2GG8A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg8A00
4IU6A 1R5HA 2GG5A 3L7GA 3PKBA 2GU4A 1YVMA 4A6VA 2Q94A 4U70A 2BN7A 2DFIA 4IPAA 2Q92A 2BH3A 3PKAA 4S2RP 4RGZ1 4S00A 4QR8A 4PNCA 3S6BA 4PV4A 2EVOA 4IKRA 3MR1A 1WLRA 4MATA 2B3HA 4IKSA 4JUQA 1XGOA 3PKDA 1C22A 1WBQA 3TB5A 4U6WA 2BWVA 3D27A 3CTZA 1MATA 1YW8A 4OOKA 5CDLA 1YJ3A 3FMRA 3RVAA 3BITA 1XGMA 2P99A 4Z7MA 2BHCA 3BIPA 4FLLA 2Q96A 4U6CA 1WL9A 2GGCA 4U6EA 2BWYA 4FO8A 5CDEA 2GZ5A 2G6PA 5JFRA 3TAVA 5D6EA 1B6AA 2BHDA 4FKCA 4FLJA 1B59A 1WKMA 4RZYA 4S2TP 1KP0A 1QXYA 1KQ9A 3L24A 4HXXA 1W7VA 5CNXA 2ADUA 4ZWOA 2BHBA 4IF7A 2BWUA 2GU5A 2GG2A 2NQ6A 2GTXA 5JI6A 1PV9A 4IECA 2EA4A 5D6FA 2B3KA 2BWWA 5CIKA 3PKCA 5CLSA 2OAZA 5E5BA 5JHUA 2ZSGA 1C21A 4IKTA 1CHMA 4R60A 2NQ7A 5CDVA 1WN1A 2BB7A 1QXWA 2GG9A 2EA2A 2BWXA 2IW2A 1BOAA 3Q6DA 1XNZA 3IG4A 4FLIA 2EVCA 1KQ0A 2GA2A 1YW7A 2MATA 4IDYA 2GG3A 3CB6A 3RORA 2GU6A 3FMQA 2V3ZA 4U75A 2BWSA 1QZYA 2Q93A 1C23A 2V3XA 3IU8A 4RZZA 2V3YA 2Q95A 2HOWA 4U6ZA 1YW9A 5CE6A 4A6WA 1O0XA 3MX6A 4U69A 2OKNA 4U73A 1XGNA 2GG8A 1QXZA 2P9AA 4U1BA 2P98A 2GG7A 2BHAA 3BIQA 4U6JA 4ZWUA 3FM3A 1Y1NA 4ZWPA 1WY2A 4FLKA 3CB5A 4KM3A 4U76A 1R58A 2GU7A 1C24A 4EGEA 2Q8KA 1WL6A 2EVMA 3IU7A 2BWTA 4IKUA 1BN5A 2GG0A 4ZNGA 1N51A 1M35A 1JAWA 1XGSA 4FO7A 4S01A 1R5GA 2B3LA 1A16A 3MATA 4B28A 2GGBA 5FCHA 4FUKA 2V6CA 1C27A 3PKEA 3IU9A 4U71A 5FCFA 1W2MA
chains in the Genus database with same CATH superfamily
4IU6A 1R5HA 2GG5A 3L7GA 3PKBA 2GU4A 1YVMA 4A6VA 2Q94A 4U70A 2BN7A 2DFIA 4IPAA 2Q92A 2BH3A 3PKAA 4S2RP 4RGZ1 4S00A 4QR8A 4PNCA 3S6BA 4PV4A 2EVOA 4IKRA 3MR1A 1WLRA 4MATA 2B3HA 4IKSA 4JUQA 1XGOA 3PKDA 1C22A 1WBQA 3TB5A 4U6WA 2BWVA 3D27A 3CTZA 1MATA 1YW8A 4OOKA 5CDLA 1YJ3A 3FMRA 3RVAA 3BITA 1XGMA 2P99A 4Z7MA 2BHCA 3BIPA 4FLLA 2Q96A 4U6CA 1WL9A 2GGCA 4U6EA 2BWYA 4FO8A 5CDEA 2GZ5A 2G6PA 5JFRA 3TAVA 5D6EA 1B6AA 2BHDA 4FKCA 4FLJA 1B59A 1WKMA 4RZYA 4S2TP 1KP0A 1QXYA 1KQ9A 3L24A 4HXXA 1W7VA 5CNXA 2ADUA 4ZWOA 2BHBA 4IF7A 2BWUA 2GU5A 2GG2A 2NQ6A 2GTXA 5JI6A 1PV9A 4IECA 2EA4A 5D6FA 2B3KA 