2GG8A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 88
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg8A00
4R60A 3L24A 4A6WA 2BWWA 2BWTA 3FMRA 2V3ZA 5CNXA 4U6WA 2GA2A 3MATA 2BWUA 2GZ5A 2Q95A 4Z7MA 2DFIA 4U70A 4FUKA 2ZSGA 2GG2A 4MATA 2B3KA 2Q8KA 1C24A 4FLIA 5JFRA 2OKNA 3PKCA 3MX6A 3CB5A 1Y1NA 2GG0A 1KQ9A 2ADUA 2BN7A 2P98A 1WLRA 4IDYA 4U6CA 2V3XA 5JI6A 2B3HA 3IU7A 1N51A 2GGCA 4IKSA 2NQ6A 2GG7A 1C22A 5CDEA 4FLJA 4ZWUA 2EA4A 2V6CA 1C21A 3IU8A 3RORA 2Q94A 1WY2A 4U76A 5JHUA 4S2RP 2GU6A 2BWVA 1A16A 3TB5A 2P99A 4U71A 1JAWA 2BH3A 2OAZA 4IKRA 1R5HA 1QXWA 4HXXA 4FLKA 4IPAA 1KQ0A 4ZWOA 1YW8A 2GG9A 2GG8A 2HOWA 3Q6DA 1WBQA 4RZYA 2EA2A 3RVAA 1WN1A 1YW9A 4RZZA 4U73A 2MATA 5FCFA 1WL6A 2BWSA 1B6AA 2BHCA 4B28A 5CDVA 4S00A 1QXYA 3PKAA 3S6BA 1MATA 4ZNGA 2BWXA 1YW7A 4ZWPA 4FO8A 2BB7A 4PNCA 1WL9A 3D27A 2GG5A 1C23A 2GU7A 3IG4A 4FLLA 4U6ZA 2V3YA 1R58A 3CTZA 4IF7A 5D6FA 3BIPA 4U69A 1W7VA 3CB6A 4IKTA 5CDLA 1CHMA 1XGSA 1W2MA 1C27A 2GTXA 5CIKA 2EVOA 4U6EA 4U6JA 3PKDA 3TAVA 1B59A 4IU6A 4IECA 2Q92A 4JUQA 3IU9A 1YVMA 5CLSA 5D6EA 5CE6A 1XNZA 5FCHA 2EVCA 4U1BA 3FM3A 2BWYA 2B3LA 2IW2A 5E5BA 4A6VA 2BHBA 2G6PA 4S2TP 3BITA 4IKUA 3PKEA 1XGOA 4U75A 1XGMA 3MR1A 4RGZ1 3FMQA 2P9AA 1M35A 2GGBA 3PKBA 1R5GA 4PV4A 4EGEA 2Q93A 1WKMA 4FO7A 4QR8A 1QZYA 1PV9A 3BIQA 1O0XA 1XGNA 2Q96A 4KM3A 1BN5A 1KP0A 1QXZA 1YJ3A 2GU5A 1BOAA 4FKCA 4OOKA 2EVMA 2GU4A 2NQ7A 2BHDA 2GG3A 4S01A 3L7GA 2BHAA
chains in the Genus database with same CATH superfamily
4R60A 3L24A 4A6WA 2BWWA 2BWTA 3FMRA 2V3ZA 5CNXA 4U6WA 2GA2A 3MATA 2BWUA 2GZ5A 2Q95A 4Z7MA 2DFIA 4U70A 4FUKA 2ZSGA 2GG2A 4MATA 2B3KA 2Q8KA 1C24A 4FLIA 5JFRA 2OKNA 3PKCA 3MX6A 3CB5A 1Y1NA 2GG0A 1KQ9A 2ADUA 2BN7A 2P98A 1WLRA 4IDYA 4U6CA 2V3XA 5JI6A 2B3HA 3IU7A 1N51A 2GGCA 4IKSA 2NQ6A 2GG7A 1C22A 5CDEA 4FLJA 4ZWUA 2EA4A 2V6CA 1C21A 3IU8A 3RORA 2Q94A 1WY2A 4U76A 5JHUA 4S2RP 2GU6A 2BWVA 1A16A 3TB5A 2P99A 4U71A 1JAWA 2BH3A 2OAZA 4IKRA 1R5HA 1QXWA 4HXXA 4FLKA 4IPAA 1KQ0A 4ZWOA 1YW8A 2GG9A 2GG8A 2HOWA 3Q6DA 1WBQA 4RZYA 2EA2A 3RVAA 1WN1A 