2GG8A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 88
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg8A00
3BIQA 4RZZA 2Q94A 4S00A 1WN1A 2P98A 4U76A 3FM3A 4ZWPA 2P99A 4S2TP 4U69A 2BWWA 5FCFA 2BHAA 2BHCA 1QZYA 4ZNGA 2GZ5A 5E5BA 2GG5A 3IG4A 1C27A 1B59A 4IF7A 4U71A 5D6FA 2EA2A 5JI6A 4B28A 4A6VA 2GU4A 3TB5A 4RGZ1 3IU9A 1WY2A 1YW8A 2BWSA 2P9AA 1XGOA 4FO8A 4OOKA 1XGSA 5FCHA 4IECA 1BN5A 3RORA 3L24A 1WLRA 2Q8KA 2G6PA 3PKAA 1O0XA 1QXWA 4U73A 4IU6A 1QXZA 3MR1A 4JUQA 3D27A 2BWUA 2B3HA 1C21A 4U6EA 2NQ6A 5D6EA 4R60A 2B3KA 2GG3A 4U1BA 1YVMA 2HOWA 3IU8A 2GTXA 2EVOA 2ZSGA 4IKSA 2V3ZA 5CDLA 1B6AA 1PV9A 4S2RP 5JHUA 5CNXA 2V6CA 2BWTA 2DFIA 1XGNA 4IKRA 3S6BA 3FMQA 1KQ9A 4U6ZA 2GU6A 2Q95A 1W2MA 3PKEA 1C23A 4FO7A 2V3XA 3FMRA 4KM3A 2GG9A 1JAWA 1WKMA 2BWYA 3Q6DA 1R5HA 4S01A 1MATA 5CE6A 1YW9A 2EVCA 2Q96A 4ZWOA 3PKCA 4FUKA 5CLSA 3IU7A 2GA2A 1A16A 5CIKA 2BH3A 1YW7A 4Z7MA 2BWVA 2BN7A 3RVAA 1QXYA 2IW2A 4U6CA 3BIPA 1M35A 2OKNA 2GU7A 4MATA 4U6WA 1WL9A 4U75A 4IKUA 4IPAA 1WBQA 4FLJA 4ZWUA 4IDYA 2Q93A 2ADUA 1R5GA 1YJ3A 3BITA 2NQ7A 5CDVA 2B3LA 2BHDA 1XNZA 3PKDA 3MATA 4IKTA 2GGCA 4A6WA 3CB5A 3L7GA 1BOAA 2BHBA 2GGBA 1XGMA 2OAZA 1WL6A 5CDEA 2Q92A 4PNCA 2GG0A 1KP0A 2GG8A 3CTZA 3MX6A 4FLLA 1C22A 1W7VA 3PKBA 4PV4A 2MATA 4U70A 1KQ0A 2V3YA 4FKCA 3CB6A 1CHMA 4EGEA 4RZYA 2BWXA 2EVMA 4FLIA 1R58A 5JFRA 1C24A 4U6JA 1Y1NA 1N51A 4QR8A 2GG2A 2GG7A 4HXXA 4FLKA 2GU5A 2BB7A 2EA4A 3TAVA
chains in the Genus database with same CATH superfamily
3BIQA 4RZZA 2Q94A 4S00A 1WN1A 2P98A 4U76A 3FM3A 4ZWPA 2P99A 4S2TP 4U69A 2BWWA 5FCFA 2BHAA 2BHCA 1QZYA 4ZNGA 2GZ5A 5E5BA 2GG5A 3IG4A 1C27A 1B59A 4IF7A 4U71A 5D6FA 2EA2A 5JI6A 4B28A 4A6VA 2GU4A 3TB5A 4RGZ1 3IU9A 1WY2A 1YW8A 2BWSA 2P9AA 1XGOA 4FO8A 4OOKA 1XGSA 5FCHA 4IECA 1BN5A 3RORA 3L24A 1WLRA 2Q8KA 2G6PA 3PKAA 1O0XA 1QXWA 4U73A 4IU6A 1QXZA 3MR1A 4JUQA 3D27A 2BWUA 2B3HA 1C21A 4U6EA 2NQ6A 5D6EA 4R60A 2B3KA 2GG3A 4U1BA 1YVMA 2HOWA 3IU8A 2GTXA 2EVOA 2ZSGA 4IKSA 2V3ZA 5CDLA 1B6AA 1PV9A 4S2RP 5JHUA 5CNXA 2V6CA 2BWTA 2DFIA 1XGNA 4IKRA 