3D27A

E. coli methionine aminopeptidase with fe inhibitor w29
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Discovery of inhibitors of Escherichia coli methionine aminopeptidase with the Fe(II)-form selectivity and antibacterial activity.
pubmed doi rcsb
source organism Escherichia coli
total genus 83
structure length 261
sequence length 261
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3d27A00
2BWUA 1R5HA 3FMRA 3L24A 4Z7MA 1R5GA 2HOWA 2NQ7A 5CLSA 3IU7A 2BWXA 2GG2A 2GU5A 3FM3A 5CDEA 3RORA 4S01A 4FO8A 3CTZA 2EA2A 3MATA 1YW7A 2BWVA 2GG8A 1WN1A 4U75A 4IPAA 1XGNA 1A16A 1KP0A 2EVCA 4IKTA 1C27A 1WLRA 4R60A 4RZZA 1WL9A 2ZSGA 3RVAA 4IF7A 3IU8A 1C24A 1W2MA 3S6BA 2Q94A 4S2RP 4ZNGA 4IKUA 5CIKA 4U6CA 2B3KA 2EA4A 3L7GA 4IU6A 2MATA 3CB6A 3MR1A 1KQ9A 1MATA 4FO7A 3BITA 4QR8A 2BHBA 5D6FA 2GTXA 4KM3A 4IDYA 3TAVA 1YW9A 2GA2A 4FLIA 4MATA 3CB5A 2P9AA 4U69A 2GU6A 2V6CA 1C23A 4U71A 2BWWA 2OAZA 3BIPA 3PKAA 1YVMA 4IKRA 3FMQA 2BB7A 2IW2A 3IG4A 1PV9A 1KQ0A 4IECA 1JAWA 4FLJA 2GG0A 2GG9A 1YJ3A 4JUQA 4S2TP 2B3LA 2ADUA 4FKCA 4U73A 1XGSA 4IKSA 2OKNA 2G6PA 2GG3A 2B3HA 1C22A 5JFRA 1BN5A 4PNCA 4HXXA 5E5BA 2GZ5A 4ZWPA 2V3YA 4U1BA 4B28A 2Q96A 1B6AA 1WKMA 2BWYA 5CE6A 4U70A 3MX6A 5JI6A 1XGOA 1XGMA 2BHCA 4U76A 2BWSA 1WBQA 1QXZA 4EGEA 2P99A 3PKCA 2GU7A 2EVMA 1N51A 1YW8A 1O0XA 1QXYA 2BWTA 2Q92A 2V3ZA 1WY2A 4FLLA 4S00A 4U6JA 2BN7A 2GG7A 3PKDA 1BOAA 1QXWA 2BH3A 4RGZ1 2DFIA 2Q95A 2GGBA 4A6VA 4ZWOA 5FCHA 2NQ6A 2GGCA 3IU9A 4FUKA 1CHMA 3PKEA 2Q8KA 1R58A 5CNXA 1XNZA 3TB5A 5D6EA 5CDVA 3BIQA 4RZYA 1W7VA 2BHDA 4U6WA 5CDLA 5FCFA 1QZYA 5JHUA 4U6ZA 4A6WA 1B59A 2V3XA 4PV4A 1WL6A 2BHAA 3Q6DA 4U6EA 1M35A 2Q93A 2GU4A 2EVOA 4ZWUA 1Y1NA 2GG5A 4OOKA 3D27A 2P98A 1C21A 4FLKA 3PKBA
chains in the Genus database with same CATH superfamily
