2GG8A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg8A00
1BN5A 2P9AA 2GG9A 1XNZA 4U69A 1BOAA 4S00A 2BWXA 2IW2A 2P99A 1R5HA 3MX6A 3PKDA 4U73A 5D6FA 1QXWA 3FMQA 2BB7A 1YW8A 2EVCA 3CB6A 1WBQA 1XGMA 2G6PA 1QXZA 4FLLA 2GTXA 5CE6A 5FCHA 5JHUA 1KQ9A 1A16A 1B59A 2GG5A 5CNXA 1C23A 1M35A 2NQ6A 3IG4A 4U70A 1CHMA 3L7GA 4U6CA 2GGBA 4R60A 2NQ7A 3CTZA 1XGSA 4IDYA 4KM3A 2GG3A 4S01A 2ADUA 1C22A 4FLIA 1MATA 2V3XA 1C21A 2B3HA 2EVMA 1QZYA 1WKMA 2Q94A 4RZYA 5CDLA 5JI6A 1Y1NA 2BN7A 4ZWOA 4U71A 4IPAA 1WL6A 1XGOA 2Q93A 2B3LA 3L24A 4PV4A 4RGZ1 4S2RP 4RZZA 2GA2A 3BIPA 5D6EA 4U1BA 1QXYA 2V3YA 5CIKA 4IKRA 4B28A 2GG8A 1W7VA 1WL9A 4A6WA 3FMRA 4IKTA 1O0XA 5CDEA 2EA4A 2GG2A 3TAVA 2EVOA 2OAZA 1N51A 4IF7A 2P98A 4FLJA 1KQ0A 2GU7A 4IECA 4Z7MA 2Q8KA 2DFIA 4OOKA 4U6ZA 3MATA 4S2TP 1JAWA 2BWWA 1C24A 3PKCA 2V6CA 1YVMA 4HXXA 2BWTA 2BWYA 3IU7A 3Q6DA 4ZWUA 2GGCA 2EA2A 1KP0A 1PV9A 4PNCA 1WY2A 2BWUA 2OKNA 1WN1A 2GU5A 3RORA 1W2MA 3MR1A 1YW7A 4IKUA 3S6BA 1R5GA 5CDVA 3BITA 2BWSA 3TB5A 2Q96A 3CB5A 1XGNA 4U75A 2V3ZA 2GU6A 2GZ5A 3BIQA 4FLKA 2MATA 4U6JA 4A6VA 4FUKA 4MATA 2BH3A 2BHDA 5FCFA 1R58A 4IKSA 2GU4A 2ZSGA 5E5BA 3PKEA 1B6AA 4FO7A 3RVAA 2HOWA 2BHCA 4ZWPA 4FO8A 2Q95A 3PKBA 1YJ3A 4ZNGA 3IU9A 2B3KA 1YW9A 4QR8A 2BWVA 2BHBA 1WLRA 4U76A 3D27A 2GG0A 4U6EA 3PKAA 4IU6A 4JUQA 3FM3A 4U6WA 3IU8A 5JFRA 4FKCA 5CLSA 2Q92A 2GG7A 4EGEA 1C27A 2BHAA
chains in the Genus database with same CATH superfamily
1BN5A 2P9AA 2GG9A 1XNZA 4U69A 1BOAA 4S00A 2BWXA 2IW2A 2P99A 1R5HA 3MX6A 3PKDA 4U73A 5D6FA 1QXWA 3FMQA 2BB7A 1YW8A 2EVCA 3CB6A 1WBQA 1XGMA 2G6PA 1QXZA 4FLLA 2GTXA 5CE6A 5FCHA 5JHUA 1KQ9A 1A16A 1B59A 2GG5A 5CNXA 1C23A 1M35A 2NQ6A 3IG4A 4U70A 1CHMA 3L7GA 4U6CA 2GGBA 4R60A 2NQ7A 3CTZA 1XGSA 4IDYA 4KM3A 2GG3A 4S01A 2ADUA 1C22A 4FLIA 1MATA 2V3XA 1C21A 2B3HA 2EVMA 1QZYA 1WKMA 2Q94A 4RZYA 5CDLA 5JI6A 1Y1NA 2BN7A 4ZWOA 4U71A 4IPAA 1WL6A 1XGOA 2Q93A 2B3LA 3L24A 4PV4A 4RGZ1 4S2RP 4RZZA 2GA2A 3BIPA 5D6EA 4U1BA 1QXYA 2V3YA 5CIKA 4IKRA 4B28A 2GG8A 1W7VA 1WL9A 4A6WA 3FMRA 4IKTA 1O0XA 5CDEA 