3S6BA 3FMQA 1KQ9A 4U6ZA 2GU6A 2Q95A 1W2MA 3PKEA 1C23A 4FO7A 2V3XA 3FMRA 4KM3A 2GG9A 1JAWA 1WKMA 2BWYA 3Q6DA 1R5HA 4S01A 1MATA 5CE6A 1YW9A 2EVCA 2Q96A 4ZWOA 3PKCA 4FUKA 5CLSA 3IU7A 2GA2A 1A16A 5CIKA 2BH3A 1YW7A 4Z7MA 2BWVA 2BN7A 3RVAA 1QXYA 2IW2A 4U6CA 3BIPA 1M35A 2OKNA 2GU7A 4MATA 4U6WA 1WL9A 4U75A 4IKUA 4IPAA 1WBQA 4FLJA 4ZWUA 4IDYA 2Q93A 2ADUA 1R5GA 1YJ3A 3BITA 2NQ7A 5CDVA 2B3LA 2BHDA 1XNZA 3PKDA 3MATA 4IKTA 2GGCA 4A6WA 3CB5A 3L7GA 1BOAA 2BHBA 2GGBA 1XGMA 2OAZA 1WL6A 5CDEA 2Q92A 4PNCA 2GG0A 1KP0A 2GG8A 3CTZA 3MX6A 4FLLA 1C22A 1W7VA 3PKBA 4PV4A 2MATA 4U70A 1KQ0A 2V3YA 4FKCA 3CB6A 1CHMA 4EGEA 4RZYA 2BWXA 2EVMA 4FLIA 1R58A 5JFRA 1C24A 4U6JA 1Y1NA 1N51A 4QR8A 2GG2A 2GG7A 4HXXA 4FLKA 2GU5A 2BB7A 2EA4A 3TAVA
chains in the Genus database with same CATH topology
3BIQA 4RZZA 2Q94A 4S00A 1WN1A 2P98A 4U76A 3FM3A 4ZWPA 2P99A 4S2TP 4U69A 2BWWA 5FCFA 2BHAA 2BHCA 1QZYA 4ZNGA 2GZ5A 5E5BA 2GG5A 3IG4A 1C27A 1B59A 4IF7A 4U71A 5D6FA 2EA2A 5JI6A 4B28A 4A6VA 2GU4A 3TB5A 4RGZ1 3IU9A 1WY2A 1YW8A 2BWSA 2P9AA 1XGOA 4FO8A 4OOKA 1XGSA 5FCHA 4IECA 1BN5A 3RORA 3L24A 1WLRA 2Q8KA 2G6PA 3PKAA 1O0XA 1QXWA 4U73A 4IU6A 1QXZA 3MR1A 4JUQA 3D27A 2BWUA 2B3HA 1C21A 4U6EA 2NQ6A 5D6EA 4R60A 2B3KA 2GG3A 4U1BA 1YVMA 2HOWA 3IU8A 2GTXA 2EVOA 2ZSGA 4IKSA 2V3ZA 5CDLA 1B6AA 1PV9A 4S2RP 5JHUA 5CNXA 2V6CA 2BWTA 2DFIA 1XGNA 4IKRA 3S6BA 3FMQA 1KQ9A 4U6ZA 2GU6A 2Q95A 1W2MA 3PKEA 1C23A 4FO7A 2V3XA 3FMRA 4KM3A 2GG9A 1JAWA 1WKMA 2BWYA 3Q6DA 1R5HA 4S01A 1MATA 5CE6A 1YW9A 2EVCA 2Q96A 4ZWOA 3PKCA 4FUKA 5CLSA 3IU7A 2GA2A 1A16A 5CIKA 2BH3A 1YW7A 4Z7MA 2BWVA 2BN7A 3RVAA 1QXYA 2IW2A 4U6CA 3BIPA 1M35A 2OKNA 2GU7A 4MATA 4U6WA 1WL9A 4U75A 4IKUA 4IPAA 1WBQA 4FLJA 4ZWUA 4IDYA 2Q93A 2ADUA 1R5GA 1YJ3A 3BITA 2NQ7A 5CDVA 2B3LA 2BHDA 1XNZA 3PKDA 3MATA 4IKTA 2GGCA 4A6WA 3CB5A 3L7GA 1BOAA 2BHBA 2GGBA 1XGMA 2OAZA 1WL6A 5CDEA 2Q92A 4PNCA 2GG0A 1KP0A 2GG8A 3CTZA 3MX6A 4FLLA 1C22A 1W7VA 3PKBA 4PV4A 2MATA 4U70A 1KQ0A 2V3YA 4FKCA 3CB6A 1CHMA 4EGEA 4RZYA 2BWXA 2EVMA 4FLIA 1R58A 5JFRA 1C24A 4U6JA 1Y1NA 1N51A 