3D27A

E. coli methionine aminopeptidase with fe inhibitor w29
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Discovery of inhibitors of Escherichia coli methionine aminopeptidase with the Fe(II)-form selectivity and antibacterial activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 83
structure length 261
sequence length 261
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3d27A00
4S2TP 5D6FA 3RORA 4B28A 3PKAA 4KM3A 4QR8A 3PKEA 1R5GA 4HXXA 3L24A 2BWWA 2BWUA 1XGSA 2V3XA 4U6ZA 1YW7A 5E5BA 4IKUA 4Z7MA 1C22A 2B3LA 2GGBA 2Q92A 4FUKA 1YVMA 1YJ3A 4FLIA 5D6EA 5CDLA 4FO8A 2GTXA 1C27A 4ZWOA 1YW8A 2B3HA 1C21A 1XGOA 4IKTA 3CB6A 4IDYA 3BIQA 1WN1A 4R60A 4U73A 4ZNGA 5FCHA 2EVMA 4FLJA 2V6CA 1B6AA 2EA4A 3PKDA 3FMRA 5CNXA 3IU9A 2B3KA 2P98A 4JUQA 5CLSA 2GA2A 4A6VA 5CIKA 1W2MA 2Q94A 2GU4A 2BHDA 2GG2A 2NQ6A 4IKRA 2BWTA 5CE6A 3FM3A 1C23A 2BWXA 2HOWA 3MX6A 4U6EA 2DFIA 2GU5A 2Q93A 3CTZA 3FMQA 4RGZ1 2NQ7A 2BN7A 1BN5A 1M35A 4IU6A 4RZZA 1B59A 1Y1NA 1BOAA 4PNCA 1QXWA 2BHCA 1XGNA 1YW9A 1QZYA 1XNZA 4IECA 4U75A 1KQ9A 2V3YA 2GG7A 4FLKA 4U6CA 3CB5A 2Q95A 2BB7A 3IU7A 1C24A 3S6BA 4S2RP 2GG8A 1WL9A 3D27A 1WY2A 1KP0A 4IPAA 2ADUA 1A16A 3L7GA 2IW2A 5JI6A 4S01A 2OKNA 1QXYA 2G6PA 3MR1A 1R58A 1N51A 1QXZA 4IF7A 3Q6DA 2GG3A 1WKMA 2V3ZA 5CDEA 1R5HA 2EVOA 2Q8KA 3IU8A 2ZSGA 5FCFA 1MATA 2GU7A 2GG9A 4FKCA 4U69A 3PKCA 1W7VA 4S00A 5CDVA 1XGMA 2BHBA 4EGEA 1WL6A 2GZ5A 2P99A 4A6WA 3BIPA 2P9AA 4PV4A 4U71A 2MATA 1JAWA 2Q96A 4U70A 3TAVA 4U6WA 2GGCA 4OOKA 3BITA 4MATA 1KQ0A 1WBQA 2GG5A 2BHAA 3IG4A 1CHMA 5JHUA 2BWYA 1O0XA 2EA2A 2GG0A 4ZWPA 4U76A 4RZYA 2GU6A 4U6JA 4IKSA 3TB5A 2EVCA 1PV9A 4FO7A 2BH3A 2BWVA 3PKBA 1WLRA 2BWSA 4FLLA 4U1BA 4ZWUA 2OAZA 3MATA 5JFRA 3RVAA
chains in the Genus database with same CATH superfamily
4S2TP 5D6FA 3RORA 4B28A 3PKAA 4KM3A 4QR8A 3PKEA 1R5GA 4HXXA 3L24A 2BWWA 2BWUA 1XGSA 2V3XA 4U6ZA 1YW7A 5E5BA 4IKUA 4Z7MA 1C22A 2B3LA 2GGBA 2Q92A 4FUKA 1YVMA 1YJ3A 4FLIA 5D6EA 5CDLA 4FO8A 2GTXA 1C27A 4ZWOA 1YW8A 2B3HA 1C21A 1XGOA 4IKTA 3CB6A 4IDYA 3BIQA 1WN1A 4R60A 4U73A 4ZNGA 5FCHA 2EVMA 4FLJA 2V6CA 1B6AA 2EA4A 