U73A 3DKWA 2PEXA 5HS8A 2FQ3A 2OQRA 1KU7A 2EFOA 4TV7A 3COAC 5JHUA 2E7XA 3PKBA 2EVOA 3D0SA 2FF4A 4BNCA 3OOPA 1BI1A 4M6YA 5CDVA 4UUVA 2J5OA 2DI3A 2PBIA 1T39A 4ZYGA 1OYIA 1WLRA 5CE6A 4JBAA 5HVQC 1G3SA 5AIQA 2D45A 4U6EA 1IRGA 4U6ZA 1KA8A 1J75A 4XSZF 3EUHA 2HTJA 2D1HA 1U5TA 2F5EA 1CHMA 4M6XA 2OZUA 2W25A 1LDDA 1IUYA 1MDMB 4QR8A 4ENNA 1FBSA 5FFXA 3KETA 3RKWA 1SFUA 1PDNC 1DPUA 3FMQA 4A0XA 3RDIA 4RB1A 4BH9A 2QQAA 3ABUA 1LB2A 5E1ZB 2Q95A 2DTRA 2EVMA 5K1YA 2HYFA 5FLXK 2MATA 1S6LA 2NYXA 3WTXC 4CHUA 3LAJA 1OKRA 1W2MA 4BAYA 1IXRC 2ESHA 3M9AA 3J81Z 1U5TB 4WXHA 4R1HA 4KUMA 2IPQX 2XAFA 4S01A 3I58A 4RB2C 3GF2A 1DP7P 4U6WA 2IA1A 4HQEA 5DYMA 1ULYA 1S29A 4WWCA 3F8NA 2QBYA 2QQBA 3TDUC 2M5WA 3JSOA 2YX7A 3BROA 1V3FA 1TQMA 3GVAA 4IPAA 3IRRA 4U0WA 4S2TP 3GXOA 5LHHA 4Q47A 1XB4A 4A6DA 1D3YA 1JHFA 4LLLA 4EQQA 1R36A 2EWNA 1XMAA 2IVMA 2WTEA 3DF8A 1TLHB 2BEOA 3PKAA 4B8XA 2CFXA 2R3SA 1ZN2A 4EV0A 1XGOA 4EJUA 3RJPA 1KU9A 1AWCA 3ZMZA 2JSCA 4RZZA 2VBWA 1YYVA 2DW4A 3KP5A 2GA2A 3ZN0A 3BZ6A 3MATA 3KP6A 3WODF 5D6FA 1WBQA 2STWA 1FP2A 1O57A 2EFWA 1XSXA 5DUIA 4HV5A 2HKOA 4IF7A 1YS6A 3HSFA 3ISPA 4IKSA 5CVVA 3BIPA 2ZSGA 5F6FA 3M7GA 3OV8A 2PFBA 3BP8A 4HF0A 2W85A 5DD4A 5CVIA 4LK0F 4LD5A 3IU8A 2ZXJA 4PDKA 3LA3A 1U8RA 3KCCA 1LVAA 2FA5A 3E5UA 4HDVA 2F5FA 3FHZA 4EM1A 3Q9VA 2BHBA 4UVCA 4U0YA 2ISZA 5ICCA 3R6SA 3KEOA 3QPHA 3E5QA 1WKMA 2E1CA 3TOBA 1KU2A 1XCBA 5LGTA 1HKTA 1YW7A 3KP7A 4QLCU 4G7HF 1PP7U 2L3DA 1K78A 3K69A 4ZYDA 2LF7A 3E6DA 2XKOA 4L5JA 4WF2A 2B3HA 3KE2A 4M9XA 2EV0A 1BI0A 3BPVA 2ESNA 2P7CB 2BB7A 3L00A 1ZRCA 1O3TA 3CUQB 3RPUA 2Z99A 1ZRFA 3K1PA 2VBXA 1QZZA 4IHTA 1FYMA 1IN6A 4LMYA 1XDSA 1IZ1A 1ZG1A 1HXDA 3N4MA 2K27A 2DBBA 2VOPA 3TAVA 2OQGA 1B1BA 2MBFA 4RS8A 3QRFF 5LEKA 2P99A 4BHBA 4IKRA 5FCHA 2ZFWA 2P9AA 4HAMA 2H94A 2XIGA 2V3ZA 4IRGA 3TO6A 4FX4A 5E18F 2V1XA 3I59B 1WQ2A 2ZMEB 1MJAA 3WU0A 3R60A 4LLNA 3CB5A 1XGSA 1K78B 3GZ5A 3G3ZA 1J7KA 5CNXA 2BWTA 2H27A 2UWMA 1R5HA 1W5TA 1YFHA 4GYGA 2QM3A 4YIIA 1XNZA 1WI9A 4D0PA 2GG8A 4CYDA 2M1BA 2GG5A 2J5PA 1R58A 1UCRA 3SZTA 2GG0A 4U70A 1OMIA 1YTYA 5JVTA 1LDJA 5FD6A 1ZAOA 1OPCA 4WXCA 3CJNA 3Q6DA 2V3XA 4NB5A 2GG3A 2BH3A 1BC8C 3HTSB 2H09A 4A6EA 1MJ9A 2OZ6A 2XAJA 1WSUA 2LDUA 3WGIA 1ZH5A 2ACJA 4ZYEA 3MZHA 1RNLA 1EH7A 3WTZA 4HBLA 3HRSA 4HLXA 3F23A 4EJOA 3RVAA 1A16A 2DLLA 2E1NA 3MR1A 5AIPA 2YSRA 4AWXB 2RDPA 1BIAA 2HFHA 5D4SA 2BHCA 2CO5A 5HS9A 5D4RA 2PQ8A 2QUFA 4EJTA 4PCQA 4YFKF 3JAMK 2G7HA 1TW2A 3E6BA 2RN7A 2BWSA 1YW8A 1PUEE 3E6MA 1WWXA 5IT3A 5J8CA 1KP0A 3WE2A 3ZN1A 2RVCA 3S6BA 2L54A 1FOKA 5D8LB 2YR2A 3PKEA 1JXSA 1T38A 1I6XA 2G9WA 1J2XA 1M35A 3GWZA 4MHGA 1ZHFA 1E17A 3CDHA 1BI3A 3E5XA 3KP2A 2FEZA 1T0FA 4LB5A 2M8EA 1ZRDA 1ON1A 4A0ZA 2MLKA 2EA2A 1FZPB 2DQLA 2GIVA 1FC3A 4ENKA 5LLQA 3SQNA 2KJBA 1Z9CA 4HDUA 4KNYA 5D5XB 4KFCA 2TDXA 1K7AA 4I0AA 3B02A 2WWYA 3M8FA 1IN7A 5HDKA 3RORA 5E1XA 4S00A 3TOAA 1G4DA 5E8IA 3F6OA 2QVOA 2EV5A 3T0YA 4KIFA 3PKDA 1Y0UA 4LK1F 2GU5A 3JW4A 3RI4A 1P92A 3BOQA 4PZJA 2OAZA 1RI7A 4LG0A 1G3TA 2JPCA 4R60A 5K5RA 3MQ0A 4G7OF 3R61A 2OBPA 3QPTA 2BHDA 1GHCA 4KA4A 3REOA 3N97A 3R4KA 2JRTA 4P55A 3GFJA 1L0OC 3RYPA 2VXZA 4PNCA 4H0EA 1ZREA 1KQ0A 5LRRA 1SD4A 3MWMA 2QZ8A 3HHHA 4UV8A 1O7FA 5CJ9A 5FFZA 5LHIA 4G7ZF 2GAUA 5BOXA 1B59A 2UZKA 2VC0A 1R1TA 1IN4A 3W6JB 1A04A 2CWEA 4ENMA 4YFNF 2NQ6A 1H0MA 1SD5A 2JT1A 3JTHA 2O6GE 3KZYA 4O6JA 1EV7A 4UVAA 4XBFA 3W6KB 2V6CA 3R0AA 5BQTA 5F1RA 4RGRA 4LG0B 4U76A 2OU2A 2NS0A 3L7GA 3DPTA 4P5OA 5DDGA 3ZMSA 3WGHA 2FNAA 3BWGA 4OMYA 5J6XA 2RKHA 4CXFA 5ERIA 1IN5A 4EJWA 1BC7C 1L3LA 4RGZ1 3E97A 4EMSA 4S05A 1W4MA 3V8JA 4HX7A 5ILSA 4I01A 2Q0OA 2XV4S 1R1VA 4EJVA 1YVMA 5E17F 2P5KA 4ZWUA 1YLFA 1C27A 1I1SA 2FRHA 2GU4A 3VB2A 1SD7A 2COMA 2IW5A 2Z33A 2PLYA 3BIQA 1UB9A 4FX0A 4G9YA 1R00A 3F8BA 4BHPA 1FSHA 4RGXA 5A2QK 2V79A 5CVRA 3ZMVA 3TO9A 1W7PA 2XAHA 3H3UA 1LQ1A 1Z6RA 1SFXA 2F5CA 1F4KA 1B6AA 1KYWA 4ESBA 2YX4A 5F64A 3LQQA 4EGZA 1QQIA 1B9MA 5CIKA 3DXJF 4AIKA 3O3KA 3BPXA 3L9FA 2GG2A 1W7VA 5LEJA 1C21A 2KRFA 4BQAA 4A5NA 4A6VA 1P4WA 2K7LA 1U3EM 4G94A 1SAXA 1USTA 5FGMA 3MFKA 4OIPF 3ELKA 4IU6A 1ZLKA 2MLGA 1BI2A 3IU9A 3MX6A 5HOOA 2KIMA 1FLIA 2NNNA 1YJ3A 5FCFA 4NHJA 4MEXF 1KQ9A 3HHGA 4ENJA 2RNJA 2BWXA 4ON0A 4KMFA 2BE5F 1P2FA 2JZYA 1YS7A 2XASA 2OKNA 2A61A 3HRTA 3HOTA 3FXQA 5HS7A 2KIFA 4L9TA 3ZMDA 2Q96A 4FLIA 1BIBA 3LSTA 2JTVA 2QBYB 3JAMZ 6PAXA 1FT9A 4U88A 1K6OA 3PFIA 4I0BA 4S2RP 3ZP5A 4ZYHA 4ZZLA 2O0YA 2BN7A 2FMYA 2P6TA 4UV9A 1T2KA 3O6BB 1FWZA 1UHMA 1FP1D 5IT9Z 3G73A 4IHSA 4HLYA 3I54A 4F7ZA 1X3UA 3E6CC 4O3MA 2MC3A 3I71A 2FE3A 2PI0A 1P6RA 1OYYA 4FLLA 2GZWA 