2BWWA 5CIKA 3PKCA 5CLSA 2OAZA 5E5BA 5JHUA 2ZSGA 1C21A 4IKTA 1CHMA 4R60A 2NQ7A 5CDVA 1WN1A 2BB7A 1QXWA 2GG9A 2EA2A 2BWXA 2IW2A 1BOAA 3Q6DA 1XNZA 3IG4A 4FLIA 2EVCA 1KQ0A 2GA2A 1YW7A 2MATA 4IDYA 2GG3A 3CB6A 3RORA 2GU6A 3FMQA 2V3ZA 4U75A 2BWSA 1QZYA 2Q93A 1C23A 2V3XA 3IU8A 4RZZA 2V3YA 2Q95A 2HOWA 4U6ZA 1YW9A 5CE6A 4A6WA 1O0XA 3MX6A 4U69A 2OKNA 4U73A 1XGNA 2GG8A 1QXZA 2P9AA 4U1BA 2P98A 2GG7A 2BHAA 3BIQA 4U6JA 4ZWUA 3FM3A 1Y1NA 4ZWPA 1WY2A 4FLKA 3CB5A 4KM3A 4U76A 1R58A 2GU7A 1C24A 4EGEA 2Q8KA 1WL6A 2EVMA 3IU7A 2BWTA 4IKUA 1BN5A 2GG0A 4ZNGA 1N51A 1M35A 1JAWA 1XGSA 4FO7A 4S01A 1R5GA 2B3LA 1A16A 3MATA 4B28A 2GGBA 5FCHA 4FUKA 2V6CA 1C27A 3PKEA 3IU9A 4U71A 5FCFA 1W2MA
chains in the Genus database with same CATH topology
4IU6A 1R5HA 2GG5A 3L7GA 3PKBA 2GU4A 1YVMA 4A6VA 2Q94A 4U70A 2BN7A 2DFIA 4IPAA 2Q92A 2BH3A 3PKAA 4S2RP 4RGZ1 4S00A 4QR8A 4PNCA 3S6BA 4PV4A 2EVOA 4IKRA 3MR1A 1WLRA 4MATA 2B3HA 4IKSA 4JUQA 1XGOA 3PKDA 1C22A 1WBQA 3TB5A 4U6WA 2BWVA 3D27A 3CTZA 1MATA 1YW8A 4OOKA 5CDLA 1YJ3A 3FMRA 3RVAA 3BITA 1XGMA 2P99A 4Z7MA 2BHCA 3BIPA 4FLLA 2Q96A 4U6CA 1WL9A 2GGCA 4U6EA 2BWYA 4FO8A 5CDEA 2GZ5A 2G6PA 5JFRA 3TAVA 5D6EA 1B6AA 2BHDA 4FKCA 4FLJA 1B59A 1WKMA 4RZYA 4S2TP 1KP0A 1QXYA 1KQ9A 3L24A 4HXXA 1W7VA 5CNXA 2ADUA 4ZWOA 2BHBA 4IF7A 2BWUA 2GU5A 2GG2A 2NQ6A 2GTXA 5JI6A 1PV9A 4IECA 2EA4A 5D6FA 2B3KA 2BWWA 5CIKA 3PKCA 5CLSA 2OAZA 5E5BA 5JHUA 2ZSGA 1C21A 4IKTA 1CHMA 4R60A 2NQ7A 5CDVA 1WN1A 2BB7A 1QXWA 2GG9A 2EA2A 2BWXA 2IW2A 1BOAA 3Q6DA 1XNZA 3IG4A 4FLIA 2EVCA 1KQ0A 2GA2A 1YW7A 2MATA 4IDYA 2GG3A 3CB6A 3RORA 2GU6A 3FMQA 2V3ZA 4U75A 2BWSA 1QZYA 2Q93A 1C23A 2V3XA 3IU8A 4RZZA 2V3YA 2Q95A 2HOWA 4U6ZA 1YW9A 5CE6A 4A6WA 1O0XA 3MX6A 4U69A 2OKNA 4U73A 1XGNA 2GG8A 1QXZA 2P9AA 4U1BA 2P98A 2GG7A 2BHAA 3BIQA 4U6JA 4ZWUA 3FM3A 1Y1NA 4ZWPA 1WY2A 4FLKA 3CB5A 4KM3A 4U76A 1R58A 2GU7A 1C24A 4EGEA 2Q8KA 1WL6A 2EVMA 3IU7A 2BWTA 4IKUA 1BN5A 2GG0A 4ZNGA 1N51A 1M35A 1JAWA 1XGSA 4FO7A 4S01A 1R5GA 2B3LA 1A16A 3MATA 4B28A 2GGBA 5FCHA 4FUKA 2V6CA 1C27A 3PKEA 3IU9A 