3D27A

E. coli methionine aminopeptidase with fe inhibitor w29
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
b'SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Discovery of inhibitors of Escherichia coli methionine aminopeptidase with the Fe(II)-form selectivity and antibacterial activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 83
structure length 261
sequence length 261
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3d27A00
1WL9A 3S6BA 2GG0A 2BWTA 5JFRA 2BHAA 2GA2A 5CLSA 2BWVA 4A6VA 1A16A 2GU6A 3BITA 3FM3A 5D6FA 4ZWPA 4U69A 3TB5A 4EGEA 1KP0A 2BB7A 1XGNA 2Q95A 3PKEA 4OOKA 3L7GA 2ADUA 4U6CA 5JI6A 1BOAA 2GU4A 1O0XA 2OAZA 2GGBA 2GG9A 3RORA 4ZWUA 1C23A 2HOWA 4PV4A 2BHDA 1QXWA 2Q93A 4S01A 1QZYA 3IU7A 4S00A 1XGOA 4FO7A 5E5BA 1CHMA 2P9AA 3L24A 2DFIA 4U73A 2P99A 2BHBA 1C22A 1BN5A 2Q8KA 4IKSA 3PKBA 4U70A 1YW8A 1C27A 3IU9A 1R5GA 2GU7A 2Q94A 4IKUA 2B3LA 2G6PA 1KQ0A 4ZWOA 4FUKA 5CE6A 1C21A 2P98A 4FLKA 4IKTA 4B28A 2V3ZA 1WN1A 2BWYA 4U1BA 2IW2A 3FMRA 1YW9A 1XGMA 1QXYA 2GG7A 4U75A 4U6EA 5CDVA 2ZSGA 1B59A 4S2RP 4JUQA 2BN7A 5FCFA 4Z7MA 3PKCA 2BWWA 4IKRA 4FKCA 5CDEA 1JAWA 5CIKA 2OKNA 4R60A 2Q92A 3CTZA 2GG3A 3D27A 1KQ9A 2GG8A 3RVAA 2EA2A 1WKMA 1MATA 3CB5A 2GGCA 4A6WA 4ZNGA 2NQ7A 2EA4A 1M35A 1WLRA 4RZZA 3BIQA 1Y1NA 2MATA 1W2MA 2V6CA 1R58A 4FLLA 4RGZ1 4FO8A 1WBQA 2EVMA 3TAVA 5JHUA 4U6ZA 4U6WA 1YW7A 4IPAA 2BWSA 4U71A 3MX6A 3Q6DA 5CDLA 4KM3A 2GZ5A 4HXXA 1R5HA 4U76A 2BH3A 2B3KA 2V3YA 1B6AA 4IECA 1YJ3A 4IDYA 4IU6A 3PKDA 4QR8A 5D6EA 2B3HA 1W7VA 4S2TP 4U6JA 3CB6A 4RZYA 1PV9A 2V3XA 2BWXA 5FCHA 5CNXA 2BHCA 1WL6A 1C24A 3MR1A 2GG5A 1WY2A 4FLJA 1N51A 4MATA 4FLIA 3PKAA 3MATA 4PNCA 1XGSA 3IU8A 2EVOA 2GU5A 2Q96A 2GG2A 3FMQA 3BIPA 1XNZA 1YVMA 4IF7A 1QXZA 3IG4A 2EVCA 2BWUA 2NQ6A 2GTXA
chains in the Genus database with same CATH superfamily