3DV8A 1HBXG 4MATA 1SD6A 4N9IA 3WE3A 3FX3A 5L3BA 5KVRA 1IRFA 2XGXA 3VFZA 1UFMA 1HSJA 2DK8A 5FO5A 3IRQA 1USSA 4DQ2A 4KICA 2CGPA 3NEUA 3J80Z 4N9HA 4GYIA 1XD7A 2L4AA 4FO7A 3MEXA 1LEBA 2IA2A 4U7DA 4M73A 2A07F 5J8FA 4M9ZA 3O2PE 3K2ZA 5DV5A 1CF7A 4HOBA 1FX7A 2NAZA 5E20A 3DP7A 1WRJA 1JHHA 5K5QA 3V8LA 3D5LA 5BMZA 3ZMTA 1TQPA 1HQCA 2HOEA 1QXWA 4Q48A 5ED4A 4EM2A 1CGPA 4FUKA 3GO5A 3F3XA 2RQPA 3BJ6A 3RTRA 3PKCA 2OD5A 4ESFA 4L9JA 5HLIA 1JE8A 1G3YA 2ZJ2A 1W7PD 2XAQA 2FU4A 5HDNA 1R1UA 1BJAA 2A3SA 3BITA 1J5YA 4MTEA 1SMYF 3WU1B 2HQRA 1FYKA 1IXSB 3DEUA 4M71A 2PG4A 3GUDA 3T1BA 4B28A 2EVCA 3WTSC 4IKUA 2Q94A 4LLGF 3J81K 1TW3A 2DFIA 4IJAA 4PGGA 2Q8KA 4M72A 1BN5A 2P6SA 4YIFA 4JQFA 3L24A 4L0ZB 1RIOH 5CVUA 1P4XA 5H20A 3K1NA 2RGVA 2IT0A 5BPIA 2P8TA 1ZYRF 1XSVA 5H6RA 2GA1A 5D5VB 4Q5SF 3U2RA 3CO6C 4M74A 3SFZA 4IECA 4UXNA 2B3KA 2QENA 4A0YA 3LAPA 1GXQA 2V3YA 3VOEA 4OIRF 2MH9A 2K4BA 5HLGA 4R79A 4CICA 2VODA 3IL2A 1B9NA 4U0VA 1D5VA 5EEHA 2Q93A 3T5XA 2LNBA 1ODDA 1RUNA 3JTGA 5D8KB 4QWQA 1FBUA 2VT2A 2DT5A 2OA4A 3CTAA 4A5MA 2HGCA 2VBZA 1EH8A 2NQ7A 2M30A 2YPRA 2PJPA 2LF8A 2ZBKA 5FLXZ 1DUXC 3BY6A 4XSXF 2FSWA 2VN2A 3BJAA 1C22A 2W84A 4A12A 2MD5A 1LNWA 3GZ6A 2BV6A 4LJZF 3WTUC 4K2EA 4FLKA 1ZGAA 3F72A 3HTUA 3HUGA 5HDGA 2KJCA 3HSRA 1HW1A 3GW2A 2GQQA 2LSOA 1JGSA 3WTWC 3IU7A 1T6SA 4LGWA 4XLPF 1UHWA 4UHTA 5CDLA 1MATA 1Z05A 5HLHA 1O7LA 3M8EA 1MD0A 1HKQA 1QO0D 3C3WA 4MNUA 2ADUA 4LFUA 1IW7F 2JPBA 3IG4A 3GFLA 4L9VA 1OR7A 3KFWX 2V1UA 3ZPLA 3FM3A 4KDPA 3LA2A 4M9SA 3ML6A 1MKMA 3PQJA 2C6YA 4EGYA 2VC1A 4LB6B 2AS5F 2HWVA 1DDNA 4O5VA 3F22A 1XCVA 3SZPA 1ZG5A 2Z3YA 1WY2A 3HYIA 1REPC 2EA4A 3TGNA 4A6WA 1D8KA 3DPLC 5ICEA 5H6QA 5L3DA 5FB2A 2ZNZA
chains in the Genus database with same CATH superfamily
2BVLA 1VTNC 5ICFA 3I64A 4WK8F 3OY9A 1OR7C 3Q9SA 3GX4X 2LKXA 3FM5A 1PP8F 3V42A 3OYIA 3CTZA 2QF7A 3LSIA 3CJTB 4G6DA 5LBQA 1OYWA 2VB6A 1H9GA 1WL6A 2V1DA 4Y3OA 3HKZA 4AD9A 3DLAA 1MJBA 4DYRA 3LA7A 4ETSA 4MGRA 4XR6A 1B8IB 1S72I 3L2VA 4FE7A 2F4IA 2VBYA 4AIJA 3BJOA 3O8GA 2K02A 2QYOA 1N51A 1KYZA 2MD0A 3PIOF 2KRCA 2XPWA 5L3CA 4Y4RA 4C3HJ 3WG9A 2VOOA 3EYIA 3SJMA 1KGSA 4B09A 2W82A 4ZWOA 4XONA 4RAGA 3I4NJ 4C2MJ 1I6HJ 2FBIA 3OYKA 1X4OA 2XAGA 3C2BA 2DPUA 4U6JA 3L2WA 2LKPA 3WTYC 3C1DA 2FOKA 3P9CA 1D1AA 3FF5A 5E1WA 4XIDA 2Q92A 4A69C 5EEGA 3FXUA 4OINF 1ZR4A 3DKXA 3GLXA 1MBKA 2JMWA 4PGHA 1BR1A 3W2WA 2QQ9A 5E8GA 1QZYA 2X1DA 3RKYA 3PQKA 4ZNGA 1X1CA 3MAJA 1ERDA 4BQNA 2NVQJ 3H3ZA 1LEAA 2P0WA 2G6PA 3JRGA 2XROA 2ME0A 2A68F 2YU9J 2BWVA 3ERED 3GTGJ 4I7HA 1LFPA 4DNCA 4HX4A 3CO7C 2EINH 3BQYA 3EPZA 5C44J 3QU6A 1APLC 3ABTA 4JX4A 2V9KA 3GLLA 1HA8A 1SFEA 3PJRA 3M07A 3FMRA 3B6CA 4L9NA 4BBSJ 2KZGA 1QVTA 1X1PA 4IRHA 3K2AA 3NRVA 3GTOJ 1YI2I 1NG7A 1YRNB 2MGQA 4ZH4F 1V5FA 3WHBA 3NQOA 3K0LA 2CJJA 2JQ7A 3AG4H 2DO7A 1QNTA 2E7WA 1I27A 3H9QA 1LKXA 5IP9J 1YIJI 5E5BA 2HYGD 4RAYA 3VEPA 1P4AA 3KLNA 2K9NA 3KIOA 4Y52J 1MMSA 2KMUA 3OYBA 5CYVA 1TNTA 1IO2A 2V9VA 2RNGA 4N0BA 4CO8A 1OQYA 1Z7LA 2BYVE 1FMVA 4WXDA 3S1QJ 2GGBA 3E0JB 2WAFA 3V7CA 1U9OA 2E19A 4KIGA 3QYFA 5EZGA 2RV8A 4KYWA 1U6GA 4A3LJ 1QHHD 2Y0MA 2OV7A 1XPXA 1YG2A 1U9NA 4RB0A 4I2OA 5DEQA 3TQNA 2BWWA 1ZELA 4L5EA 1IGNA 1Z3XA 2GZ5A 3RCOA 3KP4A 4U69A 3O8HA 2EB7A 2HDWA 1BBYA 5L3EA 1IN8A 2EH3A 1KQ8A 1FY7A 3CZ6A 4MQ9F 5LHGA 3EUHC 4HRIA 3J7AO 2HDCA 3K4MA 2M87A 5FKOA 1X19A 1RZ4A 2A6EF 1QXYA 1U5TC 3CUOA 4CCJA 5HNHA 3OYEA 2W24A 5LRSA 1VQLI 3DFGA 5DD8A 4U75A 2HU9A 2Z16A 2EJRA 2HS5A 2ELHA 3QAHA 5DCMA 4F3QA 1ZG3A 5FD5A 1D0XA 4F92B 5K5OA 2W1OA 4HF2A 1YE9A 3IWZA 5EGOB 4FHTA 1FOXA 3QU3A 1MMNA 2PMHA 1ETQA 2XB0X 4DIQA 4KMUX 3BTCA 4A2UA 3ZMUA 2M9HA 4EM0B 3CD6I 1ZLJA 2CV2A 2AXTC 4A3BJ 3I0TA 1J59A 2XPUA 2ZKZA 4FETA 4R8HA 3ZGKA 2ZXWH 1B4AA 1K4SA 3T8TA 4HQMA 3C18A 1G2HA 4NQWA 5AONA 2KDZA 3I5UA 2K85A 2OPTA 2DK5A 2I8DA 2OF7A 3DU5A 3CCRI 1QXZA 2WV0A 3H9GA 2KIUA 2CG4A 2IA0A 2P7VB 3HRMA 1CQTA 4E7SA 4XKCA 1AOYA 2K4JA 1FSEA 1O3QA 1KU3A 1C24A 1W1WE 3VWBA 5KAIC 5M3MJ 3P7NA 1NHAA 4HYEA 2EFNA 2B0LA 2IJLA 2BY2A 1HCRA 4Y17A 2AO9A 1HKSA 2MH2A 4ASNA 2LLKA 4BHCA 3Q5FA 2PMUA 2BOLA 4E70A 1I5ZA 5LGUA 2EK5A 2STTA 4FQGA 2VONA 4U71A 3D1NI 1JAWA 1E3PA 4JK1X 1ZARA 4IZZA 2GG9A 2HQAA 1W7PB 2V9PA 3BR1A 4CA0A 2XHKA 1FYLA 3H92A 5TJJA 5C3EJ 4BJTA 1FOWA 2ZNYA 2E2HJ 1IRZA 3CB6A 2H6BA 1I50J 4CGZA 3P9KA 4BS9A 2FBHA 3AAFA 5KHDA 2BHAA 3DWLE 1QBJA 1S7OA 4KIBA 2Y75A 1O3RA 2H6CA 4Q4ZF 2HR3A 4OMZA 2CW0F 5DCMB 2NRAC 4A3GJ 3ZQ7A 3F8CA 3KP3A 4E7LA 1HW2A 1ETOA 3LSGA 1JUSA 3KZZA 5BS6A 5EG0A 1T98A 4P9FA 4RB3C 2BZTA 2L02A 2P98A 4G8XA 1STZA 2ZJRF 1BOAA 3TB5A 4RA2A 1E2XA 