2GG8A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
molecule tags Hydrolase
source organism Escherichia coli k12
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
total genus 88
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg8A00
2GZ5A 5JI6A 2BN7A 2BWYA 1XGOA 1QXYA 5CE6A 2BHBA 4IPAA 2V3YA 2BWSA 5FCHA 4ZWUA 4S2TP 3S6BA 4HXXA 1B59A 2GG9A 1PV9A 1WLRA 2GG0A 1YW9A 1R5HA 2BHAA 2Q96A 4S2RP 4U6ZA 3TB5A 5FCFA 2OKNA 1W2MA 1C27A 1M35A 2Q95A 2P98A 4U76A 4FLJA 2GU4A 1XGMA 2P99A 1YVMA 5CLSA 4EGEA 4MATA 4QR8A 1WBQA 2HOWA 1C24A 3CB6A 2GG5A 1R58A 3PKBA 4OOKA 2V3XA 2BHDA 2MATA 4A6VA 1KQ0A 2V6CA 2Q8KA 2BWTA 5CIKA 3RVAA 3MATA 1Y1NA 4B28A 4IDYA 4RZYA 2Q93A 2P9AA 3IU9A 2NQ7A 3MR1A 1WL6A 4JUQA 3FMQA 1BOAA 3CTZA 3FM3A 3PKDA 5E5BA 4FO8A 3PKAA 2BWWA 3BIPA 2B3LA 5CDVA 2GG2A 2BWVA 4RZZA 2Q94A 3RORA 2GU6A 5JHUA 1YW8A 4ZWOA 1WKMA 2V3ZA 1XGSA 3BIQA 3L7GA 4FO7A 4R60A 1QZYA 4PNCA 5CNXA 2IW2A 4A6WA 2GG3A 2Q92A 5D6EA 2BWUA 3BITA 2GG7A 4KM3A 1B6AA 2B3KA 4U1BA 4IKTA 4U75A 5D6FA 2OAZA 1JAWA 2NQ6A 1CHMA 2EVMA 4RGZ1 1XGNA 4S01A 4U6CA 4ZNGA 1XNZA 1KQ9A 4U6JA 4U71A 4U6WA 5CDLA 1WL9A 1WN1A 1WY2A 1MATA 2G6PA 2GGBA 3IU8A 4IKSA 4U69A 2GTXA 3MX6A 4IF7A 3CB5A 1R5GA 3IU7A 4IU6A 4FKCA 2ADUA 2BB7A 1W7VA 1BN5A 1KP0A 2EVCA 4ZWPA 4FLKA 2DFIA 3L24A 4S00A 1QXZA 4U73A 5CDEA 4FUKA 1QXWA 2GA2A 4FLIA 2EVOA 2GU7A 3FMRA 4PV4A 5JFRA 4IKRA 2EA4A 2BWXA 4FLLA 1N51A 4IKUA 4IECA 2BH3A 3PKEA 1C22A 3TAVA 1YJ3A 2GGCA 2GU5A 1A16A 3IG4A 3Q6DA 4U70A 1YW7A 4U6EA 2B3HA 1C21A 2BHCA 3D27A 3PKCA 1C23A 4Z7MA 2EA2A 2GG8A 1O0XA 2ZSGA
chains in the Genus database with same CATH superfamily
2GZ5A 5JI6A 2BN7A 2BWYA 1XGOA 1QXYA 5CE6A 2BHBA 4IPAA 2V3YA 2BWSA 5FCHA 4ZWUA 4S2TP 3S6BA 4HXXA 1B59A 2GG9A 1PV9A 1WLRA 2GG0A 1YW9A 1R5HA 2BHAA 2Q96A 4S2RP 4U6ZA 3TB5A 5FCFA 2OKNA 1W2MA 1C27A 1M35A 2Q95A 2P98A 4U76A 4FLJA 2GU4A 1XGMA 2P99A 1YVMA 5CLSA 4EGEA 4MATA 4QR8A 1WBQA 2HOWA 1C24A 3CB6A 2GG5A 1R58A 3PKBA 4OOKA 2V3XA 2BHDA 2MATA 4A6VA 1KQ0A 2V6CA 2Q8KA 2BWTA 5CIKA 3RVAA 3MATA 1Y1NA 4B28A 4IDYA 4RZYA 2Q93A 2P9AA 3IU9A 2NQ7A 