3PKDA 3FMRA 5CNXA 3IU9A 2B3KA 2P98A 4JUQA 5CLSA 2GA2A 4A6VA 5CIKA 1W2MA 2Q94A 2GU4A 2BHDA 2GG2A 2NQ6A 4IKRA 2BWTA 5CE6A 3FM3A 1C23A 2BWXA 2HOWA 3MX6A 4U6EA 2DFIA 2GU5A 2Q93A 3CTZA 3FMQA 4RGZ1 2NQ7A 2BN7A 1BN5A 1M35A 4IU6A 4RZZA 1B59A 1Y1NA 1BOAA 4PNCA 1QXWA 2BHCA 1XGNA 1YW9A 1QZYA 1XNZA 4IECA 4U75A 1KQ9A 2V3YA 2GG7A 4FLKA 4U6CA 3CB5A 2Q95A 2BB7A 3IU7A 1C24A 3S6BA 4S2RP 2GG8A 1WL9A 3D27A 1WY2A 1KP0A 4IPAA 2ADUA 1A16A 3L7GA 2IW2A 5JI6A 4S01A 2OKNA 1QXYA 2G6PA 3MR1A 1R58A 1N51A 1QXZA 4IF7A 3Q6DA 2GG3A 1WKMA 2V3ZA 5CDEA 1R5HA 2EVOA 2Q8KA 3IU8A 2ZSGA 5FCFA 1MATA 2GU7A 2GG9A 4FKCA 4U69A 3PKCA 1W7VA 4S00A 5CDVA 1XGMA 2BHBA 4EGEA 1WL6A 2GZ5A 2P99A 4A6WA 3BIPA 2P9AA 4PV4A 4U71A 2MATA 1JAWA 2Q96A 4U70A 3TAVA 4U6WA 2GGCA 4OOKA 3BITA 4MATA 1KQ0A 1WBQA 2GG5A 2BHAA 3IG4A 1CHMA 5JHUA 2BWYA 1O0XA 2EA2A 2GG0A 4ZWPA 4U76A 4RZYA 2GU6A 4U6JA 4IKSA 3TB5A 2EVCA 1PV9A 4FO7A 2BH3A 2BWVA 3PKBA 1WLRA 2BWSA 4FLLA 4U1BA 4ZWUA 2OAZA 3MATA 5JFRA 3RVAA
chains in the Genus database with same CATH topology
4S2TP 5D6FA 3RORA 4B28A 3PKAA 4KM3A 4QR8A 3PKEA 1R5GA 4HXXA 3L24A 2BWWA 2BWUA 1XGSA 2V3XA 4U6ZA 1YW7A 5E5BA 4IKUA 4Z7MA 1C22A 2B3LA 2GGBA 2Q92A 4FUKA 1YVMA 1YJ3A 4FLIA 5D6EA 5CDLA 4FO8A 2GTXA 1C27A 4ZWOA 1YW8A 2B3HA 1C21A 1XGOA 4IKTA 3CB6A 4IDYA 3BIQA 1WN1A 4R60A 4U73A 4ZNGA 5FCHA 2EVMA 4FLJA 2V6CA 1B6AA 2EA4A 3PKDA 3FMRA 5CNXA 3IU9A 2B3KA 2P98A 4JUQA 5CLSA 2GA2A 4A6VA 5CIKA 1W2MA 2Q94A 2GU4A 2BHDA 2GG2A 2NQ6A 4IKRA 2BWTA 5CE6A 3FM3A 1C23A 2BWXA 2HOWA 3MX6A 4U6EA 2DFIA 2GU5A 2Q93A 3CTZA 3FMQA 4RGZ1 2NQ7A 2BN7A 1BN5A 1M35A 4IU6A 4RZZA 1B59A 1Y1NA 1BOAA 4PNCA 1QXWA 2BHCA 1XGNA 1YW9A 1QZYA 1XNZA 4IECA 4U75A 1KQ9A 2V3YA 2GG7A 4FLKA 4U6CA 3CB5A 2Q95A 2BB7A 3IU7A 1C24A 3S6BA 4S2RP 2GG8A 1WL9A 3D27A 1WY2A 1KP0A 4IPAA 2ADUA 1A16A 3L7GA 2IW2A 5JI6A 4S01A 2OKNA 1QXYA 2G6PA 3MR1A 1R58A 1N51A 1QXZA 4IF7A 3Q6DA 2GG3A 1WKMA 2V3ZA 5CDEA 1R5HA 2EVOA 2Q8KA 3IU8A 2ZSGA 5FCFA 1MATA 2GU7A 2GG9A 4FKCA 4U69A 3PKCA 1W7VA 4S00A 5CDVA 1XGMA 2BHBA 4EGEA 1WL6A 2GZ5A 2P99A 4A6WA 3BIPA 2P9AA 4PV4A 4U71A 2MATA 1JAWA 2Q96A 4U70A 3TAVA 4U6WA 