5GAHJ 3V7RA 2DU9A 4X6AJ 1U2WA 1WL9A 2XB5A 5FLVA 4IKTA 1SEUA 1O3SA 1VQ8I 1Q1VA 1Z77A 3ULQB 5JFRA 3OIPA 4I98B 4EEFG 4P96A 2XGDA 3WTTC 3SDGA 2LY1A 2QSHX 4AC0A 4XRSA 4B1RA 1QGPA 3FZVA 4CZZA 2LREA 2GOMA 2GGCA 3MCZA 3HL2A 2WC2A 3FBIB 2CQKA 1XMXA 5TRDA 4OOIA 1BJZA 2FOWA 4IO9F 4HA8A 4JOMA 3I4PA 3DQVC 4DYQA 5L3FA 1TBXA 2X6WA 1Z7UA 3W6VA 3HIFA 5DM6F 2L4MA 3TO7A 2HXOA 5J3LA 3JRCA 2ME6A 3ZQHA 2KPMA 2XRNA 2A6TA 4GO1A 4HF1A 2EZIA 1S3JA 3FWEA 2M45A 1YQAA 4UVBA 5FKKA 3ROUA 4PFOA 5DTDA 3K1MA 2GTXA 4RAZA 3V7SA 4BYYA 1LDKB 4IF4A 3RIRA 1G59A 1AKHA 5F0HA 1TNSA 3GYHX 1Z91A 3JRFA 2ZO4A 2WY7Q 1TTYA 3IWFA 1F1ZA 4BEHA 3A4CA 1S5LC 4HW0A 3I3LA 2FXAA 2JN6A 2B63J 3CESA 1X1BA 1YJ9I 1GVJA 4AIHA 4KM3A 3CUQA 3V8KA 1Q1HA 3DEEA 2Z5UA 2QLZA 3I55I 2EIKH 3F21A 5JI6A 4B3XA 1RKWA 4I6ZA 4QPQA 2HVQA 1ZGJA 2XAUA 3HOZJ 1FBQA 2LG4A 3KEYA 1C0WA 3MZYA 1ETXA 1J0RA 3QOPA 3SHFA 3K6GA 1JGGA 3FK6A 3OR2C 3MKZA 3GFIA 4L18B 3HJEA 4J00A 1XX5A 5CDEA 4IKFA 2HQNA 5ILVA 2Z9OA 2IS1A 2X0LA 4KN7X 5J40A 2ID3A 1Z1DA 2XVCA 3IKVA 3RPQA 4Z7MA 2X9DA 2O7OA 3CLOA 3G1LA 5EZHA 4EVIA 3I59A 3UKGA 1YX3A 2NXNB 2ZMEA 3UNGC 4WCGA 3OYJA 1D8JA 1C23A 4ZZDA 5DUKA 3CUQC 3BDDA 1ONVA 4XRFA 3OYAA 4XLHA 2XUBA 3F8FA 1UG0A 5JR3A 2RC4A 3GFMA 2R7VA 1Z6TA 4KT6A 1JUPA 2IRFG 2EIJH 3RQ4A 3L2RA 2JA7J 1I1GA 4P9UA 1MGTA 2G0EA 1AKHB 4HXXA 3QP5A 2E1MB 4FT8A 3L09A 3M8JA 3I53A 4NC7A 4IRIA 2GU6A 2P5VA 2BY0A 3VYTB 2BHYA 3GTLJ 1GVDA 3PL8A 1HSTA 4B43A 2NVXJ 2BXZA 1R5GA 5FKMA 2F5DA 3SDBA 1S7EA 2O03A 2HPIA 1V5GA 4BUPA 3ZQCA 2ZMEC 1H9TA 4D5FA 1AU7A 2ZJQF 2R7SA 4MTDA 2K86A 5IP6A 2R7DA 3ECHA 3QQAA 1Y1NA 2CSOA 2GXGA 1WJCA 3S2WA 2ISYA 2BGCA 2QWWA 5CPRB 2DT7B 1XGMA 3LQRA 2DPDA 1YW9A 3U1DA 4U6CA 1R7JA 4E6KG 1JT0A 3JSPA 4GRIA 2M0MA 5ICGA 5D5UB 4A3EJ 5GAEJ 2QSGX 5LGNA 3FKIJ 5IP7J 5B1BH 2Q1ZB 2F48A 3LFKA 1G3WA 4S04A 3I56I 2E5ZA 2Y31A 3EETA 1IRXA 2X6YA 5IPAA 4OU0A 5D6EA 3WTVC 1MNEA 1MMDA 3BG5A 1CF7B 2LRDA 4QIWN 4ZWPA 4Z2YA 2KQRA 2O3FA 3BR6A 2GWRA 2QA4I 1GXPA 1JUMA 3FXRA 3S1MJ 1F5TA 5B1AH 2DCEA 2X4HA 3LMMA 3IC7A 1ON2A 1MZBA 4C9YA 4B4CA 1LPQA 4JUQA 1IXCA 3FXKA 4G6QA 3Q3SA 2YU3A 2DAOA 4L0YB 3L2CA 3DBLB 1XG1A 4EGEA 2A6HF 3BCBA 2FMLA 4GGGA 2O8XA 5C4JJ 3QYBA 4IOAF 2Z2SB 1PV9A 1UMQA 2HZTA 2XF6A 5EYRA 1T95A 3CC4I 3C7JA 3GCMA 4KN4X 2FBKA 2H1LA 2UXNA 2DA6A 1IJWC 2IW2A 2M8GX 3J7YJ 3HGGA 4Y15A 4IQJA 1R23A 2ETHA 2JA8J 1S7AA 4CH7A 4AVZA 3KZIC 3T8RA 2LY2A 2D2WA 5JVGF 2BWYA 5K7ZA 3PNVA 3WGGA 2HKXA 1HW5A 4OOKA 2R7FA 3QP6A 2CFOA 2Q2EA 1WZ2A 1O0XA 2A05A 5EF6A 3F8MA 4BL0B 4XN0A 2CMPA 1JKPC 3M1EA 2K9SA 1G6NA 5L3GA 2QEXI 4QPOA 3CMMA 4D1QA 2ZCWA 1FMWA 1XGNA 2UXXA 4E4HA 4ESJA 2V4JC 4I09A 4XKWA 1XDUA 2EZHA 2IP2A 3RYRA 2XSJC 5DS9A 4UNOA 4ZTJA 3AFHA 2KKOA 4IVNA 4X1EA 3KLOA 2D5VA 1DPRA 4I02A 5A2QZ 2LOOA 2GG7A 3U9GA 4OIOF 2W4SA 4HNUA 4IXAA 2G7UA 4HX8A 1WCMJ 1F9NA 1QPMA 2CW8A 2D1VA 3GTMJ 2DODA 2R7OA 4PV4A 4PJMA 3KEQA 2H8WA 2ZJPF 1ZGWA 1XN7A 3GTKJ 3EUAA 2B3LA 2HPMA 2QKLB 1POGA 3Q0UA 3HBLA 2ZB9A 1O4XA 3K9TA 4IX7A 1QZEA 2EFQA 4RZYA 2JK3A 1D1BA 2WADA 3K70C 3FXLA 3SXYA 3L7WA 2AQEA 1R4NB 2FNPA 3NWTA 5DCFA 5BPDA 5GP9A 3EUKL 4CSWA 1TP4A 3IV5A 3EDPA 3OYLA 3HRUA 1BM9A 4RAFA 3TW6A 4HV6A 2BBYA 2F2EA 5IT9K 2GIZA 3CF2A 3CQZJ 4IL6C 3AG2H 2GXAA 2AXLA 3OYCA 4V19K 1EA3A 2VE8A 3H9JA 4IHVA 1YJWI 2DJNA 2HTSA 1V4RA 2LP0A 3FIWA 4L5IA 2A5YB 4C3IJ 2P5LC 3R0JA 2F5VA 3K10A 4X0GA 2EV6A 5IYBJ 3IHUA 3ONQA 4U1BA 2L5QA 1RRJA 2XGCA 3TDZC 4IDYA 1S9HA 3LSHA 1OCRH 3LFUA 2EFPA 2Y48A 4KT5C 2GXBA 2JUCA 3RKXA 3V4GA 4NBQA 5LFAA 2V7FA 1FPQA 3G6EI 4U7BA 1LJ9A 3CDIA 3TKYA 3S14J 2CYYA 4RGSA 4OIQF 4MQVA 3BG7A 2L7MP 3F6VA 4Y33A 5CLSA 2GLOA 3EYYA 4PJJA 4YG2F 1UG2A 3CF5F 2A69F 1J9IA 1YIOA 2P4WA 3B73A 1ITYA 2DA4A 4CYCB 1SVMA 1QU3A 1XMKA 4BQQA 1OCTC 2R4GA 4F93B 4NC6A 3J80K 3VODA 2PN6A 1U78A 1R22A 3LWFA 1RUOA 4FO8A 3IH2A 3OSFA 4XM3A 4MEYF 1EKEA 3OL3A 1FNNA 5K7FA 3PO3J 3IKTA 2DDAA 4YFXF 2CW7A 1OLTA 1TQIA 4DBQA 1S8NA 4AVPA 2O61A 4HZFA 2H1KA 2E34A 4GXOA 1JJ8C 2L01A 5IOZA 1WN1A 4Y13A 4FLJA 4XK4A 1K83J 4GCVA 3P9IA 1VQ9I 2GU7A 2HOAA 1IF1A 4RM3A 1Z0XA 5KK1A 5J1RA 1K79A 2MA3A 5CVJA 5H2FC 1XSDA 2HOWA 5CQGA 2DA5A 2VT3A 2W57A 3E3VA 4HNTA 5IYDJ 3FBNB 4B48A 2E1OA 2M7BA 3HG9A 3HSEA 5HODA 3AG1H 5FROA 5ILUA 2NNYA 2L9VA 3FMSA 2HEOA 1SMTA 1IAWA 1RKTA 4CDGA 3EQLF 4RGUA 4BXUA 2BWUA 4FKCA 3GEZA 4WX9A 3ECOA 5C4XJ 2EILH 1BW6A 3CDLA 1YO5C 2ECBA 4XLNF 3D27A 2VE9A 1W5SA 1D0ZA 2XKPA 3JRBA 2DQRA 5D5WB 5E3OA 3HOSA 1EH6A 2A5WA 1MDMA 4XN3A 4U73A 2LKSA 3DKWA 2PEXA 3CP8A 1WJBA 3VPRA 5HS8A 2WBMA 2FQ3A 3OL4A 5EDNA 3ERMA 2OQRA 1KU7A 1SFKA 2EFOA 1W5CC 4TV7A 5JHUA 3COAC 4A3JJ 