4U71A 5FCFA 1W2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IU6 A;  1R5H A;  2GG5 A;  3L7G A;  3PKB A;  2GU4 A;  1YVM A;  4A6V A;  2Q94 A;  4U70 A;  2BN7 A;  2DFI A;  4IPA A;  2Q92 A;  2BH3 A;  3PKA A;  4S2R P;  4RGZ 1;  4S00 A;  4QR8 A;  4PNC A;  3S6B A;  4PV4 A;  2EVO A;  4IKR A;  3MR1 A;  1WLR A;  4MAT A;  2B3H A;  4IKS A;  4JUQ A;  1XGO A;  3PKD A;  1C22 A;  1WBQ A;  3TB5 A;  4U6W A;  2BWV A;  3D27 A;  3CTZ A;  1MAT A;  1YW8 A;  4OOK A;  5CDL A;  1YJ3 A;  3FMR A;  3RVA A;  3BIT A;  1XGM A;  2P99 A;  4Z7M A;  2BHC A;  3BIP A;  4FLL A;  2Q96 A;  4U6C A;  1WL9 A;  2GGC A;  4U6E A;  2BWY A;  4FO8 A;  5CDE A;  2GZ5 A;  2G6P A;  5JFR A;  3TAV A;  5D6E A;  1B6A A;  2BHD A;  4FKC A;  4FLJ A;  1B59 A;  1WKM A;  4RZY A;  4S2T P;  1KP0 A;  1QXY A;  1KQ9 A;  3L24 A;  4HXX A;  1W7V A;  5CNX A;  2ADU A;  4ZWO A;  2BHB A;  4IF7 A;  2BWU A;  2GU5 A;  2GG2 A;  2NQ6 A;  2GTX A;  5JI6 A;  1PV9 A;  4IEC A;  2EA4 A;  5D6F A;  2B3K A;  2BWW A;  5CIK A;  3PKC A;  5CLS A;  2OAZ A;  5E5B A;  5JHU A;  2ZSG A;  1C21 A;  4IKT A;  1CHM A;  4R60 A;  2NQ7 A;  5CDV A;  1WN1 A;  2BB7 A;  1QXW A;  2GG9 A;  2EA2 A;  2BWX A;  2IW2 A;  1BOA A;  3Q6D A;  1XNZ A;  3IG4 A;  4FLI A;  2EVC A;  1KQ0 A;  2GA2 A;  1YW7 A;  2MAT A;  4IDY A;  2GG3 A;  3CB6 A;  3ROR A;  2GU6 A;  3FMQ A;  2V3Z A;  4U75 A;  2BWS A;  1QZY A;  2Q93 A;  1C23 A;  2V3X A;  3IU8 A;  4RZZ A;  2V3Y A;  2Q95 A;  2HOW A;  4U6Z A;  1YW9 A;  5CE6 A;  4A6W A;  1O0X A;  3MX6 A;  4U69 A;  2OKN A;  4U73 A;  1XGN A;  2GG8 A;  1QXZ A;  2P9A A;  4U1B A;  2P98 A;  2GG7 A;  2BHA A;  3BIQ A;  4U6J A;  4ZWU A;  3FM3 A;  1Y1N A;  4ZWP A;  1WY2 A;  4FLK A;  3CB5 A;  4KM3 A;  4U76 A;  1R58 A;  2GU7 A;  1C24 A;  4EGE A;  2Q8K A;  1WL6 A;  2EVM A;  3IU7 A;  2BWT A;  4IKU A;  1BN5 A;  2GG0 A;  4ZNG A;  1N51 A;  1M35 A;  1JAW A;  1XGS A;  4FO7 A;  4S01 A;  1R5G A;  2B3L A;  1A16 A;  3MAT A;  4B28 A;  2GGB A;  5FCH A;  4FUK A;  2V6C A;  1C27 A;  3PKE A;  3IU9 A;  4U71 A;  5FCF A;  1W2M A; 