1YW9A 4RZZA 4U73A 2MATA 5FCFA 1WL6A 2BWSA 1B6AA 2BHCA 4B28A 5CDVA 4S00A 1QXYA 3PKAA 3S6BA 1MATA 4ZNGA 2BWXA 1YW7A 4ZWPA 4FO8A 2BB7A 4PNCA 1WL9A 3D27A 2GG5A 1C23A 2GU7A 3IG4A 4FLLA 4U6ZA 2V3YA 1R58A 3CTZA 4IF7A 5D6FA 3BIPA 4U69A 1W7VA 3CB6A 4IKTA 5CDLA 1CHMA 1XGSA 1W2MA 1C27A 2GTXA 5CIKA 2EVOA 4U6EA 4U6JA 3PKDA 3TAVA 1B59A 4IU6A 4IECA 2Q92A 4JUQA 3IU9A 1YVMA 5CLSA 5D6EA 5CE6A 1XNZA 5FCHA 2EVCA 4U1BA 3FM3A 2BWYA 2B3LA 2IW2A 5E5BA 4A6VA 2BHBA 2G6PA 4S2TP 3BITA 4IKUA 3PKEA 1XGOA 4U75A 1XGMA 3MR1A 4RGZ1 3FMQA 2P9AA 1M35A 2GGBA 3PKBA 1R5GA 4PV4A 4EGEA 2Q93A 1WKMA 4FO7A 4QR8A 1QZYA 1PV9A 3BIQA 1O0XA 1XGNA 2Q96A 4KM3A 1BN5A 1KP0A 1QXZA 1YJ3A 2GU5A 1BOAA 4FKCA 4OOKA 2EVMA 2GU4A 2NQ7A 2BHDA 2GG3A 4S01A 3L7GA 2BHAA
chains in the Genus database with same CATH topology
4R60A 3L24A 4A6WA 2BWWA 2BWTA 3FMRA 2V3ZA 5CNXA 4U6WA 2GA2A 3MATA 2BWUA 2GZ5A 2Q95A 4Z7MA 2DFIA 4U70A 4FUKA 2ZSGA 2GG2A 4MATA 2B3KA 2Q8KA 1C24A 4FLIA 5JFRA 2OKNA 3PKCA 3MX6A 3CB5A 1Y1NA 2GG0A 1KQ9A 2ADUA 2BN7A 2P98A 1WLRA 4IDYA 4U6CA 2V3XA 5JI6A 2B3HA 3IU7A 1N51A 2GGCA 4IKSA 2NQ6A 2GG7A 1C22A 5CDEA 4FLJA 4ZWUA 2EA4A 2V6CA 1C21A 3IU8A 3RORA 2Q94A 1WY2A 4U76A 5JHUA 4S2RP 2GU6A 2BWVA 1A16A 3TB5A 2P99A 4U71A 1JAWA 2BH3A 2OAZA 4IKRA 1R5HA 1QXWA 4HXXA 4FLKA 4IPAA 1KQ0A 4ZWOA 1YW8A 2GG9A 2GG8A 2HOWA 3Q6DA 1WBQA 4RZYA 2EA2A 3RVAA 1WN1A 1YW9A 4RZZA 4U73A 2MATA 5FCFA 1WL6A 2BWSA 1B6AA 2BHCA 4B28A 5CDVA 4S00A 1QXYA 3PKAA 3S6BA 1MATA 4ZNGA 2BWXA 1YW7A 4ZWPA 4FO8A 2BB7A 4PNCA 1WL9A 3D27A 2GG5A 1C23A 2GU7A 3IG4A 4FLLA 4U6ZA 2V3YA 1R58A 3CTZA 4IF7A 5D6FA 3BIPA 4U69A 1W7VA 3CB6A 4IKTA 5CDLA 1CHMA 1XGSA 1W2MA 1C27A 2GTXA 5CIKA 2EVOA 4U6EA 4U6JA 3PKDA 3TAVA 1B59A 4IU6A 4IECA 2Q92A 4JUQA 3IU9A 1YVMA 5CLSA 5D6EA 5CE6A 1XNZA 5FCHA 2EVCA 4U1BA 3FM3A 2BWYA 2B3LA 2IW2A 5E5BA 4A6VA 2BHBA 2G6PA 4S2TP 3BITA 4IKUA 3PKEA 1XGOA 4U75A 1XGMA 3MR1A 4RGZ1 3FMQA 2P9AA 1M35A 2GGBA 3PKBA 1R5GA 4PV4A 4EGEA 2Q93A 1WKMA 4FO7A 4QR8A 1QZYA 1PV9A 3BIQA 1O0XA 1XGNA 2Q96A 4KM3A 1BN5A 1KP0A 1QXZA 1YJ3A 2GU5A 1BOAA 4FKCA 