2E7XA 3PKBA 2EVOA 1R5ID 1TT0A 1DGRM 3D0SA 2FF4A 4BNCA 3E7LA 2ZXIA 1ETWA 3ZQGA 3OOPA 1SVOA 3VYRB 2PMZN 2LK2A 1BI1A 2IGMA 3IAM2 4M6YA 4LOCA 5CDVA 5F0CA 4UUVA 1TT5B 2J5OA 2DI3A 2IGKA 4HSRA 2PBIA 3NARA 4M3BA 1T39A 2VPLA 4ZYGA 1OYIA 3VYUB 2VUMJ 1WLRA 2P81A 3UR3C 2PJRA 5CE6A 4JBAA 3CJQB 5HVQC 1TWHJ 4JX6A 3H5NA 1G3SA 5AIQA 2D45A 4U6EA 4OAZA 3DTIA 1IRGA 4U6ZA 1AA7A 1KA8A 1DP3A 2LH9A 2MC4A 1J75A 4XSZF 5JHFA 3EUHA 2HTJA 1FIPA 2D1HA 4AYBN 1U5TA 1PUFA 5KNLA 2M34A 2B7EA 2QSFX 4BU2A 2F5EA 4KITB 4IQ4A 1CHMA 4M6XA 4CCNA 3TBIA 2OZUA 2V1NA 2W25A 1LDDA 1IUYA 2V6EA 2KLOA 3K4KA 1MDMB 4QR8A 4ENNA 1FBSA 3CCEI 5FFXA 1MH4A 3KETA 3RKWA 3K70D 2KISA 4ZTFA 4IEJA 5EJCA 4A93J 1SFUA 1MSEC 1PDNC 2EIMH 3CMYA 3FMQA 1DPUA 1IV8A 2I10A 1BW5A 2FX0A 2CS3A 3ZXSA 4C3JJ 2IXSA 1ZR2A 4A0XA 4JYKA 3HOXJ 4IOCF 1A36A 3C2GA 3RDIA 3OSGA 3A03A 2AHQA 2CUEA 1Y39A 4RB1A 4BH9A 2QQAA 1SVLA 3ABUA 5HLTA 1LB2A 2PMZA 1BR4A 3PUFA 4QTRA 5E1ZB 1MIJA 2E60A 3H36A 2Q95A 2DTRA 2EVMA 5K1YA 2HYFA 3H5RA 4OWRB 5FLXK 2PJRB 2Y0SN 2MATA 3BT9A 1S6LA 2NYXA 3WTXC 1FJLA 4CHUA 1I39A 5IY5H 3LAJA 1OKRA 2YUSA 1W2MA 4BAYA 3BZKA 2FJ1A 1DQUA 1VQ6I 1IXRC 2ESHA 3M9AA 2XDVA 3J81Z 1U5TB 1PUFB 2TCTA 4WXHA 4AYBA 4HNVA 4YIRX 1R49A 4R1HA 4KUMA 2IPQX 2XAFA 4S01A 3I58A 4RB2C 3GF2A 1DP7P 2XGEA 3MVPA 2UUZA 2IA1A 4U6WA 4HQEA 3JRDA 1KZHA 5DYMA 1G8XA 1WJDA 4XRSG 4KJZA 4E7IA 1ETYA 1ULYA 1NK3P 4I99C 3DKYA 3DBHB 4BDYA 1S29A 3LSMA 4MLOA 3F8NA 4WWCA 2QBYA 2QQBA 4IHYA 2JWTA 3K4BA 3S32A 3TDUC 1Y1WJ 3K7AJ 2M5WA 4M3DA 3A01A 3JSOA 2YX7A 2N8GA 3BROA 2KRHA 2R0QC 1V3FA 1TQMA 3GVAA 4IPAA 3OYMA 3IRRA 4U0WA 2CUZA 4S2TP 3GXOA 4RLQA 1Y8RB 5LHHA 2VQLA 4Q47A 5J1UA 1DGWY 1XB4A 2UV1A 4A6DA 2CU7A 1HDDC 1D3YA 1GV5A 1JHFA 2HXIA 2MABA 1Z21A 4LLLA 3L2QA 1X2NA 4EQQA 1MMAA 1R36A 2EWNA 4FISA 4CCMA 1XMAA 2Y0SA 1RR7A 2IVMA 2DT6A 3HC7A 2WTEA 3DF8A 1TLHB 2DYSH 3KPHA 4NUBA 1OISA 5DM7F 2BEOA 3PKAA 4NQWB 4B8XA 3IH3A 2CFXA 2R3SA 3K4JA 1ZN2A 3H1CA 3LSPA 4PJ0C 4EV0A 1XGOA 4EJUA 3RJPA 1KU9A 1AWCA 1F36A 3ZMZA 2JSCA 1E3HA 4RZZA 2VBWA 2X6OA 1RC9A 1YYVA 2DW4A 3KP5A 2DA1A 2DMNA 2GA2A 2OCEA 3ZN0A 3BZ6A 1D1CA 2K9LA 3MATA 1VFCA 3KP6A 3WODF 5D6FA 1WBQA 2STWA 1FP2A 2DMTA 1YITI 1O57A 2MG4A 2EFWA 4HPQA 1XSXA 5DUIA 4CZCA 5FKNA 4ITVA 1SANA 1MH3A 4E7JA 4HV5A 2HKOA 4PUSA 3TL4X 4PSWA 3S93A 4A3IJ 3M4OJ 4HG2A 3S16J 4IF7A 1MMGA 1YS6A 1WHUA 2OJED 3HSFA 3ISPA 1RR8C 4IKSA 5CVVA 3BIPA 2ZSGA 4CUGA 1NH3A 1A5JA 5F6FA 3M7GA 3OV8A 1VQMI 2PFBA 3BP8A 3CP2A 4AUXA 1FTZA 2JSPA 4HF0A 1X58A 2W85A 5DD4A 5CVIA 5J47A 4LK0F 2R7RA 2KZVA 4LD5A 3OMYA 3IU8A 2ZXJA 4PDKA 3LA3A 4J01A 5EG0B 1ORKA 5KCMA 1U8RA 3S3NA 3KCCA 4S0HB 1LVAA 2LVSA 2FA5A 3E5UA 3S2DJ 2DA7A 4HDVA 2F5FA 1IV6A 3FHZA 4EM1A 1VQOI 3I4MJ 2FD5A 3DCFA 3G1MA 3Q9VA 1FTTA 3HEFA 1RETA 3CMAI 1K4TA 2BHBA 4Y7NJ 4UVCA 4U0YA 3GTJJ 3MN2A 2KL4A 3OOUA 2OTLI 2ISZA 5ICCA 1QPIA 3BZCA 3NWSA 3R6SA 2W7NA 5IYCJ 3KEOA 2E36A 3QPHA 3WU2C 1TZLA 3E5QA 5E3NA 3S1RJ 2DFEA 2DMQA 2WY8Q 4CCLA 1WKMA 3HOUJ 2E1CA 2DYRH 3HGYA 3F0CA 3TOBA 3OYFA 1KU2A 1XCBA 1V54H 2AQFA 2M2EA 2QKMB 2CH0A 1VF9A 3E1SA 5LGTA 1HKTA 1YW7A 3KP7A 4QLCU 3FDYA 1GDTA 1X1DA 4G7HF 3DLLF 1PP7U 2L3DA 3A1YA 1K78A 2Y9YA 3GTPJ 3K69A 1HDPA 3K4LA 1UZCA 4RDUA 4ZYDA 2LF7A 3E6DA 2XKOA 5JLWA 2LBFA 4L5JA 3J7ZI 2K9MA 4WF2A 2B3HA 1MBHA 3KE2A 2X1EA 3LSKA 3QPSA 1D0YA 3AL0C 4M9XA 3KYDB 2WA0A 5FLMJ 2EV0A 3K4CA 1BI0A 4QSHA 2NVYJ 3BR3A 4BEHB 3BPVA 2ESNA 2P7CB 3RKQA 2BB7A 3L00A 4A3KJ 1ZRCA 1O3TA 3RZOJ 3CUQB 4M3FA 3RPUA 5M5YJ 2O8KA 2Z99A 1ZRFA 3K1PA 2VBXA 3MKYB 1U8BA 1QZZA 4IHTA 1FYMA 1IN6A 4LMYA 2L7KA 1XDSA 1IZ1A 2VQHA 4XQFA 1ZG1A 1HXDA 2IS2A 3N4MA 3J7AY 3CLQA 1MBGA 2BY3A 2K27A 2DBBA 3S2HJ 4XKBA 5J1YA 2VOPA 3TAVA 2OQGA 1B1BA 3ASOH 4XORA 2MBFA 4RS8A 3QRFF 2F6CA 5LEKA 2P99A 3HB9A 2X48A 4BHBA 4IKRA 5FCHA 2M4GA 2ZFWA 2P9AA 4HAMA 2H94A 1JKOC 2XIGA 2DMUA 2V3ZA 1U0JA 3IAS2 4IRGA 3TO6A 4FX4A 5E18F 2V1XA 3I59B 2CQXA 1WQ2A 2ZMEB 2CQ7A 1MJAA 2L9RA 3WU0A 2VJIA 3R60A 4LLNA 3CB5A 4BGDA 1XGSA 1K78B 3GZ5A 4B47A 3G3ZA 1J7KA 5CNXA 2Y2ZA 1W36C 2BWTA 2H27A 2UWMA 1R5HA 4FCYA 2Y69H 1W5TA 1YFHA 2LYCA 3IH4A 1J09A 1X2MA 4GYGA 2QM3A 4YIIA 1XNZA 1WI9A 5FKLA 4D0PA 3MD2A 3H0GJ 4A3FJ 2GG8A 1OCZH 1OCPA 1NG6A 2LR8A 4UY8I 4CYDA 2M1BA 2GG5A 2CV0A 2DA2A 2J5PA 1R58A 1UCRA 3JRAA 3S17J 5F27A 4EATA 1QHGA 3SZTA 2GG0A 4U70A 3D5SC 1OMIA 1YTYA 1MSFC 3QOEA 5JVTA 1LDJA 2R92J 4M6VA 5FD6A 1UJ8A 1ZAOA 1OPCA 2VKVA 4RLFA 4WXCA 1GUUA 1SAUA 3CJNA 3Q6DA 2L7ZA 2BW3A 5J4VA 3H3VK 5J4YA 2V3XA 4NB5A 3TEDA 4NC8A 2GG3A 2BH3A 1BC8C 5CQEA 3HTSB 3C2HA 3CCQI 2H09A 1IG7A 3W2AA 4A6EA 1MJ9A 2OZ6A 1QVUA 2XAJA 