3MR1A 1WL6A 4JUQA 3FMQA 1BOAA 3CTZA 3FM3A 3PKDA 5E5BA 4FO8A 3PKAA 2BWWA 3BIPA 2B3LA 5CDVA 2GG2A 2BWVA 4RZZA 2Q94A 3RORA 2GU6A 5JHUA 1YW8A 4ZWOA 1WKMA 2V3ZA 1XGSA 3BIQA 3L7GA 4FO7A 4R60A 1QZYA 4PNCA 5CNXA 2IW2A 4A6WA 2GG3A 2Q92A 5D6EA 2BWUA 3BITA 2GG7A 4KM3A 1B6AA 2B3KA 4U1BA 4IKTA 4U75A 5D6FA 2OAZA 1JAWA 2NQ6A 1CHMA 2EVMA 4RGZ1 1XGNA 4S01A 4U6CA 4ZNGA 1XNZA 1KQ9A 4U6JA 4U71A 4U6WA 5CDLA 1WL9A 1WN1A 1WY2A 1MATA 2G6PA 2GGBA 3IU8A 4IKSA 4U69A 2GTXA 3MX6A 4IF7A 3CB5A 1R5GA 3IU7A 4IU6A 4FKCA 2ADUA 2BB7A 1W7VA 1BN5A 1KP0A 2EVCA 4ZWPA 4FLKA 2DFIA 3L24A 4S00A 1QXZA 4U73A 5CDEA 4FUKA 1QXWA 2GA2A 4FLIA 2EVOA 2GU7A 3FMRA 4PV4A 5JFRA 4IKRA 2EA4A 2BWXA 4FLLA 1N51A 4IKUA 4IECA 2BH3A 3PKEA 1C22A 3TAVA 1YJ3A 2GGCA 2GU5A 1A16A 3IG4A 3Q6DA 4U70A 1YW7A 4U6EA 2B3HA 1C21A 2BHCA 3D27A 3PKCA 1C23A 4Z7MA 2EA2A 2GG8A 1O0XA 2ZSGA
chains in the Genus database with same CATH topology
2GZ5A 5JI6A 2BN7A 2BWYA 1XGOA 1QXYA 5CE6A 2BHBA 4IPAA 2V3YA 2BWSA 5FCHA 4ZWUA 4S2TP 3S6BA 4HXXA 1B59A 2GG9A 1PV9A 1WLRA 2GG0A 1YW9A 1R5HA 2BHAA 2Q96A 4S2RP 4U6ZA 3TB5A 5FCFA 2OKNA 1W2MA 1C27A 1M35A 2Q95A 2P98A 4U76A 4FLJA 2GU4A 1XGMA 2P99A 1YVMA 5CLSA 4EGEA 4MATA 4QR8A 1WBQA 2HOWA 1C24A 3CB6A 2GG5A 1R58A 3PKBA 4OOKA 2V3XA 2BHDA 2MATA 4A6VA 1KQ0A 2V6CA 2Q8KA 2BWTA 5CIKA 3RVAA 3MATA 1Y1NA 4B28A 4IDYA 4RZYA 2Q93A 2P9AA 3IU9A 2NQ7A 3MR1A 1WL6A 4JUQA 3FMQA 1BOAA 3CTZA 3FM3A 3PKDA 5E5BA 4FO8A 3PKAA 2BWWA 3BIPA 2B3LA 5CDVA 2GG2A 2BWVA 4RZZA 2Q94A 3RORA 2GU6A 5JHUA 1YW8A 4ZWOA 1WKMA 2V3ZA 1XGSA 3BIQA 3L7GA 4FO7A 4R60A 1QZYA 4PNCA 5CNXA 2IW2A 4A6WA 2GG3A 2Q92A 5D6EA 2BWUA 3BITA 2GG7A 4KM3A 1B6AA 2B3KA 4U1BA 4IKTA 4U75A 5D6FA 2OAZA 1JAWA 2NQ6A 1CHMA 2EVMA 4RGZ1 1XGNA 4S01A 4U6CA 4ZNGA 1XNZA 1KQ9A 4U6JA 4U71A 4U6WA 5CDLA 1WL9A 1WN1A 1WY2A 1MATA 2G6PA 2GGBA 3IU8A 4IKSA 4U69A 2GTXA 3MX6A 4IF7A 3CB5A 1R5GA 3IU7A 4IU6A 4FKCA 2ADUA 2BB7A 1W7VA 1BN5A 1KP0A 2EVCA 4ZWPA 4FLKA 2DFIA 3L24A 4S00A 1QXZA 4U73A 5CDEA 4FUKA 1QXWA 2GA2A 4FLIA 2EVOA 2GU7A 3FMRA 4PV4A 5JFRA 4IKRA 2EA4A 2BWXA 4FLLA 1N51A 4IKUA 4IECA 2BH3A 3PKEA 