4OOKA 2EVMA 2GU4A 2NQ7A 2BHDA 2GG3A 4S01A 3L7GA 2BHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R60 A;  3L24 A;  4A6W A;  2BWW A;  2BWT A;  3FMR A;  2V3Z A;  5CNX A;  4U6W A;  2GA2 A;  3MAT A;  2BWU A;  2GZ5 A;  2Q95 A;  4Z7M A;  2DFI A;  4U70 A;  4FUK A;  2ZSG A;  2GG2 A;  4MAT A;  2B3K A;  2Q8K A;  1C24 A;  4FLI A;  5JFR A;  2OKN A;  3PKC A;  3MX6 A;  3CB5 A;  1Y1N A;  2GG0 A;  1KQ9 A;  2ADU A;  2BN7 A;  2P98 A;  1WLR A;  4IDY A;  4U6C A;  2V3X A;  5JI6 A;  2B3H A;  3IU7 A;  1N51 A;  2GGC A;  4IKS A;  2NQ6 A;  2GG7 A;  1C22 A;  5CDE A;  4FLJ A;  4ZWU A;  2EA4 A;  2V6C A;  1C21 A;  3IU8 A;  3ROR A;  2Q94 A;  1WY2 A;  4U76 A;  5JHU A;  4S2R P;  2GU6 A;  2BWV A;  1A16 A;  3TB5 A;  2P99 A;  4U71 A;  1JAW A;  2BH3 A;  2OAZ A;  4IKR A;  1R5H A;  1QXW A;  4HXX A;  4FLK A;  4IPA A;  1KQ0 A;  4ZWO A;  1YW8 A;  2GG9 A;  2GG8 A;  2HOW A;  3Q6D A;  1WBQ A;  4RZY A;  2EA2 A;  3RVA A;  1WN1 A;  1YW9 A;  4RZZ A;  4U73 A;  2MAT A;  5FCF A;  1WL6 A;  2BWS A;  1B6A A;  2BHC A;  4B28 A;  5CDV A;  4S00 A;  1QXY A;  3PKA A;  3S6B A;  1MAT A;  4ZNG A;  2BWX A;  1YW7 A;  4ZWP A;  4FO8 A;  2BB7 A;  4PNC A;  1WL9 A;  3D27 A;  2GG5 A;  1C23 A;  2GU7 A;  3IG4 A;  4FLL A;  4U6Z A;  2V3Y A;  1R58 A;  3CTZ A;  4IF7 A;  5D6F A;  3BIP A;  4U69 A;  1W7V A;  3CB6 A;  4IKT A;  5CDL A;  1CHM A;  1XGS A;  1W2M A;  1C27 A;  2GTX A;  5CIK A;  2EVO A;  4U6E A;  4U6J A;  3PKD A;  3TAV A;  1B59 A;  4IU6 A;  4IEC A;  2Q92 A;  4JUQ A;  3IU9 A;  1YVM A;  5CLS A;  5D6E A;  5CE6 A;  1XNZ A;  5FCH A;  2EVC A;  4U1B A;  3FM3 A;  2BWY A;  2B3L A;  2IW2 A;  5E5B A;  4A6V A;  2BHB A;  2G6P A;  4S2T P;  3BIT A;  4IKU A;  3PKE A;  1XGO A;  4U75 A;  1XGM A;  3MR1 A;  4RGZ 1;  3FMQ A;  2P9A A;  1M35 A;  2GGB A;  3PKB A;  1R5G A;  4PV4 A;  4EGE A;  2Q93 A;  1WKM A;  4FO7 A;  4QR8 A;  1QZY A;  1PV9 A;  3BIQ A;  1O0X A;  1XGN A;  2Q96 A;  4KM3 A;  1BN5 A;  1KP0 A;  1QXZ A;  1YJ3 A;  2GU5 A;  1BOA A;  4FKC A;  4OOK A;  2EVM A;  2GU4 A;  2NQ7 A;  2BHD A;  2GG3 A;  4S01 A;  3L7G A;  2BHA A; 