1WSUA 4GFBA 2LDUA 3WGIA 1ZH5A 2ACJA 4ZYEA 2GM4A 4NNJA 3MZHA 1BOBA 4XICA 1TWFJ 1RNLA 3FXMA 1EH7A 4AIDA 4BE0A 3WTZA 4HBLA 3HRSA 4HLXA 3F23A 3GBGA 5FJ8J 2VKHA 4EJOA 3VYSB 3RVAA 1A16A 4G6TB 2JUGA 2DLLA 5E3MA 2E1NA 3HOWJ 3MR1A 5AIPA 4NDLA 1MNDA 1VQ4I 3CC2I 2YSRA 3ZR8X 4AWXB 3CCUI 4UUTA 3TW7A 1LUJB 1WVRA 2RDPA 1BIAA 2R5YA 2HFHA 3S15J 5D4SA 4BQOA 1Y56A 2M4KA 4ZYAA 1F43A 2BHCA 1IDZA 2CO5A 5HS9A 2HVRA 4XNFA 5D4RA 2PQ8A 2QUFA 3DTKA 4EJTA 4E7ZA 4PCQA 4YFKF 3JAMK 3BR5A 2G7HA 1TW2A 3FKJA 3E6BA 2RN7A 2HDDA 2BWSA 3RQIA 1YW8A 2DMPA 1PUEE 2LD5A 3E6MA 3HPGA 1WWXA 5IT3A 4MO7A 2W48A 3PUBA 5J8CA 1KP0A 3GZNB 3WE2A 1JI8A 2GBYA 2BW3B 3ZN1A 3CCMI 5FRNA 2RVCA 3VSLA 2IS4A 3S6BA 1JKQC 2IBDA 2L54A 1FOKA 3H35A 2MSYA 2NS8A 2FUG2 3WHCA 3K4NA 5D8LB 2VKDA 2YR2A 3PKEA 2MW8A 3DTEA 1JXSA 1T38A 1I6XA 4F91B 2G9WA 5M5WJ 2Q2EB 4H4KC 1J2XA 4DOZA 1VQ7I 1M35A 3GWZA 4MHGA 1ZHFA 1E17A 3OYDA 3CDHA 1BI3A 3E5XA 4BJ5C 3KP2A 5M5XJ 3BG9A 2FEZA 1NTCA 3OS0A 4HEA2 2FQ4A 4KISA 3H0DA 1T0FA 2MFZA 3G4SI 4LB5A 1OFCX 4FTHA 2M8EA 4LIUA 1ZRDA 1ON1A 4A0ZA 2MLKA 2EA2A 1FZPB 2DQLA 2R5YB 2GIVA 1FC3A 2ELKA 5LLQA 4ENKA 3SQNA 4BXXJ 2KJBA 1Z9CA 2L9SA 1UHSA 4HDUA 4XRMA 4KNYA 1MNMC 2NS7A 5D5XB 4KFCA 2TDXA 1K7AA 4I0AA 3B02A 2RREA 3LOCA 2WWYA 1K61A 3M8FA 2JA2A 1TL8A 1IN7A 3DPUA 5HDKA 3SYTA 3F9KA 3RORA 2HI3A 2JA6J 1D5YA 3QODA 5E1XA 4S00A 3TOAA 1ZKGA 1G4DA 5E8IA 3F6OA 1LE8A 3Q0WA 2KDOA 2QVOA 3DU6A 2EV5A 1VZ0A 1PYVA 4FASD 3T0YA 4KIFA 4DW6A 4RBOA 2IS6A 3PKDA 1VNDA 1Y0UA 2EPFA 4LK1F 1T0FC 1WFXA 2GU5A 3JW4A 2E2IJ 3RI4A 1HC8A 1P92A 3BOQA 4PZJA 2OAZA 1IDYA 1RI7A 1R6RA 2X51A 2DFFA 5IOYA 9ANTA 4LIVA 4LG0A 1G3TA 2JPCA 4R60A 5K5RA 3MQ0A 4IHWA 3ABKH 3PNTA 3CCVI 4G7OF 3LSRA 3R61A 4ZDLA 4CCKA 2L7FP 2OBPA 4PJNA 2KT0A 3QPTA 2R7XA 2BHDA 3RPUD 4KA4A 1GHCA 3REOA 3N97A 1Y0NA 2JRMA 3I9V2 3R4KA 2JRTA 1W36D 2K9QA 1MBJA 4BACA 1KONA 3OR1C 4P55A 2IGOA 1VQNI 1MW7A 4RM2A 2DXIA 3GFJA 1L0OC 3RYPA 2VXZA 4PNCA 4H0EA 1ZREA 1KQ0A 5LRRA 1SD4A 3MWMA 2DN0A 3QPLA 4ZC3A 3A2KA 2QZ8A 3HHHA 4UV8A 1O7FA 5CJ9A 3S3OA 5FFZA 5LHIA 4W97A 1YRNA 4G7ZF 4XOPA 2GAUA 2RQQA 2R7WA 3MMYB 5BOXA 1B59A 2UZKA 3MKLA 2VC0A 1R1TA 1WH5A 5CKTA 1IN4A 3W6JB 1R71A 1A04A 2CWEA 1GT0C 2WAQN 4ENMA 4YFNF 1QA6A 2PX9A 3W3CA 2KP6A 2NQ6A 1H0MA 1LE8B 1JT6A 1SD5A 4F52A 3HPHA 2VASA 2JT1A 3JTHA 2O6GE 3KZYA 4O6JA 1EV7A 4UVAA 3MKWB 4XBFA 3W6KB 4PK4A 3PM1A 2V6CA 3R0AA 3X2QH 5BQTA 5GTHC 5F1RA 4RGRA 4UB8C 2QGUA 4LG0B 2OU2A 4U76A 2NS0A 3G71I 3BLYA 3DPTA 3L7GA 2HZDA 2LY9A 4P5OA 3CCJI 1Z3YA 3WG7H 3CC7I 5DDGA 4AM3A 1X3ZB 3ZMSA 1EJ9A 3WGHA 4XLCA 3ABLH 1NK2P 2CQNA 2FNAA 3BWGA 4OMYA 3OIOA 5J6XA 2RKHA 2XRLA 4CXFA 3U21A 5ERIA 3QWLA 2COBA 5B66C 1IN5A 1N75A 2NOJB 3CCYA 4EJWA 1BL0A 1BC7C 2DFHA 1L3LA 4P1WA 4RGZ1 3E97A 4EMSA 1Y6IA 1VI0A 2R93J 4S05A 1W4MA 4DGWB 4RMNA 2K3FA 4CCOA 3JR9A 4C2UA 5EGOA 4E7KA 1XTAA 1A35A 1P9QC 2WV1A 1H8AC 1E3OC 3V8JA 3PNYA 3ESWB 4HX7A 1B72A 3HDDA 4XL9A 5ILSA 4BY7J 4DZPA 2JJ7A 4I01A 3AG3H 1I3QJ 2HQ5A 2TRTA 2Q0OA 2WAQA 2XV4S 2ZSHB 1R1VA 4EJVA 1YVMA 5E17F 2P5KA 4ZWUA 1YLFA 1LFUP 3ABMH 5F1JA 1C27A 1I1SA 2FRHA 2CUJA 2GU4A 3VB2A 3PSIA 2R7UA 1QRYA 2KHMA 1SD7A 2COMA 2IW5A 2Z33A 2PLYA 3BIQA 1UB9A 1T56A 1WPKA 2VQCA 4FX0A 4IHXA 4G9YA 5GAGJ 1R00A 2X1CA 3F8BA 4BHPA 2F4OB 1FSHA 4RGXA 1MBEA 5A2QK 2V79A 3SFIA 5CVRA 2OUMA 1VQ5I 2CQQA 3ZMVA 3TO9A 1ETKA 1W7PA 2XAHA 3H3UA 5E79C 2RAEA 3FXOA 1LQ1A 1BR2A 1TWCJ 1ZK8A 1Z6RA 3LL7A 3HOVJ 1WI3A 3G1OA 2BY1A 1SFXA 2F5CA 3IUOA 1RPWA 1F4KA 1Z67A 2OCCH 4N4OB 1B6AA 1KYWA 4ESBA 1JKRC 2LFBA 2M0CA 2YX4A 5F64A 4II3A 3LQQA 4EGZA 1SC7A 1QQIA 2L0KA 3PFYA 1N77A 3BTLA 2HOTA 1B9MA 5CIKA 1B72B 1VQKI 1ZQ3P 1JJ6C 3DXJF 4AIKA 1IUFA 1N78A 3O3KA 3BPXA 1P7IA 3Q0VA 4XKVA 2IEKA 2K3PA 4C30A 4BDZA 3L9FA 2GG2A 1WH7A 1UAAA 3P5JA 1W7VA 3HZJA 1AHDP 5LEJA 1C21A 2KRFA 4A3MJ 1H89C 4BQAA 1TWAJ 4A5NA 4A6VA 1P4WA 5GPAA 2K7LA 3BC8A 2EZLA 3H5AA 4D7NA 1U3EM 4FE4A 4G94A 2BXYA 3G2BA 1SAXA 1USTA 5FGMA 3MFKA 3PSFA 5LD2C 3QYEA 4OIPF 3ELKA 1VQPI 2R7ZJ 4IU6A 1ZLKA 4PFPA 2MLGA 1BI2A 3IU9A 3MX6A 5HOOA 2KIMA 1FLIA 2F4MB 2NNNA 2ZSIB 1YJ3A 5E3LA 3PO2J 5FCFA 4NHJA 3TMOA 2VJ4A 4MEXF 3ZCOA 3U1KA 1KQ9A 3HHGA 2VIXA 2R5ZA 4ENJA 2RNJA 2BWXA 2VJ5A 2VLAA 4ON0A 1ZTRA 3OS2A 4KMFA 2BE5F 3CCLI 3IP4B 1P2FA 2JZYA 1A6QA 1YS7A 3DEWA 2XASA 1Y8QB 2OKNA 2A61A 4XLFA 1P7JA 3HRTA 3HOTA 4YRVA 2M7AA 3FXQA 1LVKA 4XLEA 1XS9A 4ZJZA 4I76A 5HS7A 4ABZA 1HLVA 2KIFA 4L9TA 3S1NJ 3ZMDA 5TGTA 2Q96A 4FLIA 1BIBA 3LSTA 4U87A 2JTVA 2QBYB 3JAMZ 6PAXA 1FT9A 2O5RA 4U88A 1K6OA 3BR0A 3PFIA 4I0BA 3A01B 5GADJ 2ID6A 4S2RP 3ZP5A 5F08A 4ZYHA 4ZZLA 2O0YA 2BN7A 2FMYA 