1C22A 3TAVA 1YJ3A 2GGCA 2GU5A 1A16A 3IG4A 3Q6DA 4U70A 1YW7A 4U6EA 2B3HA 1C21A 2BHCA 3D27A 3PKCA 1C23A 4Z7MA 2EA2A 2GG8A 1O0XA 2ZSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZ5 A;  5JI6 A;  2BN7 A;  2BWY A;  1XGO A;  1QXY A;  5CE6 A;  2BHB A;  4IPA A;  2V3Y A;  2BWS A;  5FCH A;  4ZWU A;  4S2T P;  3S6B A;  4HXX A;  1B59 A;  2GG9 A;  1PV9 A;  1WLR A;  2GG0 A;  1YW9 A;  1R5H A;  2BHA A;  2Q96 A;  4S2R P;  4U6Z A;  3TB5 A;  5FCF A;  2OKN A;  1W2M A;  1C27 A;  1M35 A;  2Q95 A;  2P98 A;  4U76 A;  4FLJ A;  2GU4 A;  1XGM A;  2P99 A;  1YVM A;  5CLS A;  4EGE A;  4MAT A;  4QR8 A;  1WBQ A;  2HOW A;  1C24 A;  3CB6 A;  2GG5 A;  1R58 A;  3PKB A;  4OOK A;  2V3X A;  2BHD A;  2MAT A;  4A6V A;  1KQ0 A;  2V6C A;  2Q8K A;  2BWT A;  5CIK A;  3RVA A;  3MAT A;  1Y1N A;  4B28 A;  4IDY A;  4RZY A;  2Q93 A;  2P9A A;  3IU9 A;  2NQ7 A;  3MR1 A;  1WL6 A;  4JUQ A;  3FMQ A;  1BOA A;  3CTZ A;  3FM3 A;  3PKD A;  5E5B A;  4FO8 A;  3PKA A;  2BWW A;  3BIP A;  2B3L A;  5CDV A;  2GG2 A;  2BWV A;  4RZZ A;  2Q94 A;  3ROR A;  2GU6 A;  5JHU A;  1YW8 A;  4ZWO A;  1WKM A;  2V3Z A;  1XGS A;  3BIQ A;  3L7G A;  4FO7 A;  4R60 A;  1QZY A;  4PNC A;  5CNX A;  2IW2 A;  4A6W A;  2GG3 A;  2Q92 A;  5D6E A;  2BWU A;  3BIT A;  2GG7 A;  4KM3 A;  1B6A A;  2B3K A;  4U1B A;  4IKT A;  4U75 A;  5D6F A;  2OAZ A;  1JAW A;  2NQ6 A;  1CHM A;  2EVM A;  4RGZ 1;  1XGN A;  4S01 A;  4U6C A;  4ZNG A;  1XNZ A;  1KQ9 A;  4U6J A;  4U71 A;  4U6W A;  5CDL A;  1WL9 A;  1WN1 A;  1WY2 A;  1MAT A;  2G6P A;  2GGB A;  3IU8 A;  4IKS A;  4U69 A;  2GTX A;  3MX6 A;  4IF7 A;  3CB5 A;  1R5G A;  3IU7 A;  4IU6 A;  4FKC A;  2ADU A;  2BB7 A;  1W7V A;  1BN5 A;  1KP0 A;  2EVC A;  4ZWP A;  4FLK A;  2DFI A;  3L24 A;  4S00 A;  1QXZ A;  4U73 A;  5CDE A;  4FUK A;  1QXW A;  2GA2 A;  4FLI A;  2EVO A;  2GU7 A;  3FMR A;  4PV4 A;  5JFR A;  4IKR A;  2EA4 A;  2BWX A;  4FLL A;  1N51 A;  4IKU A;  4IEC A;  2BH3 A;  3PKE A;  1C22 A;  3TAV A;  1YJ3 A;  2GGC A;  2GU5 A;  1A16 A;  3IG4 A;  3Q6D A;  4U70 A;  1YW7 A;  4U6E A;  2B3H A;  1C21 A;  2BHC A;  3D27 A;  3PKC A;  1C23 A;  4Z7M A;  2EA2 A;  2GG8 A;  1O0X A;  2ZSG A; 