#chains in the Genus database with same CATH topology
 4R60 A;  3L24 A;  4A6W A;  2BWW A;  2BWT A;  3FMR A;  2V3Z A;  5CNX A;  4U6W A;  2GA2 A;  3MAT A;  2BWU A;  2GZ5 A;  2Q95 A;  4Z7M A;  2DFI A;  4U70 A;  4FUK A;  2ZSG A;  2GG2 A;  4MAT A;  2B3K A;  2Q8K A;  1C24 A;  4FLI A;  5JFR A;  2OKN A;  3PKC A;  3MX6 A;  3CB5 A;  1Y1N A;  2GG0 A;  1KQ9 A;  2ADU A;  2BN7 A;  2P98 A;  1WLR A;  4IDY A;  4U6C A;  2V3X A;  5JI6 A;  2B3H A;  3IU7 A;  1N51 A;  2GGC A;  4IKS A;  2NQ6 A;  2GG7 A;  1C22 A;  5CDE A;  4FLJ A;  4ZWU A;  2EA4 A;  2V6C A;  1C21 A;  3IU8 A;  3ROR A;  2Q94 A;  1WY2 A;  4U76 A;  5JHU A;  4S2R P;  2GU6 A;  2BWV A;  1A16 A;  3TB5 A;  2P99 A;  4U71 A;  1JAW A;  2BH3 A;  2OAZ A;  4IKR A;  1R5H A;  1QXW A;  4HXX A;  4FLK A;  4IPA A;  1KQ0 A;  4ZWO A;  1YW8 A;  2GG9 A;  2GG8 A;  2HOW A;  3Q6D A;  1WBQ A;  4RZY A;  2EA2 A;  3RVA A;  1WN1 A;  1YW9 A;  4RZZ A;  4U73 A;  2MAT A;  5FCF A;  1WL6 A;  2BWS A;  1B6A A;  2BHC A;  4B28 A;  5CDV A;  4S00 A;  1QXY A;  3PKA A;  3S6B A;  1MAT A;  4ZNG A;  2BWX A;  1YW7 A;  4ZWP A;  4FO8 A;  2BB7 A;  4PNC A;  1WL9 A;  3D27 A;  2GG5 A;  1C23 A;  2GU7 A;  3IG4 A;  4FLL A;  4U6Z A;  2V3Y A;  1R58 A;  3CTZ A;  4IF7 A;  5D6F A;  3BIP A;  4U69 A;  1W7V A;  3CB6 A;  4IKT A;  5CDL A;  1CHM A;  1XGS A;  1W2M A;  1C27 A;  2GTX A;  5CIK A;  2EVO A;  4U6E A;  4U6J A;  3PKD A;  3TAV A;  1B59 A;  4IU6 A;  4IEC A;  2Q92 A;  4JUQ A;  3IU9 A;  1YVM A;  5CLS A;  5D6E A;  5CE6 A;  1XNZ A;  5FCH A;  2EVC A;  4U1B A;  3FM3 A;  2BWY A;  2B3L A;  2IW2 A;  5E5B A;  4A6V A;  2BHB A;  2G6P A;  4S2T P;  3BIT A;  4IKU A;  3PKE A;  1XGO A;  4U75 A;  1XGM A;  3MR1 A;  4RGZ 1;  3FMQ A;  2P9A A;  1M35 A;  2GGB A;  3PKB A;  1R5G A;  4PV4 A;  4EGE A;  2Q93 A;  1WKM A;  4FO7 A;  4QR8 A;  1QZY A;  1PV9 A;  3BIQ A;  1O0X A;  1XGN A;  2Q96 A;  4KM3 A;  1BN5 A;  1KP0 A;  1QXZ A;  1YJ3 A;  2GU5 A;  1BOA A;  4FKC A;  4OOK A;  2EVM A;  2GU4 A;  2NQ7 A;  2BHD A;  2GG3 A;  4S01 A;  3L7G A;  2BHA A; 