1WL9A 3S6BA 2GG0A 2BWTA 5JFRA 2BHAA 2GA2A 5CLSA 2BWVA 4A6VA 1A16A 2GU6A 3BITA 3FM3A 5D6FA 4ZWPA 4U69A 3TB5A 4EGEA 1KP0A 2BB7A 1XGNA 2Q95A 3PKEA 4OOKA 3L7GA 2ADUA 4U6CA 5JI6A 1BOAA 2GU4A 1O0XA 2OAZA 2GGBA 2GG9A 3RORA 4ZWUA 1C23A 2HOWA 4PV4A 2BHDA 1QXWA 2Q93A 4S01A 1QZYA 3IU7A 4S00A 1XGOA 4FO7A 5E5BA 1CHMA 2P9AA 3L24A 2DFIA 4U73A 2P99A 2BHBA 1C22A 1BN5A 2Q8KA 4IKSA 3PKBA 4U70A 1YW8A 1C27A 3IU9A 1R5GA 2GU7A 2Q94A 4IKUA 2B3LA 2G6PA 1KQ0A 4ZWOA 4FUKA 5CE6A 1C21A 2P98A 4FLKA 4IKTA 4B28A 2V3ZA 1WN1A 2BWYA 4U1BA 2IW2A 3FMRA 1YW9A 1XGMA 1QXYA 2GG7A 4U75A 4U6EA 5CDVA 2ZSGA 1B59A 4S2RP 4JUQA 2BN7A 5FCFA 4Z7MA 3PKCA 2BWWA 4IKRA 4FKCA 5CDEA 1JAWA 5CIKA 2OKNA 4R60A 2Q92A 3CTZA 2GG3A 3D27A 1KQ9A 2GG8A 3RVAA 2EA2A 1WKMA 1MATA 3CB5A 2GGCA 4A6WA 4ZNGA 2NQ7A 2EA4A 1M35A 1WLRA 4RZZA 3BIQA 1Y1NA 2MATA 1W2MA 2V6CA 1R58A 4FLLA 4RGZ1 4FO8A 1WBQA 2EVMA 3TAVA 5JHUA 4U6ZA 4U6WA 1YW7A 4IPAA 2BWSA 4U71A 3MX6A 3Q6DA 5CDLA 4KM3A 2GZ5A 4HXXA 1R5HA 4U76A 2BH3A 2B3KA 2V3YA 1B6AA 4IECA 1YJ3A 4IDYA 4IU6A 3PKDA 4QR8A 5D6EA 2B3HA 1W7VA 4S2TP 4U6JA 3CB6A 4RZYA 1PV9A 2V3XA 2BWXA 5FCHA 5CNXA 2BHCA 1WL6A 1C24A 3MR1A 2GG5A 1WY2A 4FLJA 1N51A 4MATA 4FLIA 3PKAA 3MATA 4PNCA 1XGSA 3IU8A 2EVOA 2GU5A 2Q96A 2GG2A 3FMQA 3BIPA 1XNZA 1YVMA 4IF7A 1QXZA 3IG4A 2EVCA 2BWUA 2NQ6A 2GTXA
chains in the Genus database with same CATH topology
1WL9A 3S6BA 2GG0A 2BWTA 5JFRA 2BHAA 2GA2A 5CLSA 2BWVA 4A6VA 1A16A 2GU6A 3BITA 3FM3A 5D6FA 4ZWPA 4U69A 3TB5A 4EGEA 1KP0A 2BB7A 1XGNA 2Q95A 3PKEA 4OOKA 3L7GA 2ADUA 4U6CA 5JI6A 1BOAA 2GU4A 1O0XA 2OAZA 2GGBA 2GG9A 3RORA 4ZWUA 1C23A 2HOWA 4PV4A 2BHDA 1QXWA 2Q93A 4S01A 1QZYA 3IU7A 4S00A 1XGOA 4FO7A 5E5BA 1CHMA 2P9AA 3L24A 2DFIA 4U73A 2P99A 2BHBA 1C22A 1BN5A 2Q8KA 4IKSA 3PKBA 4U70A 1YW8A 1C27A 3IU9A 1R5GA 2GU7A 2Q94A 4IKUA 2B3LA 2G6PA 1KQ0A 4ZWOA 4FUKA 5CE6A 1C21A 2P98A 4FLKA 4IKTA 4B28A 2V3ZA 1WN1A 2BWYA 4U1BA 2IW2A 3FMRA 1YW9A 1XGMA 1QXYA 2GG7A 4U75A 4U6EA 5CDVA 2ZSGA 1B59A 4S2RP 4JUQA 2BN7A 5FCFA 4Z7MA 3PKCA 2BWWA 4IKRA 4FKCA 5CDEA 1JAWA 5CIKA 2OKNA 4R60A 2Q92A 3CTZA 2GG3A 3D27A 1KQ9A 2GG8A 3RVAA 2EA2A 1WKMA 1MATA 3CB5A 2GGCA 4A6WA 4ZNGA 2NQ7A 2EA4A 1M35A 1WLRA 4RZZA 3BIQA 1Y1NA 2MATA 1W2MA 2V6CA 1R58A 4FLLA 4RGZ1 4FO8A 1WBQA 2EVMA 3TAVA 5JHUA 4U6ZA 4U6WA 1YW7A 4IPAA 2BWSA 4U71A 3MX6A 3Q6DA 5CDLA 4KM3A 2GZ5A 4HXXA 1R5HA 4U76A 2BH3A 2B3KA 2V3YA 1B6AA 4IECA 1YJ3A 4IDYA 4IU6A 3PKDA 