#chains in the Genus database with same CATH topology
 2GZ5 A;  5JI6 A;  2BN7 A;  2BWY A;  1XGO A;  1QXY A;  5CE6 A;  2BHB A;  4IPA A;  2V3Y A;  2BWS A;  5FCH A;  4ZWU A;  4S2T P;  3S6B A;  4HXX A;  1B59 A;  2GG9 A;  1PV9 A;  1WLR A;  2GG0 A;  1YW9 A;  1R5H A;  2BHA A;  2Q96 A;  4S2R P;  4U6Z A;  3TB5 A;  5FCF A;  2OKN A;  1W2M A;  1C27 A;  1M35 A;  2Q95 A;  2P98 A;  4U76 A;  4FLJ A;  2GU4 A;  1XGM A;  2P99 A;  1YVM A;  5CLS A;  4EGE A;  4MAT A;  4QR8 A;  1WBQ A;  2HOW A;  1C24 A;  3CB6 A;  2GG5 A;  1R58 A;  3PKB A;  4OOK A;  2V3X A;  2BHD A;  2MAT A;  4A6V A;  1KQ0 A;  2V6C A;  2Q8K A;  2BWT A;  5CIK A;  3RVA A;  3MAT A;  1Y1N A;  4B28 A;  4IDY A;  4RZY A;  2Q93 A;  2P9A A;  3IU9 A;  2NQ7 A;  3MR1 A;  1WL6 A;  4JUQ A;  3FMQ A;  1BOA A;  3CTZ A;  3FM3 A;  3PKD A;  5E5B A;  4FO8 A;  3PKA A;  2BWW A;  3BIP A;  2B3L A;  5CDV A;  2GG2 A;  2BWV A;  4RZZ A;  2Q94 A;  3ROR A;  2GU6 A;  5JHU A;  1YW8 A;  4ZWO A;  1WKM A;  2V3Z A;  1XGS A;  3BIQ A;  3L7G A;  4FO7 A;  4R60 A;  1QZY A;  4PNC A;  5CNX A;  2IW2 A;  4A6W A;  2GG3 A;  2Q92 A;  5D6E A;  2BWU A;  3BIT A;  2GG7 A;  4KM3 A;  1B6A A;  2B3K A;  4U1B A;  4IKT A;  4U75 A;  5D6F A;  2OAZ A;  1JAW A;  2NQ6 A;  1CHM A;  2EVM A;  4RGZ 1;  1XGN A;  4S01 A;  4U6C A;  4ZNG A;  1XNZ A;  1KQ9 A;  4U6J A;  4U71 A;  4U6W A;  5CDL A;  1WL9 A;  1WN1 A;  1WY2 A;  1MAT A;  2G6P A;  2GGB A;  3IU8 A;  4IKS A;  4U69 A;  2GTX A;  3MX6 A;  4IF7 A;  3CB5 A;  1R5G A;  3IU7 A;  4IU6 A;  4FKC A;  2ADU A;  2BB7 A;  1W7V A;  1BN5 A;  1KP0 A;  2EVC A;  4ZWP A;  4FLK A;  2DFI A;  3L24 A;  4S00 A;  1QXZ A;  4U73 A;  5CDE A;  4FUK A;  1QXW A;  2GA2 A;  4FLI A;  2EVO A;  2GU7 A;  3FMR A;  4PV4 A;  5JFR A;  4IKR A;  2EA4 A;  2BWX A;  4FLL A;  1N51 A;  4IKU A;  4IEC A;  2BH3 A;  3PKE A;  1C22 A;  3TAV A;  1YJ3 A;  2GGC A;  2GU5 A;  1A16 A;  3IG4 A;  3Q6D A;  4U70 A;  1YW7 A;  4U6E A;  2B3H A;  1C21 A;  2BHC A;  3D27 A;  3PKC A;  1C23 A;  4Z7M A;  2EA2 A;  2GG8 A;  1O0X A;  2ZSG A; 
