2GG8A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 88
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg8A00
1WY2A 2OAZA 2GG7A 1QXZA 2BHCA 2HOWA 1PV9A 1YVMA 1R58A 4KM3A 2P99A 1QXWA 3BIQA 5JHUA 2GU7A 2BWSA 2DFIA 5E5BA 4HXXA 4A6WA 4B28A 5JFRA 4Z7MA 4RGZ1 3CB5A 3L7GA 1B6AA 1YW7A 2EA4A 2GG5A 4FLIA 1C27A 1XGNA 4OOKA 4S2TP 1XNZA 4ZWPA 2BWUA 2V3ZA 1BOAA 3PKBA 3MATA 4ZWUA 2Q96A 1WBQA 2GGBA 2EVMA 2ADUA 2EVOA 2GA2A 3L24A 3D27A 4PV4A 2BWXA 4S01A 4FO7A 2GG0A 3PKEA 2EVCA 2MATA 5CE6A 4IU6A 4ZWOA 4FUKA 1R5HA 5CDVA 1WKMA 4RZYA 2BN7A 1XGSA 2V3YA 5CNXA 5JI6A 4QR8A 1YW8A 4IKUA 5CDLA 4IPAA 3BIPA 1XGOA 1JAWA 4R60A 3Q6DA 2GTXA 1WN1A 4U1BA 4S2RP 4IKSA 2P9AA 1YW9A 2GG9A 4FKCA 3PKDA 2Q93A 2BHBA 3IU9A 3PKAA 1C24A 1Y1NA 4U6JA 1CHMA 1C21A 2GGCA 3CTZA 1W2MA 1C22A 1KQ0A 2Q8KA 2EA2A 3IU8A 4EGEA 2GU4A 3PKCA 3FMQA 4S00A 4U6WA 1MATA 4U6CA 2BWYA 2NQ6A 5CLSA 3FM3A 2GZ5A 3FMRA 4FLLA 4U73A 4JUQA 1WL9A 3CB6A 3IG4A 2IW2A 4RZZA 1WLRA 2Q95A 3TAVA 3BITA 4U69A 4IKTA 4U6ZA 1WL6A 4FLJA 1BN5A 2BWWA 1B59A 4PNCA 3MX6A 3RORA 4FO8A 2NQ7A 1KQ9A 5FCFA 4U75A 1W7VA 1QZYA 1N51A 4FLKA 1YJ3A 2GG8A 2BH3A 2GG2A 1O0XA 2G6PA 1R5GA 4IF7A 2B3KA 4ZNGA 3TB5A 1XGMA 2B3HA 4IECA 5D6FA 4IDYA 1A16A 2BB7A 2Q92A 3IU7A 5FCHA 3S6BA 2Q94A 2BHAA 5D6EA 1M35A 2OKNA 2GU5A 4U71A 2BWTA 1C23A 4U70A 4A6VA 2B3LA 2V3XA 2GG3A 3RVAA 4U76A 3MR1A 1KP0A 2BHDA 4MATA 2P98A 5CIKA 2BWVA 2GU6A 4IKRA 2V6CA 5CDEA 4U6EA 2ZSGA 1QXYA
chains in the Genus database with same CATH superfamily
1WY2A 2OAZA 2GG7A 1QXZA 2BHCA 2HOWA 1PV9A 1YVMA 1R58A 4KM3A 2P99A 1QXWA 3BIQA 5JHUA 2GU7A 2BWSA 2DFIA 5E5BA 4HXXA 4A6WA 4B28A 5JFRA 4Z7MA 4RGZ1 3CB5A 3L7GA 1B6AA 1YW7A 2EA4A 2GG5A 4FLIA 1C27A 1XGNA 4OOKA 4S2TP 1XNZA 4ZWPA 2BWUA 2V3ZA 1BOAA 3PKBA 3MATA 4ZWUA 2Q96A 1WBQA 2GGBA 2EVMA 2ADUA 2EVOA 2GA2A 3L24A 3D27A 4PV4A 2BWXA 4S01A 4FO7A 2GG0A 3PKEA 2EVCA 2MATA 5CE6A 4IU6A 4ZWOA 4FUKA 1R5HA 5CDVA 1WKMA 4RZYA 2BN7A 1XGSA 2V3YA 5CNXA 5JI6A 4QR8A 1YW8A 4IKUA 5CDLA 4IPAA 3BIPA 1XGOA 1JAWA 4R60A 3Q6DA 2GTXA 1WN1A 4U1BA 4S2RP 4IKSA 2P9AA 