2GGCA 4OOKA 3BITA 4MATA 1KQ0A 1WBQA 2GG5A 2BHAA 3IG4A 1CHMA 5JHUA 2BWYA 1O0XA 2EA2A 2GG0A 4ZWPA 4U76A 4RZYA 2GU6A 4U6JA 4IKSA 3TB5A 2EVCA 1PV9A 4FO7A 2BH3A 2BWVA 3PKBA 1WLRA 2BWSA 4FLLA 4U1BA 4ZWUA 2OAZA 3MATA 5JFRA 3RVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2T P;  5D6F A;  3ROR A;  4B28 A;  3PKA A;  4KM3 A;  4QR8 A;  3PKE A;  1R5G A;  4HXX A;  3L24 A;  2BWW A;  2BWU A;  1XGS A;  2V3X A;  4U6Z A;  1YW7 A;  5E5B A;  4IKU A;  4Z7M A;  1C22 A;  2B3L A;  2GGB A;  2Q92 A;  4FUK A;  1YVM A;  1YJ3 A;  4FLI A;  5D6E A;  5CDL A;  4FO8 A;  2GTX A;  1C27 A;  4ZWO A;  1YW8 A;  2B3H A;  1C21 A;  1XGO A;  4IKT A;  3CB6 A;  4IDY A;  3BIQ A;  1WN1 A;  4R60 A;  4U73 A;  4ZNG A;  5FCH A;  2EVM A;  4FLJ A;  2V6C A;  1B6A A;  2EA4 A;  3PKD A;  3FMR A;  5CNX A;  3IU9 A;  2B3K A;  2P98 A;  4JUQ A;  5CLS A;  2GA2 A;  4A6V A;  5CIK A;  1W2M A;  2Q94 A;  2GU4 A;  2BHD A;  2GG2 A;  2NQ6 A;  4IKR A;  2BWT A;  5CE6 A;  3FM3 A;  1C23 A;  2BWX A;  2HOW A;  3MX6 A;  4U6E A;  2DFI A;  2GU5 A;  2Q93 A;  3CTZ A;  3FMQ A;  4RGZ 1;  2NQ7 A;  2BN7 A;  1BN5 A;  1M35 A;  4IU6 A;  4RZZ A;  1B59 A;  1Y1N A;  1BOA A;  4PNC A;  1QXW A;  2BHC A;  1XGN A;  1YW9 A;  1QZY A;  1XNZ A;  4IEC A;  4U75 A;  1KQ9 A;  2V3Y A;  2GG7 A;  4FLK A;  4U6C A;  3CB5 A;  2Q95 A;  2BB7 A;  3IU7 A;  1C24 A;  3S6B A;  4S2R P;  2GG8 A;  1WL9 A;  3D27 A;  1WY2 A;  1KP0 A;  4IPA A;  2ADU A;  1A16 A;  3L7G A;  2IW2 A;  5JI6 A;  4S01 A;  2OKN A;  1QXY A;  2G6P A;  3MR1 A;  1R58 A;  1N51 A;  1QXZ A;  4IF7 A;  3Q6D A;  2GG3 A;  1WKM A;  2V3Z A;  5CDE A;  1R5H A;  2EVO A;  2Q8K A;  3IU8 A;  2ZSG A;  5FCF A;  1MAT A;  2GU7 A;  2GG9 A;  4FKC A;  4U69 A;  3PKC A;  1W7V A;  4S00 A;  5CDV A;  1XGM A;  2BHB A;  4EGE A;  1WL6 A;  2GZ5 A;  2P99 A;  4A6W A;  3BIP A;  2P9A A;  4PV4 A;  4U71 A;  2MAT A;  1JAW A;  2Q96 A;  4U70 A;  3TAV A;  4U6W A;  2GGC A;  4OOK A;  3BIT A;  4MAT A;  1KQ0 A;  1WBQ A;  2GG5 A;  2BHA A;  3IG4 A;  1CHM A;  5JHU A;  2BWY A;  1O0X A;  2EA2 A;  2GG0 A;  4ZWP A;  4U76 A;  4RZY A;  2GU6 A;  4U6J A;  4IKS A;  3TB5 A;  2EVC A;  1PV9 A;  4FO7 A;  2BH3 A;  2BWV A;  3PKB A;  1WLR A;  2BWS A;  4FLL A;  4U1B A;  4ZWU A;  2OAZ A;  3MAT A;  5JFR A;  3RVA A; 