#chains in the Genus database with same CATH homology
 2GZ5 A;  5JI6 A;  2BN7 A;  2BWY A;  1XGO A;  1QXY A;  5CE6 A;  2BHB A;  4IPA A;  2V3Y A;  2BWS A;  5FCH A;  4ZWU A;  4S2T P;  3S6B A;  4HXX A;  1B59 A;  2GG9 A;  1PV9 A;  1WLR A;  2GG0 A;  1YW9 A;  1R5H A;  2BHA A;  2Q96 A;  4S2R P;  4U6Z A;  3TB5 A;  5FCF A;  2OKN A;  1W2M A;  1C27 A;  1M35 A;  2Q95 A;  2P98 A;  4U76 A;  4FLJ A;  2GU4 A;  1XGM A;  2P99 A;  1YVM A;  5CLS A;  4EGE A;  4MAT A;  4QR8 A;  1WBQ A;  2HOW A;  1C24 A;  3CB6 A;  2GG5 A;  1R58 A;  3PKB A;  4OOK A;  2V3X A;  2BHD A;  2MAT A;  4A6V A;  1KQ0 A;  2V6C A;  2Q8K A;  2BWT A;  5CIK A;  3RVA A;  3MAT A;  1Y1N A;  4B28 A;  4IDY A;  4RZY A;  2Q93 A;  2P9A A;  3IU9 A;  2NQ7 A;  3MR1 A;  1WL6 A;  4JUQ A;  3FMQ A;  1BOA A;  3CTZ A;  3FM3 A;  3PKD A;  5E5B A;  4FO8 A;  3PKA A;  2BWW A;  3BIP A;  2B3L A;  5CDV A;  2GG2 A;  2BWV A;  4RZZ A;  2Q94 A;  3ROR A;  2GU6 A;  5JHU A;  1YW8 A;  4ZWO A;  1WKM A;  2V3Z A;  1XGS A;  3BIQ A;  3L7G A;  4FO7 A;  4R60 A;  1QZY A;  4PNC A;  5CNX A;  2IW2 A;  4A6W A;  2GG3 A;  2Q92 A;  5D6E A;  2BWU A;  3BIT A;  2GG7 A;  4KM3 A;  1B6A A;  2B3K A;  4U1B A;  4IKT A;  4U75 A;  5D6F A;  2OAZ A;  1JAW A;  2NQ6 A;  1CHM A;  2EVM A;  4RGZ 1;  1XGN A;  4S01 A;  4U6C A;  4ZNG A;  1XNZ A;  1KQ9 A;  4U6J A;  4U71 A;  4U6W A;  5CDL A;  1WL9 A;  1WN1 A;  1WY2 A;  1MAT A;  2G6P A;  2GGB A;  3IU8 A;  4IKS A;  4U69 A;  2GTX A;  3MX6 A;  4IF7 A;  3CB5 A;  1R5G A;  3IU7 A;  4IU6 A;  4FKC A;  2ADU A;  2BB7 A;  1W7V A;  1BN5 A;  1KP0 A;  2EVC A;  4ZWP A;  4FLK A;  2DFI A;  3L24 A;  4S00 A;  1QXZ A;  4U73 A;  5CDE A;  4FUK A;  1QXW A;  2GA2 A;  4FLI A;  2EVO A;  2GU7 A;  3FMR A;  4PV4 A;  5JFR A;  4IKR A;  2EA4 A;  2BWX A;  4FLL A;  1N51 A;  4IKU A;  4IEC A;  2BH3 A;  3PKE A;  1C22 A;  3TAV A;  1YJ3 A;  2GGC A;  2GU5 A;  1A16 A;  3IG4 A;  3Q6D A;  4U70 A;  1YW7 A;  4U6E A;  2B3H A;  1C21 A;  2BHC A;  3D27 A;  3PKC A;  1C23 A;  4Z7M A;  2EA2 A;  2GG8 A;  1O0X A;  2ZSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...