2P6TA 4UV9A 4V2FA 1T2KA 3O6BB 1FWZA 2ZC2A 3ASNH 2HVSA 4JX5A 1UHMA 3BCAA 1OCOH 3VDXA 4Z6YA 1FP1D 4BJ6C 4ZDOA 5IT9Z 3BTIA 1WJ5A 2VXDA 3G73A 4IHSA 3W2VA 4XOTA 4ANJA 2OTJI 4HLYA 2R5ZB 3I54A 4F7ZA 1X3UA 1XC5A 3E6CC 1WJAA 4O3MA 2MC3A 1YHQI 3I71A 1SFOJ 2FE3A 1FEXA 2PI0A 1P6RA 1OYYA 2H8RA 4FLLA 2GZWA 3ZQLA 3DV8A 1HBXG 3JRHA 2MYSA 1OJLA 2KFDA 1ENHA 3TP0A 4MATA 4XLAA 1SD6A 4N9IA 3WE3A 3FX3A 5F0FA 3L2UA 5L3BA 4MIMA 5KVRA 1FOYA 1IRFA 1WJEA 1A31A 2BVMA 1BA5A 3M3YJ 2XPVA 2XGXA 2L9NA 2VPRA 3VFZA 1UFMA 1HSJA 2DK8A 5FO5A 3IRQA 4YEJA 1USSA 4KICA 4DQ2A 2CGPA 3NEUA 3J80Z 4N9HA 4UB6C 4DJAA 4GYIA 1XD7A 2L4AA 4LITA 4FO7A 3MEXA 1LEBA 2ZXHA 3OS1A 2IA2A 4U7DA 4M73A 2A07F 2E1MC 1ETVA 5J8FA 3B6AA 4BXFA 3JREA 4BY1J 1GV2A 2KIQA 4M9ZA 2M3AA 3O2PE 2DOAA 2Z1DA 2BHZA 1YOVB 2QCOA 3K2ZA 4D7MA 5DV5A 4J19A 1CF7A 4HOBA 1FX7A 2NAZA 2E71A 2WAEA 1WGXA 4DBRA 5E20A 3DP7A 1WRJA 1JHHA 5B5EC 5K5QA 3V8LA 3D5LA 5GTIC 2K5CA 5BMZA 4ZDPA 3ZMTA 2GOXB 1TQPA 1HQCA 3AL0B 1TWGJ 2HOEA 2B9SA 1QXWA 4Q48A 5ED4A 4EM2A 3DBRB 2EQRA 2XC7A 2IAIA 1CGPA 4FUKA 3GO5A 5F04A 3CCSI 3NAUA 3F3XA 2RQPA 3BJ6A 3S3MA 2LTPA 3RTRA 2JA5J 3PKCA 2OD5A 4ESFA 4L9JA 5HLIA 2YS9A 1JE8A 1G3YA 1JTXA 2ZJ2A 1H88C 1W7PD 3AKZA 2XAQA 3SZGA 2FU4A 5HDNA 1M1EB 1T33A 1R1UA 1LFBA 2E35A 1BJAA 4BE2A 1N25A 2A3SA 3BITA 3JRIA 1J5YA 4MTEA 1SMYF 3WU1B 2Y9ZA 2HQRA 2DOFA 1FYKA 1IXSB 3DEUA 4M71A 2VKEA 2LBFB 2IGNA 3OYHA 5BNGA 1I3AA 2XF7A 2PG4A 3GUDA 2QQ8A 3T1BA 2EVCA 4B28A 4GDFA 3OIQA 3RZDJ 3OWTA 3WTSC 1A6IA 1MBFA 3SEZA 4A3CJ 4IKUA 3KYLA 2Q94A 1OCCH 2LC2A 2E5NA 3ZRGA 2ZFUA 4LLGF 3J81K 1PJRA 1GLNA 1TW3A 2DJIA 3VSKA 2DFIA 5KAFC 4IJAA 4PGGA 2Q8KA 3A0HC 4M72A 1BN5A 2P6SA 4YIFA 4JQFA 3L24A 3HXLA 4DYCA 3ZQIA 4L0ZB 1RIOH 4AU7A 5CVUA 1P4XA 5H20A 3K1NA 2RGVA 3SEQA 1HF0A 3MZ8A 2O9LA 1W0UA 3TP3A 3JCUC 3HOYJ 2IT0A 5BPIA 2P8TA 4OAYA 2CRGA 4M3EA 1ZYRF 1XSVA 3LSJA 4PJLA 5H6RA 2GA1A 5D5VB 4Q5SF 3U2RA 2DA3A 2L2OA 2WB1N 2VJJA 3CO6C 3GMEA 4II2A 2DOEA 4M74A 3SFZA 2OC6A 2X85A 2ICWG 4IECA 4UXNA 3HM5A 2X6XA 2B3KA 2JVGA 2QENA 3FHNA 2HNHA 4A0YA 3LAPA 1GXQA 2V3YA 3VOEA 4OIRF 2EZKA 2NVUB 2MH9A 2K4BA 5GPCA 5HLGA 4R79A 2NVTJ 4D5CA 4CICA 2VODA 4YELA 3IL2A 3A0BC 4V2GA 1B9NA 2NOGA 2VL8A 4U0VA 1D5VA 5EEHA 2Q93A 1R9TJ 2DTZA 3T5XA 2LNBA 1ODDA 4BBRJ 3BG6A 1RUNA 4G12A 3JTGA 3CMEI 5D8KB 1T08B 4QWQA 3OYGA 4W1UA 1FBUA 2VT2A 2DT5A 1Y1VJ 3KYCB 2OA4A 3CTAA 4A5MA 2HGCA 4B3AA 2VBZA 5M3FJ 2XF5A 3BQZA 1EH8A 2NQ7A 2M30A 2YPRA 3ZQQA 4UUSA 2PJPA 2LF8A 2ZBKA 3N05A 5FLXZ 2VQGA 4C2TA 1DU6A 1X1AA 4LG3A 1DUXC 3BR2A 3BY6A 4XSXF 2FSWA 2VN2A 3BJAA 1C22A 2W84A 3PIPF 2E2JJ 4A12A 2MD5A 1LNWA 3BG3A 3GZ6A 2HYJA 1ACIA 4JP0A 1TC3C 2R7TA 2BV6A 4CYCA 4LJZF 3WTUC 4K2EA 2JVHA 4FLKA 1ZGAA 3F72A 3BTJA 4XMYA 3HTUA 1RESA 3HUGA 5HDGA 2VI6A 2V26A 5EEAA 2CUFA 2KJCA 2WB1A 3HSRA 4MFDA 3FXJA 1HW1A 3GW2A 5FRMA 1V55H 1R4MB 2GQQA 2I5UA 2LSOA 3FISA 4PSXA 2Y30A 4N4NB 4D9JA 3KX2A 1X3WB 1JGSA 3WTWC 4M3GA 3OYNA 3IU7A 3CJRB 1T6SA 4LGWA 4XLPF 1UHWA 2XSDC 2K40A 4UHTA 1YJNI 5CDLA 1YX5A 3A02A 4MFEA 2HOSA 1MATA 1Z05A 5HLHA 3S8PA 3HKZN 1IC8A 5JLXA 2DDBA 2EBIA 1O7LA 3M8EA 1MD0A 1HKQA 1QO0D 1X4PA 2W00A 1B8IA 3C3WA 4A3DJ 3ZQFA 3M1CA 4MNUA 4BE1A 2ADUA 2ECCA 4LFUA 1EF4A 1IW7F 1WJFA 1UELB 2JPBA 3IG4A 2LMDA 5B3SH 3GFLA 5HNFA 4L9VA 1OR7A 1W0TA 3KFWX 2CV1A 2V1UA 3ZPLA 3FM3A 1E0EA 4KDPA 3L1PA 5TISC 1DU0A 3LA2A 4M9SA 4F55A 4UUSB 5K7HA 3ZOBA 1JTYA 3FK7A 3ML6A 4HSTA 1MKMA 3PQJA 1PVEA 2C6YA 4EGYA 2VC1A 3LNQA 4LB6B 2AS5F 2HWVA 1DDNA 4E7HA 1V5EA 4O5VA 3F22A 4BKXA 1XCVA 3SZPA 1ZG5A 2Z3YA 1WY2A 4B44A 3HYIA 4DZJA 1HOMA 3D5RC 2R7QA 1REPC 3HUGB 2EA4A 3TGNA 1K6YA 3RSNA 4A6WA 1T8IA 1D8KA 2ELJA 3DPLC 5ICEA 5H6QA 5L3DA 5FB2A 3GTQJ 1FIAA 2ZNZA
chains in the Genus database with same CATH topology
1VTNC 5ICFA 3I64A 4WK8F 3GX4X 3Q9SA 3FM5A 1PP8F 3CTZA 4G6DA 5LBQA 1OYWA 1H9GA 1WL6A 2V1DA 4AD9A 1MJBA 3LA7A 4ETSA 4MGRA 2VBYA 4AIJA 3BJOA 2K02A 2QYOA 1N51A 1KYZA 5L3CA 3WG9A 2VOOA 3EYIA 1KGSA 4B09A 4ZWOA 2FBIA 2XAGA 2DPUA 4U6JA 2LKPA 3WTYC 3C1DA 2FOKA 3P9CA 2Q92A 3FF5A 5E1WA 5EEGA 3FXUA 4OINF 3GLXA 4PGHA 2QQ9A 5E8GA 1QZYA 3RKYA 3PQKA 4ZNGA 3MAJA 3H3ZA 1LEAA 2G6PA 2XROA 2A68F 2BWVA 3ERED 4I7HA 4DNCA 4HX4A 3CO7C 3QU6A 3ABTA 1SFEA 3FMRA 4L9NA 4IRHA 3NRVA 4ZH4F 3NQOA 3K0LA 2DO7A 1QNTA 2E7WA 1I27A 5E5BA 2HYGD 4RAYA 3VEPA 1P4AA 3KLNA 5CYVA 1TNTA 2V9VA 4N0BA 4CO8A 4WXDA 2BYVE 2GGBA 3V7CA 4KIGA 2RV8A 4KYWA 1U6GA 2Y0MA 1YG2A 4RB0A 4I2OA 5DEQA 3TQNA 2BWWA 2GZ5A 3KP4A 4U69A 2EB7A 1BBYA 5L3EA 1IN8A 1KQ8A 1FY7A 4MQ9F 5LHGA 3J7AO 2HDCA 2M87A 1RZ4A 2A6EF 1QXYA 1U5TC 3CUOA 2W24A 5LRSA 3DFGA 