2EA4A 2GG2A 3TAVA 2EVOA 2OAZA 1N51A 4IF7A 2P98A 4FLJA 1KQ0A 2GU7A 4IECA 4Z7MA 2Q8KA 2DFIA 4OOKA 4U6ZA 3MATA 4S2TP 1JAWA 2BWWA 1C24A 3PKCA 2V6CA 1YVMA 4HXXA 2BWTA 2BWYA 3IU7A 3Q6DA 4ZWUA 2GGCA 2EA2A 1KP0A 1PV9A 4PNCA 1WY2A 2BWUA 2OKNA 1WN1A 2GU5A 3RORA 1W2MA 3MR1A 1YW7A 4IKUA 3S6BA 1R5GA 5CDVA 3BITA 2BWSA 3TB5A 2Q96A 3CB5A 1XGNA 4U75A 2V3ZA 2GU6A 2GZ5A 3BIQA 4FLKA 2MATA 4U6JA 4A6VA 4FUKA 4MATA 2BH3A 2BHDA 5FCFA 1R58A 4IKSA 2GU4A 2ZSGA 5E5BA 3PKEA 1B6AA 4FO7A 3RVAA 2HOWA 2BHCA 4ZWPA 4FO8A 2Q95A 3PKBA 1YJ3A 4ZNGA 3IU9A 2B3KA 1YW9A 4QR8A 2BWVA 2BHBA 1WLRA 4U76A 3D27A 2GG0A 4U6EA 3PKAA 4IU6A 4JUQA 3FM3A 4U6WA 3IU8A 5JFRA 4FKCA 5CLSA 2Q92A 2GG7A 4EGEA 1C27A 2BHAA
chains in the Genus database with same CATH topology
1BN5A 2P9AA 2GG9A 1XNZA 4U69A 1BOAA 4S00A 2BWXA 2IW2A 2P99A 1R5HA 3MX6A 3PKDA 4U73A 5D6FA 1QXWA 3FMQA 2BB7A 1YW8A 2EVCA 3CB6A 1WBQA 1XGMA 2G6PA 1QXZA 4FLLA 2GTXA 5CE6A 5FCHA 5JHUA 1KQ9A 1A16A 1B59A 2GG5A 5CNXA 1C23A 1M35A 2NQ6A 3IG4A 4U70A 1CHMA 3L7GA 4U6CA 2GGBA 4R60A 2NQ7A 3CTZA 1XGSA 4IDYA 4KM3A 2GG3A 4S01A 2ADUA 1C22A 4FLIA 1MATA 2V3XA 1C21A 2B3HA 2EVMA 1QZYA 1WKMA 2Q94A 4RZYA 5CDLA 5JI6A 1Y1NA 2BN7A 4ZWOA 4U71A 4IPAA 1WL6A 1XGOA 2Q93A 2B3LA 3L24A 4PV4A 4RGZ1 4S2RP 4RZZA 2GA2A 3BIPA 5D6EA 4U1BA 1QXYA 2V3YA 5CIKA 4IKRA 4B28A 2GG8A 1W7VA 1WL9A 4A6WA 3FMRA 4IKTA 1O0XA 5CDEA 2EA4A 2GG2A 3TAVA 2EVOA 2OAZA 1N51A 4IF7A 2P98A 4FLJA 1KQ0A 2GU7A 4IECA 4Z7MA 2Q8KA 2DFIA 4OOKA 4U6ZA 3MATA 4S2TP 1JAWA 2BWWA 1C24A 3PKCA 2V6CA 1YVMA 4HXXA 2BWTA 2BWYA 3IU7A 3Q6DA 4ZWUA 2GGCA 2EA2A 1KP0A 1PV9A 4PNCA 1WY2A 2BWUA 2OKNA 1WN1A 2GU5A 3RORA 1W2MA 3MR1A 1YW7A 4IKUA 3S6BA 1R5GA 5CDVA 3BITA 2BWSA 3TB5A 2Q96A 3CB5A 1XGNA 4U75A 2V3ZA 2GU6A 2GZ5A 3BIQA 4FLKA 2MATA 4U6JA 4A6VA 4FUKA 4MATA 2BH3A 2BHDA 5FCFA 1R58A 4IKSA 2GU4A 2ZSGA 5E5BA 3PKEA 1B6AA 4FO7A 3RVAA 2HOWA 2BHCA 4ZWPA 4FO8A 2Q95A 3PKBA 1YJ3A 4ZNGA 3IU9A 2B3KA 1YW9A 4QR8A 2BWVA 2BHBA 1WLRA 4U76A 3D27A 2GG0A 4U6EA 3PKAA 4IU6A 4JUQA 3FM3A 4U6WA 3IU8A 5JFRA 4FKCA 5CLSA 2Q92A 2GG7A 