#chains in the Genus database with same CATH topology
 4S2T P;  5D6F A;  3ROR A;  4B28 A;  3PKA A;  4KM3 A;  4QR8 A;  3PKE A;  1R5G A;  4HXX A;  3L24 A;  2BWW A;  2BWU A;  1XGS A;  2V3X A;  4U6Z A;  1YW7 A;  5E5B A;  4IKU A;  4Z7M A;  1C22 A;  2B3L A;  2GGB A;  2Q92 A;  4FUK A;  1YVM A;  1YJ3 A;  4FLI A;  5D6E A;  5CDL A;  4FO8 A;  2GTX A;  1C27 A;  4ZWO A;  1YW8 A;  2B3H A;  1C21 A;  1XGO A;  4IKT A;  3CB6 A;  4IDY A;  3BIQ A;  1WN1 A;  4R60 A;  4U73 A;  4ZNG A;  5FCH A;  2EVM A;  4FLJ A;  2V6C A;  1B6A A;  2EA4 A;  3PKD A;  3FMR A;  5CNX A;  3IU9 A;  2B3K A;  2P98 A;  4JUQ A;  5CLS A;  2GA2 A;  4A6V A;  5CIK A;  1W2M A;  2Q94 A;  2GU4 A;  2BHD A;  2GG2 A;  2NQ6 A;  4IKR A;  2BWT A;  5CE6 A;  3FM3 A;  1C23 A;  2BWX A;  2HOW A;  3MX6 A;  4U6E A;  2DFI A;  2GU5 A;  2Q93 A;  3CTZ A;  3FMQ A;  4RGZ 1;  2NQ7 A;  2BN7 A;  1BN5 A;  1M35 A;  4IU6 A;  4RZZ A;  1B59 A;  1Y1N A;  1BOA A;  4PNC A;  1QXW A;  2BHC A;  1XGN A;  1YW9 A;  1QZY A;  1XNZ A;  4IEC A;  4U75 A;  1KQ9 A;  2V3Y A;  2GG7 A;  4FLK A;  4U6C A;  3CB5 A;  2Q95 A;  2BB7 A;  3IU7 A;  1C24 A;  3S6B A;  4S2R P;  2GG8 A;  1WL9 A;  3D27 A;  1WY2 A;  1KP0 A;  4IPA A;  2ADU A;  1A16 A;  3L7G A;  2IW2 A;  5JI6 A;  4S01 A;  2OKN A;  1QXY A;  2G6P A;  3MR1 A;  1R58 A;  1N51 A;  1QXZ A;  4IF7 A;  3Q6D A;  2GG3 A;  1WKM A;  2V3Z A;  5CDE A;  1R5H A;  2EVO A;  2Q8K A;  3IU8 A;  2ZSG A;  5FCF A;  1MAT A;  2GU7 A;  2GG9 A;  4FKC A;  4U69 A;  3PKC A;  1W7V A;  4S00 A;  5CDV A;  1XGM A;  2BHB A;  4EGE A;  1WL6 A;  2GZ5 A;  2P99 A;  4A6W A;  3BIP A;  2P9A A;  4PV4 A;  4U71 A;  2MAT A;  1JAW A;  2Q96 A;  4U70 A;  3TAV A;  4U6W A;  2GGC A;  4OOK A;  3BIT A;  4MAT A;  1KQ0 A;  1WBQ A;  2GG5 A;  2BHA A;  3IG4 A;  1CHM A;  5JHU A;  2BWY A;  1O0X A;  2EA2 A;  2GG0 A;  4ZWP A;  4U76 A;  4RZY A;  2GU6 A;  4U6J A;  4IKS A;  3TB5 A;  2EVC A;  1PV9 A;  4FO7 A;  2BH3 A;  2BWV A;  3PKB A;  1WLR A;  2BWS A;  4FLL A;  4U1B A;  4ZWU A;  2OAZ A;  3MAT A;  5JFR A;  3RVA A; 