1YW9A 2GG9A 4FKCA 3PKDA 2Q93A 2BHBA 3IU9A 3PKAA 1C24A 1Y1NA 4U6JA 1CHMA 1C21A 2GGCA 3CTZA 1W2MA 1C22A 1KQ0A 2Q8KA 2EA2A 3IU8A 4EGEA 2GU4A 3PKCA 3FMQA 4S00A 4U6WA 1MATA 4U6CA 2BWYA 2NQ6A 5CLSA 3FM3A 2GZ5A 3FMRA 4FLLA 4U73A 4JUQA 1WL9A 3CB6A 3IG4A 2IW2A 4RZZA 1WLRA 2Q95A 3TAVA 3BITA 4U69A 4IKTA 4U6ZA 1WL6A 4FLJA 1BN5A 2BWWA 1B59A 4PNCA 3MX6A 3RORA 4FO8A 2NQ7A 1KQ9A 5FCFA 4U75A 1W7VA 1QZYA 1N51A 4FLKA 1YJ3A 2GG8A 2BH3A 2GG2A 1O0XA 2G6PA 1R5GA 4IF7A 2B3KA 4ZNGA 3TB5A 1XGMA 2B3HA 4IECA 5D6FA 4IDYA 1A16A 2BB7A 2Q92A 3IU7A 5FCHA 3S6BA 2Q94A 2BHAA 5D6EA 1M35A 2OKNA 2GU5A 4U71A 2BWTA 1C23A 4U70A 4A6VA 2B3LA 2V3XA 2GG3A 3RVAA 4U76A 3MR1A 1KP0A 2BHDA 4MATA 2P98A 5CIKA 2BWVA 2GU6A 4IKRA 2V6CA 5CDEA 4U6EA 2ZSGA 1QXYA
chains in the Genus database with same CATH topology
1WY2A 2OAZA 2GG7A 1QXZA 2BHCA 2HOWA 1PV9A 1YVMA 1R58A 4KM3A 2P99A 1QXWA 3BIQA 5JHUA 2GU7A 2BWSA 2DFIA 5E5BA 4HXXA 4A6WA 4B28A 5JFRA 4Z7MA 4RGZ1 3CB5A 3L7GA 1B6AA 1YW7A 2EA4A 2GG5A 4FLIA 1C27A 1XGNA 4OOKA 4S2TP 1XNZA 4ZWPA 2BWUA 2V3ZA 1BOAA 3PKBA 3MATA 4ZWUA 2Q96A 1WBQA 2GGBA 2EVMA 2ADUA 2EVOA 2GA2A 3L24A 3D27A 4PV4A 2BWXA 4S01A 4FO7A 2GG0A 3PKEA 2EVCA 2MATA 5CE6A 4IU6A 4ZWOA 4FUKA 1R5HA 5CDVA 1WKMA 4RZYA 2BN7A 1XGSA 2V3YA 5CNXA 5JI6A 4QR8A 1YW8A 4IKUA 5CDLA 4IPAA 3BIPA 1XGOA 1JAWA 4R60A 3Q6DA 2GTXA 1WN1A 4U1BA 4S2RP 4IKSA 2P9AA 1YW9A 2GG9A 4FKCA 3PKDA 2Q93A 2BHBA 3IU9A 3PKAA 1C24A 1Y1NA 4U6JA 1CHMA 1C21A 2GGCA 3CTZA 1W2MA 1C22A 1KQ0A 2Q8KA 2EA2A 3IU8A 4EGEA 2GU4A 3PKCA 3FMQA 4S00A 4U6WA 1MATA 4U6CA 2BWYA 2NQ6A 5CLSA 3FM3A 2GZ5A 3FMRA 4FLLA 4U73A 4JUQA 1WL9A 3CB6A 3IG4A 2IW2A 4RZZA 1WLRA 2Q95A 3TAVA 3BITA 4U69A 4IKTA 4U6ZA 1WL6A 4FLJA 1BN5A 2BWWA 1B59A 4PNCA 3MX6A 3RORA 4FO8A 2NQ7A 1KQ9A 5FCFA 4U75A 1W7VA 1QZYA 1N51A 4FLKA 1YJ3A 2GG8A 2BH3A 2GG2A 1O0XA 2G6PA 1R5GA 4IF7A 2B3KA 4ZNGA 3TB5A 1XGMA 2B3HA 4IECA 5D6FA 4IDYA 1A16A 2BB7A 2Q92A 3IU7A 5FCHA 3S6BA 2Q94A 2BHAA 5D6EA 1M35A 2OKNA 2GU5A 4U71A 2BWTA 1C23A 4U70A 4A6VA 2B3LA 2V3XA 2GG3A 3RVAA 4U76A 3MR1A 1KP0A 2BHDA 4MATA 2P98A 