5DD8A 4U75A 2EJRA 2HS5A 2ELHA 3QAHA 5DCMA 1ZG3A 5FD5A 4HF2A 5K5OA 3IWZA 4FHTA 3QU3A 2PMHA 4KMUX 3ZMUA 4A2UA 4EM0B 1ZLJA 3I0TA 1J59A 2ZKZA 4R8HA 1B4AA 3T8TA 4HQMA 3C18A 4NQWA 5AONA 3I5UA 2DK5A 1QXZA 2WV0A 2KIUA 2CG4A 2IA0A 2P7VB 3HRMA 1AOYA 2K4JA 1FSEA 1O3QA 1KU3A 1C24A 3P7NA 1NHAA 4HYEA 2EFNA 2B0LA 2IJLA 4Y17A 1HKSA 2MH2A 4ASNA 4BHCA 3Q5FA 2PMUA 4E70A 1I5ZA 5LGUA 2EK5A 2STTA 2VONA 4U71A 1JAWA 4JK1X 1ZARA 2GG9A 1W7PB 2XHKA 1FYLA 3H92A 5TJJA 2ZNYA 3CB6A 2H6BA 4CGZA 3P9KA 2FBHA 3AAFA 2BHAA 1QBJA 1S7OA 4KIBA 2Y75A 1O3RA 2H6CA 4Q4ZF 2HR3A 4OMZA 2CW0F 5DCMB 2NRAC 3ZQ7A 3F8CA 3KP3A 1HW2A 3KZZA 5BS6A 1T98A 4P9FA 4RB3C 2L02A 2P98A 4G8XA 1STZA 1BOAA 3TB5A 1E2XA 3V7RA 2DU9A 1U2WA 1WL9A 4IKTA 1O3SA 3ULQB 5JFRA 4I98B 4P96A 3WTTC 1QGPA 3FZVA 4CZZA 2GGCA 3MCZA 2WC2A 2CQKA 5TRDA 4OOIA 4HA8A 3I4PA 3DQVC 5L3FA 1TBXA 1Z7UA 3HIFA 2L4MA 3TO7A 2XRNA 4GO1A 4HF1A 1S3JA 3FWEA 2M45A 1YQAA 4UVBA 3ROUA 3K1MA 2GTXA 4RAZA 3V7SA 4BYYA 1LDKB 4IF4A 3RIRA 1TNSA 3GYHX 1Z91A 2ZO4A 1TTYA 3IWFA 1F1ZA 4HW0A 2FXAA 1GVJA 4AIHA 4KM3A 3CUQA 3V8KA 1Q1HA 2Z5UA 2QLZA 3F21A 5JI6A 1ZGJA 1FBQA 1C0WA 3MZYA 1J0RA 3QOPA 3SHFA 3GFIA 4L18B 5CDEA 2HQNA 5ILVA 2Z9OA 2X0LA 4KN7X 1Z1DA 2XVCA 3IKVA 3RPQA 4Z7MA 3CLOA 4EVIA 3I59A 2ZMEA 4WCGA 1D8JA 1C23A 4ZZDA 5DUKA 3CUQC 3BDDA 1ONVA 4XRFA 2XUBA 3F8FA 5JR3A 2RC4A 3GFMA 1Z6TA 2IRFG 1I1GA 4P9UA 1MGTA 4HXXA 3QP5A 4FT8A 3L09A 3I53A 4IRIA 2GU6A 2P5VA 1HSTA 1R5GA 2F5DA 2O03A 1H9TA 4MTDA 2K86A 2R7DA 3ECHA 1Y1NA 2CSOA 2GXGA 3S2WA 2ISYA 2BGCA 2QWWA 1XGMA 3LQRA 2DPDA 1YW9A 3U1DA 4U6CA 1R7JA 3JSPA 5ICGA 5D5UB 5LGNA 4S04A 3LFKA 1G3WA 3EETA 4OU0A 5D6EA 3WTVC 1CF7B 4ZWPA 4Z2YA 2O3FA 1GXPA 2GWRA 3FXRA 1F5TA 2X4HA 3IC7A 1ON2A 1MZBA 4JUQA 1IXCA 4G6QA 2YU3A 2DAOA 4L0YB 3L2CA 4EGEA 2A6HF 2FMLA 4GGGA 2O8XA 1PV9A 2HZTA 3C7JA 4KN4X 2FBKA 2UXNA 2IW2A 4Y15A 1R23A 2ETHA 1S7AA 3T8RA 2D2WA 2BWYA 3WGGA 2HKXA 1HW5A 4OOKA 2R7FA 3QP6A 2Q2EA 1O0XA 3F8MA 3M1EA 1G6NA 5L3GA 2ZCWA 1XGNA 2UXXA 4ESJA 4I09A 1XDUA 2IP2A 3RYRA 4UNOA 2KKOA 4IVNA 3KLOA 1DPRA 4I02A 5A2QZ 2GG7A 3U9GA 4OIOF 4IXAA 2G7UA 4HX8A 1F9NA 1QPMA 2D1VA 4PV4A 3KEQA 1XN7A 2B3LA 3K9TA 2EFQA 4RZYA 3SXYA 3L7WA 2FNPA 5DCFA 5BPDA 3EDPA 3HRUA 1BM9A 4HV6A 2BBYA 2F2EA 5IT9K 2AXLA 2VE8A 2HTSA 4L5IA 1V4RA 2A5YB 2P5LC 3R0JA 2EV6A 3IHUA 4U1BA 3TDZC 4IDYA 2EFPA 2Y48A 4KT5C 2GXBA 3RKXA 3V4GA 1FPQA 4U7BA 1LJ9A 3TKYA 2CYYA 4RGSA 4OIQF 4MQVA 5CLSA 3F6VA 3EYYA 4YG2F 2A69F 1J9IA 1YIOA 2P4WA 3B73A 1XMKA 3J80K 3VODA 2PN6A 1U78A 1R22A 3LWFA 1RUOA 4FO8A 4MEYF 1FNNA 3IKTA 4YFXF 1TQIA 1S8NA 4AVPA 2O61A 4HZFA 4GXOA 2L01A 1WN1A 4Y13A 4FLJA 4GCVA 3P9IA 2GU7A 1IF1A 5KK1A 1K79A 2MA3A 5CVJA 1XSDA 2HOWA 2VT3A 2W57A 3E3VA 3HSEA 5ILUA 2NNYA 3FMSA 2HEOA 1SMTA 1IAWA 4CDGA 3EQLF 4RGUA 4BXUA 2BWUA 4FKCA 3GEZA 4WX9A 3ECOA 1YO5C 4XLNF 3D27A 2VE9A 1W5SA 2XKPA 2DQRA 5D5WB 3HOSA 1EH6A 1MDMA 4U73A 3DKWA 2PEXA 5HS8A 2FQ3A 2OQRA 1KU7A 2EFOA 4TV7A 3COAC 5JHUA 2E7XA 3PKBA 2EVOA 3D0SA 2FF4A 4BNCA 3OOPA 1BI1A 4M6YA 5CDVA 4UUVA 2J5OA 2DI3A 2PBIA 1T39A 4ZYGA 1OYIA 1WLRA 5CE6A 4JBAA 5HVQC 1G3SA 5AIQA 2D45A 4U6EA 1IRGA 4U6ZA 1KA8A 1J75A 4XSZF 3EUHA 2HTJA 2D1HA 1U5TA 2F5EA 1CHMA 4M6XA 2OZUA 2W25A 1LDDA 1IUYA 1MDMB 4QR8A 4ENNA 1FBSA 5FFXA 3KETA 3RKWA 1SFUA 1PDNC 1DPUA 3FMQA 4A0XA 3RDIA 4RB1A 4BH9A 2QQAA 3ABUA 1LB2A 5E1ZB 2Q95A 2DTRA 2EVMA 5K1YA 2HYFA 5FLXK 2MATA 1S6LA 2NYXA 3WTXC 4CHUA 3LAJA 1OKRA 1W2MA 4BAYA 1IXRC 2ESHA 3M9AA 3J81Z 1U5TB 4WXHA 4R1HA 4KUMA 2IPQX 2XAFA 4S01A 3I58A 4RB2C 3GF2A 1DP7P 4U6WA 2IA1A 4HQEA 5DYMA 1ULYA 1S29A 4WWCA 3F8NA 2QBYA 2QQBA 3TDUC 2M5WA 3JSOA 2YX7A 3BROA 1V3FA 1TQMA 3GVAA 4IPAA 3IRRA 4U0WA 4S2TP 3GXOA 5LHHA 4Q47A 1XB4A 4A6DA 1D3YA 1JHFA 4LLLA 4EQQA 1R36A 2EWNA 1XMAA 2IVMA 2WTEA 3DF8A 1TLHB 2BEOA 3PKAA 4B8XA 2CFXA 2R3SA 1ZN2A 4EV0A 1XGOA 4EJUA 3RJPA 1KU9A 1AWCA 3ZMZA 2JSCA 4RZZA 2VBWA 1YYVA 2DW4A 3KP5A 2GA2A 3ZN0A 3BZ6A 3MATA 3KP6A 3WODF 5D6FA 1WBQA 2STWA 1FP2A 1O57A 2EFWA 1XSXA 5DUIA 4HV5A 2HKOA 4IF7A 1YS6A 3HSFA 3ISPA 4IKSA 5CVVA 3BIPA 2ZSGA 5F6FA 3M7GA 3OV8A 2PFBA 3BP8A 4HF0A 2W85A 5DD4A 5CVIA 4LK0F 4LD5A 3IU8A 2ZXJA 4PDKA 3LA3A 1U8RA 3KCCA 1LVAA 2FA5A 3E5UA 4HDVA 2F5FA 3FHZA 4EM1A 3Q9VA 2BHBA 4UVCA 4U0YA 2ISZA 5ICCA 3R6SA 3KEOA 3QPHA 3E5QA 1WKMA 2E1CA 3TOBA 1KU2A 1XCBA 5LGTA 1HKTA 1YW7A 3KP7A 4QLCU 4G7HF 1PP7U 2L3DA 1K78A 3K69A 4ZYDA 2LF7A 3E6DA 2XKOA 4L5JA 4WF2A 2B3HA 3KE2A 4M9XA 2EV0A 1BI0A 3BPVA 2ESNA 2P7CB 2BB7A 3L00A 1ZRCA 1O3TA 3CUQB 3RPUA 2Z99A 1ZRFA 3K1PA 2VBXA 1QZZA 4IHTA 1FYMA 1IN6A 4LMYA 1XDSA 1IZ1A 1ZG1A 1HXDA 3N4MA 2K27A 2DBBA 