#chains in the Genus database with same CATH homology
 4S2T P;  5D6F A;  3ROR A;  4B28 A;  3PKA A;  4KM3 A;  4QR8 A;  3PKE A;  1R5G A;  4HXX A;  3L24 A;  2BWW A;  2BWU A;  1XGS A;  2V3X A;  4U6Z A;  1YW7 A;  5E5B A;  4IKU A;  4Z7M A;  1C22 A;  2B3L A;  2GGB A;  2Q92 A;  4FUK A;  1YVM A;  1YJ3 A;  4FLI A;  5D6E A;  5CDL A;  4FO8 A;  2GTX A;  1C27 A;  4ZWO A;  1YW8 A;  2B3H A;  1C21 A;  1XGO A;  4IKT A;  3CB6 A;  4IDY A;  3BIQ A;  1WN1 A;  4R60 A;  4U73 A;  4ZNG A;  5FCH A;  2EVM A;  4FLJ A;  2V6C A;  1B6A A;  2EA4 A;  3PKD A;  3FMR A;  5CNX A;  3IU9 A;  2B3K A;  2P98 A;  4JUQ A;  5CLS A;  2GA2 A;  4A6V A;  5CIK A;  1W2M A;  2Q94 A;  2GU4 A;  2BHD A;  2GG2 A;  2NQ6 A;  4IKR A;  2BWT A;  5CE6 A;  3FM3 A;  1C23 A;  2BWX A;  2HOW A;  3MX6 A;  4U6E A;  2DFI A;  2GU5 A;  2Q93 A;  3CTZ A;  3FMQ A;  4RGZ 1;  2NQ7 A;  2BN7 A;  1BN5 A;  1M35 A;  4IU6 A;  4RZZ A;  1B59 A;  1Y1N A;  1BOA A;  4PNC A;  1QXW A;  2BHC A;  1XGN A;  1YW9 A;  1QZY A;  1XNZ A;  4IEC A;  4U75 A;  1KQ9 A;  2V3Y A;  2GG7 A;  4FLK A;  4U6C A;  3CB5 A;  2Q95 A;  2BB7 A;  3IU7 A;  1C24 A;  3S6B A;  4S2R P;  2GG8 A;  1WL9 A;  3D27 A;  1WY2 A;  1KP0 A;  4IPA A;  2ADU A;  1A16 A;  3L7G A;  2IW2 A;  5JI6 A;  4S01 A;  2OKN A;  1QXY A;  2G6P A;  3MR1 A;  1R58 A;  1N51 A;  1QXZ A;  4IF7 A;  3Q6D A;  2GG3 A;  1WKM A;  2V3Z A;  5CDE A;  1R5H A;  2EVO A;  2Q8K A;  3IU8 A;  2ZSG A;  5FCF A;  1MAT A;  2GU7 A;  2GG9 A;  4FKC A;  4U69 A;  3PKC A;  1W7V A;  4S00 A;  5CDV A;  1XGM A;  2BHB A;  4EGE A;  1WL6 A;  2GZ5 A;  2P99 A;  4A6W A;  3BIP A;  2P9A A;  4PV4 A;  4U71 A;  2MAT A;  1JAW A;  2Q96 A;  4U70 A;  3TAV A;  4U6W A;  2GGC A;  4OOK A;  3BIT A;  4MAT A;  1KQ0 A;  1WBQ A;  2GG5 A;  2BHA A;  3IG4 A;  1CHM A;  5JHU A;  2BWY A;  1O0X A;  2EA2 A;  2GG0 A;  4ZWP A;  4U76 A;  4RZY A;  2GU6 A;  4U6J A;  4IKS A;  3TB5 A;  2EVC A;  1PV9 A;  4FO7 A;  2BH3 A;  2BWV A;  3PKB A;  1WLR A;  2BWS A;  4FLL A;  4U1B A;  4ZWU A;  2OAZ A;  3MAT A;  5JFR A;  3RVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...