#chains in the Genus database with same CATH homology
 4R60 A;  3L24 A;  4A6W A;  2BWW A;  2BWT A;  3FMR A;  2V3Z A;  5CNX A;  4U6W A;  2GA2 A;  3MAT A;  2BWU A;  2GZ5 A;  2Q95 A;  4Z7M A;  2DFI A;  4U70 A;  4FUK A;  2ZSG A;  2GG2 A;  4MAT A;  2B3K A;  2Q8K A;  1C24 A;  4FLI A;  5JFR A;  2OKN A;  3PKC A;  3MX6 A;  3CB5 A;  1Y1N A;  2GG0 A;  1KQ9 A;  2ADU A;  2BN7 A;  2P98 A;  1WLR A;  4IDY A;  4U6C A;  2V3X A;  5JI6 A;  2B3H A;  3IU7 A;  1N51 A;  2GGC A;  4IKS A;  2NQ6 A;  2GG7 A;  1C22 A;  5CDE A;  4FLJ A;  4ZWU A;  2EA4 A;  2V6C A;  1C21 A;  3IU8 A;  3ROR A;  2Q94 A;  1WY2 A;  4U76 A;  5JHU A;  4S2R P;  2GU6 A;  2BWV A;  1A16 A;  3TB5 A;  2P99 A;  4U71 A;  1JAW A;  2BH3 A;  2OAZ A;  4IKR A;  1R5H A;  1QXW A;  4HXX A;  4FLK A;  4IPA A;  1KQ0 A;  4ZWO A;  1YW8 A;  2GG9 A;  2GG8 A;  2HOW A;  3Q6D A;  1WBQ A;  4RZY A;  2EA2 A;  3RVA A;  1WN1 A;  1YW9 A;  4RZZ A;  4U73 A;  2MAT A;  5FCF A;  1WL6 A;  2BWS A;  1B6A A;  2BHC A;  4B28 A;  5CDV A;  4S00 A;  1QXY A;  3PKA A;  3S6B A;  1MAT A;  4ZNG A;  2BWX A;  1YW7 A;  4ZWP A;  4FO8 A;  2BB7 A;  4PNC A;  1WL9 A;  3D27 A;  2GG5 A;  1C23 A;  2GU7 A;  3IG4 A;  4FLL A;  4U6Z A;  2V3Y A;  1R58 A;  3CTZ A;  4IF7 A;  5D6F A;  3BIP A;  4U69 A;  1W7V A;  3CB6 A;  4IKT A;  5CDL A;  1CHM A;  1XGS A;  1W2M A;  1C27 A;  2GTX A;  5CIK A;  2EVO A;  4U6E A;  4U6J A;  3PKD A;  3TAV A;  1B59 A;  4IU6 A;  4IEC A;  2Q92 A;  4JUQ A;  3IU9 A;  1YVM A;  5CLS A;  5D6E A;  5CE6 A;  1XNZ A;  5FCH A;  2EVC A;  4U1B A;  3FM3 A;  2BWY A;  2B3L A;  2IW2 A;  5E5B A;  4A6V A;  2BHB A;  2G6P A;  4S2T P;  3BIT A;  4IKU A;  3PKE A;  1XGO A;  4U75 A;  1XGM A;  3MR1 A;  4RGZ 1;  3FMQ A;  2P9A A;  1M35 A;  2GGB A;  3PKB A;  1R5G A;  4PV4 A;  4EGE A;  2Q93 A;  1WKM A;  4FO7 A;  4QR8 A;  1QZY A;  1PV9 A;  3BIQ A;  1O0X A;  1XGN A;  2Q96 A;  4KM3 A;  1BN5 A;  1KP0 A;  1QXZ A;  1YJ3 A;  2GU5 A;  1BOA A;  4FKC A;  4OOK A;  2EVM A;  2GU4 A;  2NQ7 A;  2BHD A;  2GG3 A;  4S01 A;  3L7G A;  2BHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...