5CIKA 2BWVA 2GU6A 4IKRA 2V6CA 5CDEA 4U6EA 2ZSGA 1QXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WY2 A;  2OAZ A;  2GG7 A;  1QXZ A;  2BHC A;  2HOW A;  1PV9 A;  1YVM A;  1R58 A;  4KM3 A;  2P99 A;  1QXW A;  3BIQ A;  5JHU A;  2GU7 A;  2BWS A;  2DFI A;  5E5B A;  4HXX A;  4A6W A;  4B28 A;  5JFR A;  4Z7M A;  4RGZ 1;  3CB5 A;  3L7G A;  1B6A A;  1YW7 A;  2EA4 A;  2GG5 A;  4FLI A;  1C27 A;  1XGN A;  4OOK A;  4S2T P;  1XNZ A;  4ZWP A;  2BWU A;  2V3Z A;  1BOA A;  3PKB A;  3MAT A;  4ZWU A;  2Q96 A;  1WBQ A;  2GGB A;  2EVM A;  2ADU A;  2EVO A;  2GA2 A;  3L24 A;  3D27 A;  4PV4 A;  2BWX A;  4S01 A;  4FO7 A;  2GG0 A;  3PKE A;  2EVC A;  2MAT A;  5CE6 A;  4IU6 A;  4ZWO A;  4FUK A;  1R5H A;  5CDV A;  1WKM A;  4RZY A;  2BN7 A;  1XGS A;  2V3Y A;  5CNX A;  5JI6 A;  4QR8 A;  1YW8 A;  4IKU A;  5CDL A;  4IPA A;  3BIP A;  1XGO A;  1JAW A;  4R60 A;  3Q6D A;  2GTX A;  1WN1 A;  4U1B A;  4S2R P;  4IKS A;  2P9A A;  1YW9 A;  2GG9 A;  4FKC A;  3PKD A;  2Q93 A;  2BHB A;  3IU9 A;  3PKA A;  1C24 A;  1Y1N A;  4U6J A;  1CHM A;  1C21 A;  2GGC A;  3CTZ A;  1W2M A;  1C22 A;  1KQ0 A;  2Q8K A;  2EA2 A;  3IU8 A;  4EGE A;  2GU4 A;  3PKC A;  3FMQ A;  4S00 A;  4U6W A;  1MAT A;  4U6C A;  2BWY A;  2NQ6 A;  5CLS A;  3FM3 A;  2GZ5 A;  3FMR A;  4FLL A;  4U73 A;  4JUQ A;  1WL9 A;  3CB6 A;  3IG4 A;  2IW2 A;  4RZZ A;  1WLR A;  2Q95 A;  3TAV A;  3BIT A;  4U69 A;  4IKT A;  4U6Z A;  1WL6 A;  4FLJ A;  1BN5 A;  2BWW A;  1B59 A;  4PNC A;  3MX6 A;  3ROR A;  4FO8 A;  2NQ7 A;  1KQ9 A;  5FCF A;  4U75 A;  1W7V A;  1QZY A;  1N51 A;  4FLK A;  1YJ3 A;  2GG8 A;  2BH3 A;  2GG2 A;  1O0X A;  2G6P A;  1R5G A;  4IF7 A;  2B3K A;  4ZNG A;  3TB5 A;  1XGM A;  2B3H A;  4IEC A;  5D6F A;  4IDY A;  1A16 A;  2BB7 A;  2Q92 A;  3IU7 A;  5FCH A;  3S6B A;  2Q94 A;  2BHA A;  5D6E A;  1M35 A;  2OKN A;  2GU5 A;  4U71 A;  2BWT A;  1C23 A;  4U70 A;  4A6V A;  2B3L A;  2V3X A;  2GG3 A;  3RVA A;  4U76 A;  3MR1 A;  1KP0 A;  2BHD A;  4MAT A;  2P98 A;  5CIK A;  2BWV A;  2GU6 A;  4IKR A;  2V6C A;  5CDE A;  4U6E A;  2ZSG A;  1QXY A; 