4QR8A 2GG2A 2GG7A 4HXXA 4FLKA 2GU5A 2BB7A 2EA4A 3TAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIQ A;  4RZZ A;  2Q94 A;  4S00 A;  1WN1 A;  2P98 A;  4U76 A;  3FM3 A;  4ZWP A;  2P99 A;  4S2T P;  4U69 A;  2BWW A;  5FCF A;  2BHA A;  2BHC A;  1QZY A;  4ZNG A;  2GZ5 A;  5E5B A;  2GG5 A;  3IG4 A;  1C27 A;  1B59 A;  4IF7 A;  4U71 A;  5D6F A;  2EA2 A;  5JI6 A;  4B28 A;  4A6V A;  2GU4 A;  3TB5 A;  4RGZ 1;  3IU9 A;  1WY2 A;  1YW8 A;  2BWS A;  2P9A A;  1XGO A;  4FO8 A;  4OOK A;  1XGS A;  5FCH A;  4IEC A;  1BN5 A;  3ROR A;  3L24 A;  1WLR A;  2Q8K A;  2G6P A;  3PKA A;  1O0X A;  1QXW A;  4U73 A;  4IU6 A;  1QXZ A;  3MR1 A;  4JUQ A;  3D27 A;  2BWU A;  2B3H A;  1C21 A;  4U6E A;  2NQ6 A;  5D6E A;  4R60 A;  2B3K A;  2GG3 A;  4U1B A;  1YVM A;  2HOW A;  3IU8 A;  2GTX A;  2EVO A;  2ZSG A;  4IKS A;  2V3Z A;  5CDL A;  1B6A A;  1PV9 A;  4S2R P;  5JHU A;  5CNX A;  2V6C A;  2BWT A;  2DFI A;  1XGN A;  4IKR A;  3S6B A;  3FMQ A;  1KQ9 A;  4U6Z A;  2GU6 A;  2Q95 A;  1W2M A;  3PKE A;  1C23 A;  4FO7 A;  2V3X A;  3FMR A;  4KM3 A;  2GG9 A;  1JAW A;  1WKM A;  2BWY A;  3Q6D A;  1R5H A;  4S01 A;  1MAT A;  5CE6 A;  1YW9 A;  2EVC A;  2Q96 A;  4ZWO A;  3PKC A;  4FUK A;  5CLS A;  3IU7 A;  2GA2 A;  1A16 A;  5CIK A;  2BH3 A;  1YW7 A;  4Z7M A;  2BWV A;  2BN7 A;  3RVA A;  1QXY A;  2IW2 A;  4U6C A;  3BIP A;  1M35 A;  2OKN A;  2GU7 A;  4MAT A;  4U6W A;  1WL9 A;  4U75 A;  4IKU A;  4IPA A;  1WBQ A;  4FLJ A;  4ZWU A;  4IDY A;  2Q93 A;  2ADU A;  1R5G A;  1YJ3 A;  3BIT A;  2NQ7 A;  5CDV A;  2B3L A;  2BHD A;  1XNZ A;  3PKD A;  3MAT A;  4IKT A;  2GGC A;  4A6W A;  3CB5 A;  3L7G A;  1BOA A;  2BHB A;  2GGB A;  1XGM A;  2OAZ A;  1WL6 A;  5CDE A;  2Q92 A;  4PNC A;  2GG0 A;  1KP0 A;  2GG8 A;  3CTZ A;  3MX6 A;  4FLL A;  1C22 A;  1W7V A;  3PKB A;  4PV4 A;  2MAT A;  4U70 A;  1KQ0 A;  2V3Y A;  4FKC A;  3CB6 A;  1CHM A;  4EGE A;  4RZY A;  2BWX A;  2EVM A;  4FLI A;  1R58 A;  5JFR A;  1C24 A;  4U6J A;  1Y1N A;  1N51 A;  4QR8 A;  2GG2 A;  2GG7 A;  4HXX A;  4FLK A;  2GU5 A;  2BB7 A;  2EA4 A;  3TAV A; 