#chains in the Genus database with same CATH topology
 4IU6 A;  1R5H A;  2GG5 A;  3L7G A;  3PKB A;  2GU4 A;  1YVM A;  4A6V A;  2Q94 A;  4U70 A;  2BN7 A;  2DFI A;  4IPA A;  2Q92 A;  2BH3 A;  3PKA A;  4S2R P;  4RGZ 1;  4S00 A;  4QR8 A;  4PNC A;  3S6B A;  4PV4 A;  2EVO A;  4IKR A;  3MR1 A;  1WLR A;  4MAT A;  2B3H A;  4IKS A;  4JUQ A;  1XGO A;  3PKD A;  1C22 A;  1WBQ A;  3TB5 A;  4U6W A;  2BWV A;  3D27 A;  3CTZ A;  1MAT A;  1YW8 A;  4OOK A;  5CDL A;  1YJ3 A;  3FMR A;  3RVA A;  3BIT A;  1XGM A;  2P99 A;  4Z7M A;  2BHC A;  3BIP A;  4FLL A;  2Q96 A;  4U6C A;  1WL9 A;  2GGC A;  4U6E A;  2BWY A;  4FO8 A;  5CDE A;  2GZ5 A;  2G6P A;  5JFR A;  3TAV A;  5D6E A;  1B6A A;  2BHD A;  4FKC A;  4FLJ A;  1B59 A;  1WKM A;  4RZY A;  4S2T P;  1KP0 A;  1QXY A;  1KQ9 A;  3L24 A;  4HXX A;  1W7V A;  5CNX A;  2ADU A;  4ZWO A;  2BHB A;  4IF7 A;  2BWU A;  2GU5 A;  2GG2 A;  2NQ6 A;  2GTX A;  5JI6 A;  1PV9 A;  4IEC A;  2EA4 A;  5D6F A;  2B3K A;  2BWW A;  5CIK A;  3PKC A;  5CLS A;  2OAZ A;  5E5B A;  5JHU A;  2ZSG A;  1C21 A;  4IKT A;  1CHM A;  4R60 A;  2NQ7 A;  5CDV A;  1WN1 A;  2BB7 A;  1QXW A;  2GG9 A;  2EA2 A;  2BWX A;  2IW2 A;  1BOA A;  3Q6D A;  1XNZ A;  3IG4 A;  4FLI A;  2EVC A;  1KQ0 A;  2GA2 A;  1YW7 A;  2MAT A;  4IDY A;  2GG3 A;  3CB6 A;  3ROR A;  2GU6 A;  3FMQ A;  2V3Z A;  4U75 A;  2BWS A;  1QZY A;  2Q93 A;  1C23 A;  2V3X A;  3IU8 A;  4RZZ A;  2V3Y A;  2Q95 A;  2HOW A;  4U6Z A;  1YW9 A;  5CE6 A;  4A6W A;  1O0X A;  3MX6 A;  4U69 A;  2OKN A;  4U73 A;  1XGN A;  2GG8 A;  1QXZ A;  2P9A A;  4U1B A;  2P98 A;  2GG7 A;  2BHA A;  3BIQ A;  4U6J A;  4ZWU A;  3FM3 A;  1Y1N A;  4ZWP A;  1WY2 A;  4FLK A;  3CB5 A;  4KM3 A;  4U76 A;  1R58 A;  2GU7 A;  1C24 A;  4EGE A;  2Q8K A;  1WL6 A;  2EVM A;  3IU7 A;  2BWT A;  4IKU A;  1BN5 A;  2GG0 A;  4ZNG A;  1N51 A;  1M35 A;  1JAW A;  1XGS A;  4FO7 A;  4S01 A;  1R5G A;  2B3L A;  1A16 A;  3MAT A;  4B28 A;  2GGB A;  5FCH A;  4FUK A;  2V6C A;  1C27 A;  3PKE A;  3IU9 A;  4U71 A;  5FCF A;  1W2M A; 
#chains in the Genus database with same CATH homology