#chains in the Genus database with same CATH topology
 1WY2 A;  2OAZ A;  2GG7 A;  1QXZ A;  2BHC A;  2HOW A;  1PV9 A;  1YVM A;  1R58 A;  4KM3 A;  2P99 A;  1QXW A;  3BIQ A;  5JHU A;  2GU7 A;  2BWS A;  2DFI A;  5E5B A;  4HXX A;  4A6W A;  4B28 A;  5JFR A;  4Z7M A;  4RGZ 1;  3CB5 A;  3L7G A;  1B6A A;  1YW7 A;  2EA4 A;  2GG5 A;  4FLI A;  1C27 A;  1XGN A;  4OOK A;  4S2T P;  1XNZ A;  4ZWP A;  2BWU A;  2V3Z A;  1BOA A;  3PKB A;  3MAT A;  4ZWU A;  2Q96 A;  1WBQ A;  2GGB A;  2EVM A;  2ADU A;  2EVO A;  2GA2 A;  3L24 A;  3D27 A;  4PV4 A;  2BWX A;  4S01 A;  4FO7 A;  2GG0 A;  3PKE A;  2EVC A;  2MAT A;  5CE6 A;  4IU6 A;  4ZWO A;  4FUK A;  1R5H A;  5CDV A;  1WKM A;  4RZY A;  2BN7 A;  1XGS A;  2V3Y A;  5CNX A;  5JI6 A;  4QR8 A;  1YW8 A;  4IKU A;  5CDL A;  4IPA A;  3BIP A;  1XGO A;  1JAW A;  4R60 A;  3Q6D A;  2GTX A;  1WN1 A;  4U1B A;  4S2R P;  4IKS A;  2P9A A;  1YW9 A;  2GG9 A;  4FKC A;  3PKD A;  2Q93 A;  2BHB A;  3IU9 A;  3PKA A;  1C24 A;  1Y1N A;  4U6J A;  1CHM A;  1C21 A;  2GGC A;  3CTZ A;  1W2M A;  1C22 A;  1KQ0 A;  2Q8K A;  2EA2 A;  3IU8 A;  4EGE A;  2GU4 A;  3PKC A;  3FMQ A;  4S00 A;  4U6W A;  1MAT A;  4U6C A;  2BWY A;  2NQ6 A;  5CLS A;  3FM3 A;  2GZ5 A;  3FMR A;  4FLL A;  4U73 A;  4JUQ A;  1WL9 A;  3CB6 A;  3IG4 A;  2IW2 A;  4RZZ A;  1WLR A;  2Q95 A;  3TAV A;  3BIT A;  4U69 A;  4IKT A;  4U6Z A;  1WL6 A;  4FLJ A;  1BN5 A;  2BWW A;  1B59 A;  4PNC A;  3MX6 A;  3ROR A;  4FO8 A;  2NQ7 A;  1KQ9 A;  5FCF A;  4U75 A;  1W7V A;  1QZY A;  1N51 A;  4FLK A;  1YJ3 A;  2GG8 A;  2BH3 A;  2GG2 A;  1O0X A;  2G6P A;  1R5G A;  4IF7 A;  2B3K A;  4ZNG A;  3TB5 A;  1XGM A;  2B3H A;  4IEC A;  5D6F A;  4IDY A;  1A16 A;  2BB7 A;  2Q92 A;  3IU7 A;  5FCH A;  3S6B A;  2Q94 A;  2BHA A;  5D6E A;  1M35 A;  2OKN A;  2GU5 A;  4U71 A;  2BWT A;  1C23 A;  4U70 A;  4A6V A;  2B3L A;  2V3X A;  2GG3 A;  3RVA A;  4U76 A;  3MR1 A;  1KP0 A;  2BHD A;  4MAT A;  2P98 A;  5CIK A;  2BWV A;  2GU6 A;  4IKR A;  2V6C A;  5CDE A;  4U6E A;  2ZSG A;  1QXY A; 