4EGEA 1C27A 2BHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN5 A;  2P9A A;  2GG9 A;  1XNZ A;  4U69 A;  1BOA A;  4S00 A;  2BWX A;  2IW2 A;  2P99 A;  1R5H A;  3MX6 A;  3PKD A;  4U73 A;  5D6F A;  1QXW A;  3FMQ A;  2BB7 A;  1YW8 A;  2EVC A;  3CB6 A;  1WBQ A;  1XGM A;  2G6P A;  1QXZ A;  4FLL A;  2GTX A;  5CE6 A;  5FCH A;  5JHU A;  1KQ9 A;  1A16 A;  1B59 A;  2GG5 A;  5CNX A;  1C23 A;  1M35 A;  2NQ6 A;  3IG4 A;  4U70 A;  1CHM A;  3L7G A;  4U6C A;  2GGB A;  4R60 A;  2NQ7 A;  3CTZ A;  1XGS A;  4IDY A;  4KM3 A;  2GG3 A;  4S01 A;  2ADU A;  1C22 A;  4FLI A;  1MAT A;  2V3X A;  1C21 A;  2B3H A;  2EVM A;  1QZY A;  1WKM A;  2Q94 A;  4RZY A;  5CDL A;  5JI6 A;  1Y1N A;  2BN7 A;  4ZWO A;  4U71 A;  4IPA A;  1WL6 A;  1XGO A;  2Q93 A;  2B3L A;  3L24 A;  4PV4 A;  4RGZ 1;  4S2R P;  4RZZ A;  2GA2 A;  3BIP A;  5D6E A;  4U1B A;  1QXY A;  2V3Y A;  5CIK A;  4IKR A;  4B28 A;  2GG8 A;  1W7V A;  1WL9 A;  4A6W A;  3FMR A;  4IKT A;  1O0X A;  5CDE A;  2EA4 A;  2GG2 A;  3TAV A;  2EVO A;  2OAZ A;  1N51 A;  4IF7 A;  2P98 A;  4FLJ A;  1KQ0 A;  2GU7 A;  4IEC A;  4Z7M A;  2Q8K A;  2DFI A;  4OOK A;  4U6Z A;  3MAT A;  4S2T P;  1JAW A;  2BWW A;  1C24 A;  3PKC A;  2V6C A;  1YVM A;  4HXX A;  2BWT A;  2BWY A;  3IU7 A;  3Q6D A;  4ZWU A;  2GGC A;  2EA2 A;  1KP0 A;  1PV9 A;  4PNC A;  1WY2 A;  2BWU A;  2OKN A;  1WN1 A;  2GU5 A;  3ROR A;  1W2M A;  3MR1 A;  1YW7 A;  4IKU A;  3S6B A;  1R5G A;  5CDV A;  3BIT A;  2BWS A;  3TB5 A;  2Q96 A;  3CB5 A;  1XGN A;  4U75 A;  2V3Z A;  2GU6 A;  2GZ5 A;  3BIQ A;  4FLK A;  2MAT A;  4U6J A;  4A6V A;  4FUK A;  4MAT A;  2BH3 A;  2BHD A;  5FCF A;  1R58 A;  4IKS A;  2GU4 A;  2ZSG A;  5E5B A;  3PKE A;  1B6A A;  4FO7 A;  3RVA A;  2HOW A;  2BHC A;  4ZWP A;  4FO8 A;  2Q95 A;  3PKB A;  1YJ3 A;  4ZNG A;  3IU9 A;  2B3K A;  1YW9 A;  4QR8 A;  2BWV A;  2BHB A;  1WLR A;  4U76 A;  3D27 A;  2GG0 A;  4U6E A;  3PKA A;  4IU6 A;  4JUQ A;  3FM3 A;  4U6W A;  3IU8 A;  5JFR A;  4FKC A;  5CLS A;  2Q92 A;  2GG7 A;  4EGE A;  1C27 A;  2BHA A; 