#chains in the Genus database with same CATH topology
 3BIQ A;  4RZZ A;  2Q94 A;  4S00 A;  1WN1 A;  2P98 A;  4U76 A;  3FM3 A;  4ZWP A;  2P99 A;  4S2T P;  4U69 A;  2BWW A;  5FCF A;  2BHA A;  2BHC A;  1QZY A;  4ZNG A;  2GZ5 A;  5E5B A;  2GG5 A;  3IG4 A;  1C27 A;  1B59 A;  4IF7 A;  4U71 A;  5D6F A;  2EA2 A;  5JI6 A;  4B28 A;  4A6V A;  2GU4 A;  3TB5 A;  4RGZ 1;  3IU9 A;  1WY2 A;  1YW8 A;  2BWS A;  2P9A A;  1XGO A;  4FO8 A;  4OOK A;  1XGS A;  5FCH A;  4IEC A;  1BN5 A;  3ROR A;  3L24 A;  1WLR A;  2Q8K A;  2G6P A;  3PKA A;  1O0X A;  1QXW A;  4U73 A;  4IU6 A;  1QXZ A;  3MR1 A;  4JUQ A;  3D27 A;  2BWU A;  2B3H A;  1C21 A;  4U6E A;  2NQ6 A;  5D6E A;  4R60 A;  2B3K A;  2GG3 A;  4U1B A;  1YVM A;  2HOW A;  3IU8 A;  2GTX A;  2EVO A;  2ZSG A;  4IKS A;  2V3Z A;  5CDL A;  1B6A A;  1PV9 A;  4S2R P;  5JHU A;  5CNX A;  2V6C A;  2BWT A;  2DFI A;  1XGN A;  4IKR A;  3S6B A;  3FMQ A;  1KQ9 A;  4U6Z A;  2GU6 A;  2Q95 A;  1W2M A;  3PKE A;  1C23 A;  4FO7 A;  2V3X A;  3FMR A;  4KM3 A;  2GG9 A;  1JAW A;  1WKM A;  2BWY A;  3Q6D A;  1R5H A;  4S01 A;  1MAT A;  5CE6 A;  1YW9 A;  2EVC A;  2Q96 A;  4ZWO A;  3PKC A;  4FUK A;  5CLS A;  3IU7 A;  2GA2 A;  1A16 A;  5CIK A;  2BH3 A;  1YW7 A;  4Z7M A;  2BWV A;  2BN7 A;  3RVA A;  1QXY A;  2IW2 A;  4U6C A;  3BIP A;  1M35 A;  2OKN A;  2GU7 A;  4MAT A;  4U6W A;  1WL9 A;  4U75 A;  4IKU A;  4IPA A;  1WBQ A;  4FLJ A;  4ZWU A;  4IDY A;  2Q93 A;  2ADU A;  1R5G A;  1YJ3 A;  3BIT A;  2NQ7 A;  5CDV A;  2B3L A;  2BHD A;  1XNZ A;  3PKD A;  3MAT A;  4IKT A;  2GGC A;  4A6W A;  3CB5 A;  3L7G A;  1BOA A;  2BHB A;  2GGB A;  1XGM A;  2OAZ A;  1WL6 A;  5CDE A;  2Q92 A;  4PNC A;  2GG0 A;  1KP0 A;  2GG8 A;  3CTZ A;  3MX6 A;  4FLL A;  1C22 A;  1W7V A;  3PKB A;  4PV4 A;  2MAT A;  4U70 A;  1KQ0 A;  2V3Y A;  4FKC A;  3CB6 A;  1CHM A;  4EGE A;  4RZY A;  2BWX A;  2EVM A;  4FLI A;  1R58 A;  5JFR A;  1C24 A;  4U6J A;  1Y1N A;  1N51 A;  4QR8 A;  2GG2 A;  2GG7 A;  4HXX A;  4FLK A;  2GU5 A;  2BB7 A;  2EA4 A;  3TAV A; 