4QR8A 5D6EA 2B3HA 1W7VA 4S2TP 4U6JA 3CB6A 4RZYA 1PV9A 2V3XA 2BWXA 5FCHA 5CNXA 2BHCA 1WL6A 1C24A 3MR1A 2GG5A 1WY2A 4FLJA 1N51A 4MATA 4FLIA 3PKAA 3MATA 4PNCA 1XGSA 3IU8A 2EVOA 2GU5A 2Q96A 2GG2A 3FMQA 3BIPA 1XNZA 1YVMA 4IF7A 1QXZA 3IG4A 2EVCA 2BWUA 2NQ6A 2GTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WL9 A;  3S6B A;  2GG0 A;  2BWT A;  5JFR A;  2BHA A;  2GA2 A;  5CLS A;  2BWV A;  4A6V A;  1A16 A;  2GU6 A;  3BIT A;  3FM3 A;  5D6F A;  4ZWP A;  4U69 A;  3TB5 A;  4EGE A;  1KP0 A;  2BB7 A;  1XGN A;  2Q95 A;  3PKE A;  4OOK A;  3L7G A;  2ADU A;  4U6C A;  5JI6 A;  1BOA A;  2GU4 A;  1O0X A;  2OAZ A;  2GGB A;  2GG9 A;  3ROR A;  4ZWU A;  1C23 A;  2HOW A;  4PV4 A;  2BHD A;  1QXW A;  2Q93 A;  4S01 A;  1QZY A;  3IU7 A;  4S00 A;  1XGO A;  4FO7 A;  5E5B A;  1CHM A;  2P9A A;  3L24 A;  2DFI A;  4U73 A;  2P99 A;  2BHB A;  1C22 A;  1BN5 A;  2Q8K A;  4IKS A;  3PKB A;  4U70 A;  1YW8 A;  1C27 A;  3IU9 A;  1R5G A;  2GU7 A;  2Q94 A;  4IKU A;  2B3L A;  2G6P A;  1KQ0 A;  4ZWO A;  4FUK A;  5CE6 A;  1C21 A;  2P98 A;  4FLK A;  4IKT A;  4B28 A;  2V3Z A;  1WN1 A;  2BWY A;  4U1B A;  2IW2 A;  3FMR A;  1YW9 A;  1XGM A;  1QXY A;  2GG7 A;  4U75 A;  4U6E A;  5CDV A;  2ZSG A;  1B59 A;  4S2R P;  4JUQ A;  2BN7 A;  5FCF A;  4Z7M A;  3PKC A;  2BWW A;  4IKR A;  4FKC A;  5CDE A;  1JAW A;  5CIK A;  2OKN A;  4R60 A;  2Q92 A;  3CTZ A;  2GG3 A;  3D27 A;  1KQ9 A;  2GG8 A;  3RVA A;  2EA2 A;  1WKM A;  1MAT A;  3CB5 A;  2GGC A;  4A6W A;  4ZNG A;  2NQ7 A;  2EA4 A;  1M35 A;  1WLR A;  4RZZ A;  3BIQ A;  1Y1N A;  2MAT A;  1W2M A;  2V6C A;  1R58 A;  4FLL A;  4RGZ 1;  4FO8 A;  1WBQ A;  2EVM A;  3TAV A;  5JHU A;  4U6Z A;  4U6W A;  1YW7 A;  4IPA A;  2BWS A;  4U71 A;  3MX6 A;  3Q6D A;  5CDL A;  4KM3 A;  2GZ5 A;  4HXX A;  1R5H A;  4U76 A;  2BH3 A;  2B3K A;  2V3Y A;  1B6A A;  4IEC A;  1YJ3 A;  4IDY A;  4IU6 A;  3PKD A;  4QR8 A;  5D6E A;  2B3H A;  1W7V A;  4S2T P;  4U6J A;  3CB6 A;  4RZY A;  1PV9 A;  2V3X A;  2BWX A;  5FCH A;  5CNX A;  2BHC A;  1WL6 A;  1C24 A;  3MR1 A;  2GG5 A;  1WY2 A;  4FLJ A;  1N51 A;  4MAT A;  4FLI A;  3PKA A;  3MAT A;  4PNC A;  1XGS A;  3IU8 A;  2EVO A;  2GU5 A;  2Q96 A;  2GG2 A;  3FMQ A;  3BIP A;  1XNZ A;  1YVM A;  4IF7 A;  1QXZ A;  3IG4 A;  2EVC A;  2BWU A;  2NQ6 A;  2GTX A; 