#chains in the Genus database with same CATH topology
 1BN5 A;  2P9A A;  2GG9 A;  1XNZ A;  4U69 A;  1BOA A;  4S00 A;  2BWX A;  2IW2 A;  2P99 A;  1R5H A;  3MX6 A;  3PKD A;  4U73 A;  5D6F A;  1QXW A;  3FMQ A;  2BB7 A;  1YW8 A;  2EVC A;  3CB6 A;  1WBQ A;  1XGM A;  2G6P A;  1QXZ A;  4FLL A;  2GTX A;  5CE6 A;  5FCH A;  5JHU A;  1KQ9 A;  1A16 A;  1B59 A;  2GG5 A;  5CNX A;  1C23 A;  1M35 A;  2NQ6 A;  3IG4 A;  4U70 A;  1CHM A;  3L7G A;  4U6C A;  2GGB A;  4R60 A;  2NQ7 A;  3CTZ A;  1XGS A;  4IDY A;  4KM3 A;  2GG3 A;  4S01 A;  2ADU A;  1C22 A;  4FLI A;  1MAT A;  2V3X A;  1C21 A;  2B3H A;  2EVM A;  1QZY A;  1WKM A;  2Q94 A;  4RZY A;  5CDL A;  5JI6 A;  1Y1N A;  2BN7 A;  4ZWO A;  4U71 A;  4IPA A;  1WL6 A;  1XGO A;  2Q93 A;  2B3L A;  3L24 A;  4PV4 A;  4RGZ 1;  4S2R P;  4RZZ A;  2GA2 A;  3BIP A;  5D6E A;  4U1B A;  1QXY A;  2V3Y A;  5CIK A;  4IKR A;  4B28 A;  2GG8 A;  1W7V A;  1WL9 A;  4A6W A;  3FMR A;  4IKT A;  1O0X A;  5CDE A;  2EA4 A;  2GG2 A;  3TAV A;  2EVO A;  2OAZ A;  1N51 A;  4IF7 A;  2P98 A;  4FLJ A;  1KQ0 A;  2GU7 A;  4IEC A;  4Z7M A;  2Q8K A;  2DFI A;  4OOK A;  4U6Z A;  3MAT A;  4S2T P;  1JAW A;  2BWW A;  1C24 A;  3PKC A;  2V6C A;  1YVM A;  4HXX A;  2BWT A;  2BWY A;  3IU7 A;  3Q6D A;  4ZWU A;  2GGC A;  2EA2 A;  1KP0 A;  1PV9 A;  4PNC A;  1WY2 A;  2BWU A;  2OKN A;  1WN1 A;  2GU5 A;  3ROR A;  1W2M A;  3MR1 A;  1YW7 A;  4IKU A;  3S6B A;  1R5G A;  5CDV A;  3BIT A;  2BWS A;  3TB5 A;  2Q96 A;  3CB5 A;  1XGN A;  4U75 A;  2V3Z A;  2GU6 A;  2GZ5 A;  3BIQ A;  4FLK A;  2MAT A;  4U6J A;  4A6V A;  4FUK A;  4MAT A;  2BH3 A;  2BHD A;  5FCF A;  1R58 A;  4IKS A;  2GU4 A;  2ZSG A;  5E5B A;  3PKE A;  1B6A A;  4FO7 A;  3RVA A;  2HOW A;  2BHC A;  4ZWP A;  4FO8 A;  2Q95 A;  3PKB A;  1YJ3 A;  4ZNG A;  3IU9 A;  2B3K A;  1YW9 A;  4QR8 A;  2BWV A;  2BHB A;  1WLR A;  4U76 A;  3D27 A;  2GG0 A;  4U6E A;  3PKA A;  4IU6 A;  4JUQ A;  3FM3 A;  4U6W A;  3IU8 A;  5JFR A;  4FKC A;  5CLS A;  2Q92 A;  2GG7 A;  4EGE A;  1C27 A;  2BHA A; 
#chains in the Genus database with same CATH homology