#chains in the Genus database with same CATH homology
 3BIQ A;  4RZZ A;  2Q94 A;  4S00 A;  1WN1 A;  2P98 A;  4U76 A;  3FM3 A;  4ZWP A;  2P99 A;  4S2T P;  4U69 A;  2BWW A;  5FCF A;  2BHA A;  2BHC A;  1QZY A;  4ZNG A;  2GZ5 A;  5E5B A;  2GG5 A;  3IG4 A;  1C27 A;  1B59 A;  4IF7 A;  4U71 A;  5D6F A;  2EA2 A;  5JI6 A;  4B28 A;  4A6V A;  2GU4 A;  3TB5 A;  4RGZ 1;  3IU9 A;  1WY2 A;  1YW8 A;  2BWS A;  2P9A A;  1XGO A;  4FO8 A;  4OOK A;  1XGS A;  5FCH A;  4IEC A;  1BN5 A;  3ROR A;  3L24 A;  1WLR A;  2Q8K A;  2G6P A;  3PKA A;  1O0X A;  1QXW A;  4U73 A;  4IU6 A;  1QXZ A;  3MR1 A;  4JUQ A;  3D27 A;  2BWU A;  2B3H A;  1C21 A;  4U6E A;  2NQ6 A;  5D6E A;  4R60 A;  2B3K A;  2GG3 A;  4U1B A;  1YVM A;  2HOW A;  3IU8 A;  2GTX A;  2EVO A;  2ZSG A;  4IKS A;  2V3Z A;  5CDL A;  1B6A A;  1PV9 A;  4S2R P;  5JHU A;  5CNX A;  2V6C A;  2BWT A;  2DFI A;  1XGN A;  4IKR A;  3S6B A;  3FMQ A;  1KQ9 A;  4U6Z A;  2GU6 A;  2Q95 A;  1W2M A;  3PKE A;  1C23 A;  4FO7 A;  2V3X A;  3FMR A;  4KM3 A;  2GG9 A;  1JAW A;  1WKM A;  2BWY A;  3Q6D A;  1R5H A;  4S01 A;  1MAT A;  5CE6 A;  1YW9 A;  2EVC A;  2Q96 A;  4ZWO A;  3PKC A;  4FUK A;  5CLS A;  3IU7 A;  2GA2 A;  1A16 A;  5CIK A;  2BH3 A;  1YW7 A;  4Z7M A;  2BWV A;  2BN7 A;  3RVA A;  1QXY A;  2IW2 A;  4U6C A;  3BIP A;  1M35 A;  2OKN A;  2GU7 A;  4MAT A;  4U6W A;  1WL9 A;  4U75 A;  4IKU A;  4IPA A;  1WBQ A;  4FLJ A;  4ZWU A;  4IDY A;  2Q93 A;  2ADU A;  1R5G A;  1YJ3 A;  3BIT A;  2NQ7 A;  5CDV A;  2B3L A;  2BHD A;  1XNZ A;  3PKD A;  3MAT A;  4IKT A;  2GGC A;  4A6W A;  3CB5 A;  3L7G A;  1BOA A;  2BHB A;  2GGB A;  1XGM A;  2OAZ A;  1WL6 A;  5CDE A;  2Q92 A;  4PNC A;  2GG0 A;  1KP0 A;  2GG8 A;  3CTZ A;  3MX6 A;  4FLL A;  1C22 A;  1W7V A;  3PKB A;  4PV4 A;  2MAT A;  4U70 A;  1KQ0 A;  2V3Y A;  4FKC A;  3CB6 A;  1CHM A;  4EGE A;  4RZY A;  2BWX A;  2EVM A;  4FLI A;  1R58 A;  5JFR A;  1C24 A;  4U6J A;  1Y1N A;  1N51 A;  4QR8 A;  2GG2 A;  2GG7 A;  4HXX A;  4FLK A;  2GU5 A;  2BB7 A;  2EA4 A;  3TAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...