#chains in the Genus database with same CATH topology
 1WL9 A;  3S6B A;  2GG0 A;  2BWT A;  5JFR A;  2BHA A;  2GA2 A;  5CLS A;  2BWV A;  4A6V A;  1A16 A;  2GU6 A;  3BIT A;  3FM3 A;  5D6F A;  4ZWP A;  4U69 A;  3TB5 A;  4EGE A;  1KP0 A;  2BB7 A;  1XGN A;  2Q95 A;  3PKE A;  4OOK A;  3L7G A;  2ADU A;  4U6C A;  5JI6 A;  1BOA A;  2GU4 A;  1O0X A;  2OAZ A;  2GGB A;  2GG9 A;  3ROR A;  4ZWU A;  1C23 A;  2HOW A;  4PV4 A;  2BHD A;  1QXW A;  2Q93 A;  4S01 A;  1QZY A;  3IU7 A;  4S00 A;  1XGO A;  4FO7 A;  5E5B A;  1CHM A;  2P9A A;  3L24 A;  2DFI A;  4U73 A;  2P99 A;  2BHB A;  1C22 A;  1BN5 A;  2Q8K A;  4IKS A;  3PKB A;  4U70 A;  1YW8 A;  1C27 A;  3IU9 A;  1R5G A;  2GU7 A;  2Q94 A;  4IKU A;  2B3L A;  2G6P A;  1KQ0 A;  4ZWO A;  4FUK A;  5CE6 A;  1C21 A;  2P98 A;  4FLK A;  4IKT A;  4B28 A;  2V3Z A;  1WN1 A;  2BWY A;  4U1B A;  2IW2 A;  3FMR A;  1YW9 A;  1XGM A;  1QXY A;  2GG7 A;  4U75 A;  4U6E A;  5CDV A;  2ZSG A;  1B59 A;  4S2R P;  4JUQ A;  2BN7 A;  5FCF A;  4Z7M A;  3PKC A;  2BWW A;  4IKR A;  4FKC A;  5CDE A;  1JAW A;  5CIK A;  2OKN A;  4R60 A;  2Q92 A;  3CTZ A;  2GG3 A;  3D27 A;  1KQ9 A;  2GG8 A;  3RVA A;  2EA2 A;  1WKM A;  1MAT A;  3CB5 A;  2GGC A;  4A6W A;  4ZNG A;  2NQ7 A;  2EA4 A;  1M35 A;  1WLR A;  4RZZ A;  3BIQ A;  1Y1N A;  2MAT A;  1W2M A;  2V6C A;  1R58 A;  4FLL A;  4RGZ 1;  4FO8 A;  1WBQ A;  2EVM A;  3TAV A;  5JHU A;  4U6Z A;  4U6W A;  1YW7 A;  4IPA A;  2BWS A;  4U71 A;  3MX6 A;  3Q6D A;  5CDL A;  4KM3 A;  2GZ5 A;  4HXX A;  1R5H A;  4U76 A;  2BH3 A;  2B3K A;  2V3Y A;  1B6A A;  4IEC A;  1YJ3 A;  4IDY A;  4IU6 A;  3PKD A;  4QR8 A;  5D6E A;  2B3H A;  1W7V A;  4S2T P;  4U6J A;  3CB6 A;  4RZY A;  1PV9 A;  2V3X A;  2BWX A;  5FCH A;  5CNX A;  2BHC A;  1WL6 A;  1C24 A;  3MR1 A;  2GG5 A;  1WY2 A;  4FLJ A;  1N51 A;  4MAT A;  4FLI A;  3PKA A;  3MAT A;  4PNC A;  1XGS A;  3IU8 A;  2EVO A;  2GU5 A;  2Q96 A;  2GG2 A;  3FMQ A;  3BIP A;  1XNZ A;  1YVM A;  4IF7 A;  1QXZ A;  3IG4 A;  2EVC A;  2BWU A;  2NQ6 A;  2GTX A; 