2VOPA 3TAVA 2OQGA 1B1BA 2MBFA 4RS8A 3QRFF 5LEKA 2P99A 4BHBA 4IKRA 5FCHA 2ZFWA 2P9AA 4HAMA 2H94A 2XIGA 2V3ZA 4IRGA 3TO6A 4FX4A 5E18F 2V1XA 3I59B 1WQ2A 2ZMEB 1MJAA 3WU0A 3R60A 4LLNA 3CB5A 1XGSA 1K78B 3GZ5A 3G3ZA 1J7KA 5CNXA 2BWTA 2H27A 2UWMA 1R5HA 1W5TA 1YFHA 4GYGA 2QM3A 4YIIA 1XNZA 1WI9A 4D0PA 2GG8A 4CYDA 2M1BA 2GG5A 2J5PA 1R58A 1UCRA 3SZTA 2GG0A 4U70A 1OMIA 1YTYA 5JVTA 1LDJA 5FD6A 1ZAOA 1OPCA 4WXCA 3CJNA 3Q6DA 2V3XA 4NB5A 2GG3A 2BH3A 1BC8C 3HTSB 2H09A 4A6EA 1MJ9A 2OZ6A 2XAJA 1WSUA 2LDUA 3WGIA 1ZH5A 2ACJA 4ZYEA 3MZHA 1RNLA 1EH7A 3WTZA 4HBLA 3HRSA 4HLXA 3F23A 4EJOA 3RVAA 1A16A 2DLLA 2E1NA 3MR1A 5AIPA 2YSRA 4AWXB 2RDPA 1BIAA 2HFHA 5D4SA 2BHCA 2CO5A 5HS9A 5D4RA 2PQ8A 2QUFA 4EJTA 4PCQA 4YFKF 3JAMK 2G7HA 1TW2A 3E6BA 2RN7A 2BWSA 1YW8A 1PUEE 3E6MA 1WWXA 5IT3A 5J8CA 1KP0A 3WE2A 3ZN1A 2RVCA 3S6BA 2L54A 1FOKA 5D8LB 2YR2A 3PKEA 1JXSA 1T38A 1I6XA 2G9WA 1J2XA 1M35A 3GWZA 4MHGA 1ZHFA 1E17A 3CDHA 1BI3A 3E5XA 3KP2A 2FEZA 1T0FA 4LB5A 2M8EA 1ZRDA 1ON1A 4A0ZA 2MLKA 2EA2A 1FZPB 2DQLA 2GIVA 1FC3A 4ENKA 5LLQA 3SQNA 2KJBA 1Z9CA 4HDUA 4KNYA 5D5XB 4KFCA 2TDXA 1K7AA 4I0AA 3B02A 2WWYA 3M8FA 1IN7A 5HDKA 3RORA 5E1XA 4S00A 3TOAA 1G4DA 5E8IA 3F6OA 2QVOA 2EV5A 3T0YA 4KIFA 3PKDA 1Y0UA 4LK1F 2GU5A 3JW4A 3RI4A 1P92A 3BOQA 4PZJA 2OAZA 1RI7A 4LG0A 1G3TA 2JPCA 4R60A 5K5RA 3MQ0A 4G7OF 3R61A 2OBPA 3QPTA 2BHDA 1GHCA 4KA4A 3REOA 3N97A 3R4KA 2JRTA 4P55A 3GFJA 1L0OC 3RYPA 2VXZA 4PNCA 4H0EA 1ZREA 1KQ0A 5LRRA 1SD4A 3MWMA 2QZ8A 3HHHA 4UV8A 1O7FA 5CJ9A 5FFZA 5LHIA 4G7ZF 2GAUA 5BOXA 1B59A 2UZKA 2VC0A 1R1TA 1IN4A 3W6JB 1A04A 2CWEA 4ENMA 4YFNF 2NQ6A 1H0MA 1SD5A 2JT1A 3JTHA 2O6GE 3KZYA 4O6JA 1EV7A 4UVAA 4XBFA 3W6KB 2V6CA 3R0AA 5BQTA 5F1RA 4RGRA 4LG0B 4U76A 2OU2A 2NS0A 3L7GA 3DPTA 4P5OA 5DDGA 3ZMSA 3WGHA 2FNAA 3BWGA 4OMYA 5J6XA 2RKHA 4CXFA 5ERIA 1IN5A 4EJWA 1BC7C 1L3LA 4RGZ1 3E97A 4EMSA 4S05A 1W4MA 3V8JA 4HX7A 5ILSA 4I01A 2Q0OA 2XV4S 1R1VA 4EJVA 1YVMA 5E17F 2P5KA 4ZWUA 1YLFA 1C27A 1I1SA 2FRHA 2GU4A 3VB2A 1SD7A 2COMA 2IW5A 2Z33A 2PLYA 3BIQA 1UB9A 4FX0A 4G9YA 1R00A 3F8BA 4BHPA 1FSHA 4RGXA 5A2QK 2V79A 5CVRA 3ZMVA 3TO9A 1W7PA 2XAHA 3H3UA 1LQ1A 1Z6RA 1SFXA 2F5CA 1F4KA 1B6AA 1KYWA 4ESBA 2YX4A 5F64A 3LQQA 4EGZA 1QQIA 1B9MA 5CIKA 3DXJF 4AIKA 3O3KA 3BPXA 3L9FA 2GG2A 1W7VA 5LEJA 1C21A 2KRFA 4BQAA 4A5NA 4A6VA 1P4WA 2K7LA 1U3EM 4G94A 1SAXA 1USTA 5FGMA 3MFKA 4OIPF 3ELKA 4IU6A 1ZLKA 2MLGA 1BI2A 3IU9A 3MX6A 5HOOA 2KIMA 1FLIA 2NNNA 1YJ3A 5FCFA 4NHJA 4MEXF 1KQ9A 3HHGA 4ENJA 2RNJA 2BWXA 4ON0A 4KMFA 2BE5F 1P2FA 2JZYA 1YS7A 2XASA 2OKNA 2A61A 3HRTA 3HOTA 3FXQA 5HS7A 2KIFA 4L9TA 3ZMDA 2Q96A 4FLIA 1BIBA 3LSTA 2JTVA 2QBYB 3JAMZ 6PAXA 1FT9A 4U88A 1K6OA 3PFIA 4I0BA 4S2RP 3ZP5A 4ZYHA 4ZZLA 2O0YA 2BN7A 2FMYA 2P6TA 4UV9A 1T2KA 3O6BB 1FWZA 1UHMA 1FP1D 5IT9Z 3G73A 4IHSA 4HLYA 3I54A 4F7ZA 1X3UA 3E6CC 4O3MA 2MC3A 3I71A 2FE3A 2PI0A 1P6RA 1OYYA 4FLLA 2GZWA 3DV8A 1HBXG 4MATA 1SD6A 4N9IA 3WE3A 3FX3A 5L3BA 5KVRA 1IRFA 2XGXA 3VFZA 1UFMA 1HSJA 2DK8A 5FO5A 3IRQA 1USSA 4DQ2A 4KICA 2CGPA 3NEUA 3J80Z 4N9HA 4GYIA 1XD7A 2L4AA 4FO7A 3MEXA 1LEBA 2IA2A 4U7DA 4M73A 2A07F 5J8FA 4M9ZA 3O2PE 3K2ZA 5DV5A 1CF7A 4HOBA 1FX7A 2NAZA 5E20A 3DP7A 1WRJA 1JHHA 5K5QA 3V8LA 3D5LA 5BMZA 3ZMTA 1TQPA 1HQCA 2HOEA 1QXWA 4Q48A 5ED4A 4EM2A 1CGPA 4FUKA 3GO5A 3F3XA 2RQPA 3BJ6A 3RTRA 3PKCA 2OD5A 4ESFA 4L9JA 5HLIA 1JE8A 1G3YA 2ZJ2A 1W7PD 2XAQA 2FU4A 5HDNA 1R1UA 1BJAA 2A3SA 3BITA 1J5YA 4MTEA 1SMYF 3WU1B 2HQRA 1FYKA 1IXSB 3DEUA 4M71A 2PG4A 3GUDA 3T1BA 4B28A 2EVCA 3WTSC 4IKUA 2Q94A 4LLGF 3J81K 1TW3A 2DFIA 4IJAA 4PGGA 2Q8KA 4M72A 1BN5A 2P6SA 4YIFA 4JQFA 3L24A 4L0ZB 1RIOH 5CVUA 1P4XA 5H20A 3K1NA 2RGVA 2IT0A 5BPIA 2P8TA 1ZYRF 1XSVA 5H6RA 2GA1A 5D5VB 4Q5SF 3U2RA 3CO6C 4M74A 3SFZA 4IECA 4UXNA 2B3KA 2QENA 4A0YA 3LAPA 1GXQA 2V3YA 3VOEA 4OIRF 2MH9A 2K4BA 5HLGA 4R79A 4CICA 2VODA 3IL2A 1B9NA 4U0VA 1D5VA 5EEHA 2Q93A 3T5XA 2LNBA 1ODDA 1RUNA 3JTGA 5D8KB 4QWQA 1FBUA 2VT2A 2DT5A 2OA4A 3CTAA 4A5MA 2HGCA 2VBZA 1EH8A 2NQ7A 2M30A 2YPRA 2PJPA 2LF8A 2ZBKA 5FLXZ 1DUXC 3BY6A 4XSXF 2FSWA 2VN2A 3BJAA 1C22A 2W84A 4A12A 2MD5A 1LNWA 3GZ6A 2BV6A 4LJZF 3WTUC 4K2EA 4FLKA 1ZGAA 3F72A 3HTUA 3HUGA 5HDGA 2KJCA 3HSRA 1HW1A 3GW2A 2GQQA 2LSOA 1JGSA 3WTWC 3IU7A 1T6SA 4LGWA 4XLPF 1UHWA 4UHTA 5CDLA 1MATA 1Z05A 5HLHA 1O7LA 3M8EA 1MD0A 1HKQA 1QO0D 3C3WA 4MNUA 2ADUA 4LFUA 1IW7F 2JPBA 3IG4A 3GFLA 4L9VA 1OR7A 3KFWX 2V1UA 3ZPLA 3FM3A 4KDPA 3LA2A 4M9SA 3ML6A 1MKMA 3PQJA 2C6YA 4EGYA 2VC1A 4LB6B 2AS5F 2HWVA 1DDNA 4O5VA 3F22A 1XCVA 3SZPA 1ZG5A 2Z3YA 1WY2A 3HYIA 1REPC 2EA4A 3TGNA 4A6WA 1D8KA 3DPLC 5ICEA 5H6QA 5L3DA 5FB2A