 4IU6 A;  1R5H A;  2GG5 A;  3L7G A;  3PKB A;  2GU4 A;  1YVM A;  4A6V A;  2Q94 A;  4U70 A;  2BN7 A;  2DFI A;  4IPA A;  2Q92 A;  2BH3 A;  3PKA A;  4S2R P;  4RGZ 1;  4S00 A;  4QR8 A;  4PNC A;  3S6B A;  4PV4 A;  2EVO A;  4IKR A;  3MR1 A;  1WLR A;  4MAT A;  2B3H A;  4IKS A;  4JUQ A;  1XGO A;  3PKD A;  1C22 A;  1WBQ A;  3TB5 A;  4U6W A;  2BWV A;  3D27 A;  3CTZ A;  1MAT A;  1YW8 A;  4OOK A;  5CDL A;  1YJ3 A;  3FMR A;  3RVA A;  3BIT A;  1XGM A;  2P99 A;  4Z7M A;  2BHC A;  3BIP A;  4FLL A;  2Q96 A;  4U6C A;  1WL9 A;  2GGC A;  4U6E A;  2BWY A;  4FO8 A;  5CDE A;  2GZ5 A;  2G6P A;  5JFR A;  3TAV A;  5D6E A;  1B6A A;  2BHD A;  4FKC A;  4FLJ A;  1B59 A;  1WKM A;  4RZY A;  4S2T P;  1KP0 A;  1QXY A;  1KQ9 A;  3L24 A;  4HXX A;  1W7V A;  5CNX A;  2ADU A;  4ZWO A;  2BHB A;  4IF7 A;  2BWU A;  2GU5 A;  2GG2 A;  2NQ6 A;  2GTX A;  5JI6 A;  1PV9 A;  4IEC A;  2EA4 A;  5D6F A;  2B3K A;  2BWW A;  5CIK A;  3PKC A;  5CLS A;  2OAZ A;  5E5B A;  5JHU A;  2ZSG A;  1C21 A;  4IKT A;  1CHM A;  4R60 A;  2NQ7 A;  5CDV A;  1WN1 A;  2BB7 A;  1QXW A;  2GG9 A;  2EA2 A;  2BWX A;  2IW2 A;  1BOA A;  3Q6D A;  1XNZ A;  3IG4 A;  4FLI A;  2EVC A;  1KQ0 A;  2GA2 A;  1YW7 A;  2MAT A;  4IDY A;  2GG3 A;  3CB6 A;  3ROR A;  2GU6 A;  3FMQ A;  2V3Z A;  4U75 A;  2BWS A;  1QZY A;  2Q93 A;  1C23 A;  2V3X A;  3IU8 A;  4RZZ A;  2V3Y A;  2Q95 A;  2HOW A;  4U6Z A;  1YW9 A;  5CE6 A;  4A6W A;  1O0X A;  3MX6 A;  4U69 A;  2OKN A;  4U73 A;  1XGN A;  2GG8 A;  1QXZ A;  2P9A A;  4U1B A;  2P98 A;  2GG7 A;  2BHA A;  3BIQ A;  4U6J A;  4ZWU A;  3FM3 A;  1Y1N A;  4ZWP A;  1WY2 A;  4FLK A;  3CB5 A;  4KM3 A;  4U76 A;  1R58 A;  2GU7 A;  1C24 A;  4EGE A;  2Q8K A;  1WL6 A;  2EVM A;  3IU7 A;  2BWT A;  4IKU A;  1BN5 A;  2GG0 A;  4ZNG A;  1N51 A;  1M35 A;  1JAW A;  1XGS A;  4FO7 A;  4S01 A;  1R5G A;  2B3L A;  1A16 A;  3MAT A;  4B28 A;  2GGB A;  5FCH A;  4FUK A;  2V6C A;  1C27 A;  3PKE A;  3IU9 A;  4U71 A;  5FCF A;  1W2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...