#chains in the Genus database with same CATH homology
 1WL9 A;  3S6B A;  2GG0 A;  2BWT A;  5JFR A;  2BHA A;  2GA2 A;  5CLS A;  2BWV A;  4A6V A;  1A16 A;  2GU6 A;  3BIT A;  3FM3 A;  5D6F A;  4ZWP A;  4U69 A;  3TB5 A;  4EGE A;  1KP0 A;  2BB7 A;  1XGN A;  2Q95 A;  3PKE A;  4OOK A;  3L7G A;  2ADU A;  4U6C A;  5JI6 A;  1BOA A;  2GU4 A;  1O0X A;  2OAZ A;  2GGB A;  2GG9 A;  3ROR A;  4ZWU A;  1C23 A;  2HOW A;  4PV4 A;  2BHD A;  1QXW A;  2Q93 A;  4S01 A;  1QZY A;  3IU7 A;  4S00 A;  1XGO A;  4FO7 A;  5E5B A;  1CHM A;  2P9A A;  3L24 A;  2DFI A;  4U73 A;  2P99 A;  2BHB A;  1C22 A;  1BN5 A;  2Q8K A;  4IKS A;  3PKB A;  4U70 A;  1YW8 A;  1C27 A;  3IU9 A;  1R5G A;  2GU7 A;  2Q94 A;  4IKU A;  2B3L A;  2G6P A;  1KQ0 A;  4ZWO A;  4FUK A;  5CE6 A;  1C21 A;  2P98 A;  4FLK A;  4IKT A;  4B28 A;  2V3Z A;  1WN1 A;  2BWY A;  4U1B A;  2IW2 A;  3FMR A;  1YW9 A;  1XGM A;  1QXY A;  2GG7 A;  4U75 A;  4U6E A;  5CDV A;  2ZSG A;  1B59 A;  4S2R P;  4JUQ A;  2BN7 A;  5FCF A;  4Z7M A;  3PKC A;  2BWW A;  4IKR A;  4FKC A;  5CDE A;  1JAW A;  5CIK A;  2OKN A;  4R60 A;  2Q92 A;  3CTZ A;  2GG3 A;  3D27 A;  1KQ9 A;  2GG8 A;  3RVA A;  2EA2 A;  1WKM A;  1MAT A;  3CB5 A;  2GGC A;  4A6W A;  4ZNG A;  2NQ7 A;  2EA4 A;  1M35 A;  1WLR A;  4RZZ A;  3BIQ A;  1Y1N A;  2MAT A;  1W2M A;  2V6C A;  1R58 A;  4FLL A;  4RGZ 1;  4FO8 A;  1WBQ A;  2EVM A;  3TAV A;  5JHU A;  4U6Z A;  4U6W A;  1YW7 A;  4IPA A;  2BWS A;  4U71 A;  3MX6 A;  3Q6D A;  5CDL A;  4KM3 A;  2GZ5 A;  4HXX A;  1R5H A;  4U76 A;  2BH3 A;  2B3K A;  2V3Y A;  1B6A A;  4IEC A;  1YJ3 A;  4IDY A;  4IU6 A;  3PKD A;  4QR8 A;  5D6E A;  2B3H A;  1W7V A;  4S2T P;  4U6J A;  3CB6 A;  4RZY A;  1PV9 A;  2V3X A;  2BWX A;  5FCH A;  5CNX A;  2BHC A;  1WL6 A;  1C24 A;  3MR1 A;  2GG5 A;  1WY2 A;  4FLJ A;  1N51 A;  4MAT A;  4FLI A;  3PKA A;  3MAT A;  4PNC A;  1XGS A;  3IU8 A;  2EVO A;  2GU5 A;  2Q96 A;  2GG2 A;  3FMQ A;  3BIP A;  1XNZ A;  1YVM A;  4IF7 A;  1QXZ A;  3IG4 A;  2EVC A;  2BWU A;  2NQ6 A;  2GTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...