#chains in the Genus database with same CATH homology
 1WY2 A;  2OAZ A;  2GG7 A;  1QXZ A;  2BHC A;  2HOW A;  1PV9 A;  1YVM A;  1R58 A;  4KM3 A;  2P99 A;  1QXW A;  3BIQ A;  5JHU A;  2GU7 A;  2BWS A;  2DFI A;  5E5B A;  4HXX A;  4A6W A;  4B28 A;  5JFR A;  4Z7M A;  4RGZ 1;  3CB5 A;  3L7G A;  1B6A A;  1YW7 A;  2EA4 A;  2GG5 A;  4FLI A;  1C27 A;  1XGN A;  4OOK A;  4S2T P;  1XNZ A;  4ZWP A;  2BWU A;  2V3Z A;  1BOA A;  3PKB A;  3MAT A;  4ZWU A;  2Q96 A;  1WBQ A;  2GGB A;  2EVM A;  2ADU A;  2EVO A;  2GA2 A;  3L24 A;  3D27 A;  4PV4 A;  2BWX A;  4S01 A;  4FO7 A;  2GG0 A;  3PKE A;  2EVC A;  2MAT A;  5CE6 A;  4IU6 A;  4ZWO A;  4FUK A;  1R5H A;  5CDV A;  1WKM A;  4RZY A;  2BN7 A;  1XGS A;  2V3Y A;  5CNX A;  5JI6 A;  4QR8 A;  1YW8 A;  4IKU A;  5CDL A;  4IPA A;  3BIP A;  1XGO A;  1JAW A;  4R60 A;  3Q6D A;  2GTX A;  1WN1 A;  4U1B A;  4S2R P;  4IKS A;  2P9A A;  1YW9 A;  2GG9 A;  4FKC A;  3PKD A;  2Q93 A;  2BHB A;  3IU9 A;  3PKA A;  1C24 A;  1Y1N A;  4U6J A;  1CHM A;  1C21 A;  2GGC A;  3CTZ A;  1W2M A;  1C22 A;  1KQ0 A;  2Q8K A;  2EA2 A;  3IU8 A;  4EGE A;  2GU4 A;  3PKC A;  3FMQ A;  4S00 A;  4U6W A;  1MAT A;  4U6C A;  2BWY A;  2NQ6 A;  5CLS A;  3FM3 A;  2GZ5 A;  3FMR A;  4FLL A;  4U73 A;  4JUQ A;  1WL9 A;  3CB6 A;  3IG4 A;  2IW2 A;  4RZZ A;  1WLR A;  2Q95 A;  3TAV A;  3BIT A;  4U69 A;  4IKT A;  4U6Z A;  1WL6 A;  4FLJ A;  1BN5 A;  2BWW A;  1B59 A;  4PNC A;  3MX6 A;  3ROR A;  4FO8 A;  2NQ7 A;  1KQ9 A;  5FCF A;  4U75 A;  1W7V A;  1QZY A;  1N51 A;  4FLK A;  1YJ3 A;  2GG8 A;  2BH3 A;  2GG2 A;  1O0X A;  2G6P A;  1R5G A;  4IF7 A;  2B3K A;  4ZNG A;  3TB5 A;  1XGM A;  2B3H A;  4IEC A;  5D6F A;  4IDY A;  1A16 A;  2BB7 A;  2Q92 A;  3IU7 A;  5FCH A;  3S6B A;  2Q94 A;  2BHA A;  5D6E A;  1M35 A;  2OKN A;  2GU5 A;  4U71 A;  2BWT A;  1C23 A;  4U70 A;  4A6V A;  2B3L A;  2V3X A;  2GG3 A;  3RVA A;  4U76 A;  3MR1 A;  1KP0 A;  2BHD A;  4MAT A;  2P98 A;  5CIK A;  2BWV A;  2GU6 A;  4IKR A;  2V6C A;  5CDE A;  4U6E A;  2ZSG A;  1QXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...