 1BN5 A;  2P9A A;  2GG9 A;  1XNZ A;  4U69 A;  1BOA A;  4S00 A;  2BWX A;  2IW2 A;  2P99 A;  1R5H A;  3MX6 A;  3PKD A;  4U73 A;  5D6F A;  1QXW A;  3FMQ A;  2BB7 A;  1YW8 A;  2EVC A;  3CB6 A;  1WBQ A;  1XGM A;  2G6P A;  1QXZ A;  4FLL A;  2GTX A;  5CE6 A;  5FCH A;  5JHU A;  1KQ9 A;  1A16 A;  1B59 A;  2GG5 A;  5CNX A;  1C23 A;  1M35 A;  2NQ6 A;  3IG4 A;  4U70 A;  1CHM A;  3L7G A;  4U6C A;  2GGB A;  4R60 A;  2NQ7 A;  3CTZ A;  1XGS A;  4IDY A;  4KM3 A;  2GG3 A;  4S01 A;  2ADU A;  1C22 A;  4FLI A;  1MAT A;  2V3X A;  1C21 A;  2B3H A;  2EVM A;  1QZY A;  1WKM A;  2Q94 A;  4RZY A;  5CDL A;  5JI6 A;  1Y1N A;  2BN7 A;  4ZWO A;  4U71 A;  4IPA A;  1WL6 A;  1XGO A;  2Q93 A;  2B3L A;  3L24 A;  4PV4 A;  4RGZ 1;  4S2R P;  4RZZ A;  2GA2 A;  3BIP A;  5D6E A;  4U1B A;  1QXY A;  2V3Y A;  5CIK A;  4IKR A;  4B28 A;  2GG8 A;  1W7V A;  1WL9 A;  4A6W A;  3FMR A;  4IKT A;  1O0X A;  5CDE A;  2EA4 A;  2GG2 A;  3TAV A;  2EVO A;  2OAZ A;  1N51 A;  4IF7 A;  2P98 A;  4FLJ A;  1KQ0 A;  2GU7 A;  4IEC A;  4Z7M A;  2Q8K A;  2DFI A;  4OOK A;  4U6Z A;  3MAT A;  4S2T P;  1JAW A;  2BWW A;  1C24 A;  3PKC A;  2V6C A;  1YVM A;  4HXX A;  2BWT A;  2BWY A;  3IU7 A;  3Q6D A;  4ZWU A;  2GGC A;  2EA2 A;  1KP0 A;  1PV9 A;  4PNC A;  1WY2 A;  2BWU A;  2OKN A;  1WN1 A;  2GU5 A;  3ROR A;  1W2M A;  3MR1 A;  1YW7 A;  4IKU A;  3S6B A;  1R5G A;  5CDV A;  3BIT A;  2BWS A;  3TB5 A;  2Q96 A;  3CB5 A;  1XGN A;  4U75 A;  2V3Z A;  2GU6 A;  2GZ5 A;  3BIQ A;  4FLK A;  2MAT A;  4U6J A;  4A6V A;  4FUK A;  4MAT A;  2BH3 A;  2BHD A;  5FCF A;  1R58 A;  4IKS A;  2GU4 A;  2ZSG A;  5E5B A;  3PKE A;  1B6A A;  4FO7 A;  3RVA A;  2HOW A;  2BHC A;  4ZWP A;  4FO8 A;  2Q95 A;  3PKB A;  1YJ3 A;  4ZNG A;  3IU9 A;  2B3K A;  1YW9 A;  4QR8 A;  2BWV A;  2BHB A;  1WLR A;  4U76 A;  3D27 A;  2GG0 A;  4U6E A;  3PKA A;  4IU6 A;  4JUQ A;  3FM3 A;  4U6W A;  3IU8 A;  5JFR A;  4FKC A;  5CLS A;  2Q92 A;  2GG7 A;  4EGE A;  1C27 A;  2BHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...