2BWUA 1R5HA 3FMRA 3L24A 4Z7MA 1R5GA 2HOWA 2NQ7A 5CLSA 3IU7A 2BWXA 2GG2A 2GU5A 3FM3A 5CDEA 3RORA 4S01A 4FO8A 3CTZA 2EA2A 3MATA 1YW7A 2BWVA 2GG8A 1WN1A 4U75A 4IPAA 1XGNA 1A16A 1KP0A 2EVCA 4IKTA 1C27A 1WLRA 4R60A 4RZZA 1WL9A 2ZSGA 3RVAA 4IF7A 3IU8A 1C24A 1W2MA 3S6BA 2Q94A 4S2RP 4ZNGA 4IKUA 5CIKA 4U6CA 2B3KA 2EA4A 3L7GA 4IU6A 2MATA 3CB6A 3MR1A 1KQ9A 1MATA 4FO7A 3BITA 4QR8A 2BHBA 5D6FA 2GTXA 4KM3A 4IDYA 3TAVA 1YW9A 2GA2A 4FLIA 4MATA 3CB5A 2P9AA 4U69A 2GU6A 2V6CA 1C23A 4U71A 2BWWA 2OAZA 3BIPA 3PKAA 1YVMA 4IKRA 3FMQA 2BB7A 2IW2A 3IG4A 1PV9A 1KQ0A 4IECA 1JAWA 4FLJA 2GG0A 2GG9A 1YJ3A 4JUQA 4S2TP 2B3LA 2ADUA 4FKCA 4U73A 1XGSA 4IKSA 2OKNA 2G6PA 2GG3A 2B3HA 1C22A 5JFRA 1BN5A 4PNCA 4HXXA 5E5BA 2GZ5A 4ZWPA 2V3YA 4U1BA 4B28A 2Q96A 1B6AA 1WKMA 2BWYA 5CE6A 4U70A 3MX6A 5JI6A 1XGOA 1XGMA 2BHCA 4U76A 2BWSA 1WBQA 1QXZA 4EGEA 2P99A 3PKCA 2GU7A 2EVMA 1N51A 1YW8A 1O0XA 1QXYA 2BWTA 2Q92A 2V3ZA 1WY2A 4FLLA 4S00A 4U6JA 2BN7A 2GG7A 3PKDA 1BOAA 1QXWA 2BH3A 4RGZ1 2DFIA 2Q95A 2GGBA 4A6VA 4ZWOA 5FCHA 2NQ6A 2GGCA 3IU9A 4FUKA 1CHMA 3PKEA 2Q8KA 1R58A 5CNXA 1XNZA 3TB5A 5D6EA 5CDVA 3BIQA 4RZYA 1W7VA 2BHDA 4U6WA 5CDLA 5FCFA 1QZYA 5JHUA 4U6ZA 4A6WA 1B59A 2V3XA 4PV4A 1WL6A 2BHAA 3Q6DA 4U6EA 1M35A 2Q93A 2GU4A 2EVOA 4ZWUA 1Y1NA 2GG5A 4OOKA 3D27A 2P98A 1C21A 4FLKA 3PKBA
chains in the Genus database with same CATH topology
2BWUA 1R5HA 3FMRA 3L24A 4Z7MA 1R5GA 2HOWA 2NQ7A 5CLSA 3IU7A 2BWXA 2GG2A 2GU5A 3FM3A 5CDEA 3RORA 4S01A 4FO8A 3CTZA 2EA2A 3MATA 1YW7A 2BWVA 2GG8A 1WN1A 4U75A 4IPAA 1XGNA 1A16A 1KP0A 2EVCA 4IKTA 1C27A 1WLRA 4R60A 4RZZA 1WL9A 2ZSGA 3RVAA 4IF7A 3IU8A 1C24A 1W2MA 3S6BA 2Q94A 4S2RP 4ZNGA 4IKUA 5CIKA 4U6CA 2B3KA 2EA4A 3L7GA 4IU6A 2MATA 3CB6A 3MR1A 1KQ9A 1MATA 4FO7A 3BITA 4QR8A 2BHBA 5D6FA 2GTXA 4KM3A 4IDYA 3TAVA 1YW9A 2GA2A 4FLIA 4MATA 3CB5A 2P9AA 4U69A 2GU6A 2V6CA 1C23A 4U71A 2BWWA 2OAZA 3BIPA 3PKAA 1YVMA 4IKRA 3FMQA 2BB7A 2IW2A 3IG4A 1PV9A 1KQ0A 4IECA 1JAWA 4FLJA 2GG0A 2GG9A 1YJ3A 4JUQA 4S2TP 2B3LA 2ADUA 4FKCA 4U73A 1XGSA 4IKSA 2OKNA 2G6PA 2GG3A 2B3HA 1C22A 5JFRA 1BN5A 4PNCA 4HXXA 5E5BA 2GZ5A 4ZWPA 2V3YA 4U1BA 4B28A 2Q96A 1B6AA 1WKMA 2BWYA 5CE6A 4U70A 3MX6A 5JI6A 1XGOA 1XGMA 2BHCA 4U76A 2BWSA 1WBQA 1QXZA 4EGEA 2P99A 3PKCA 2GU7A 2EVMA 1N51A 1YW8A 1O0XA 1QXYA 2BWTA 2Q92A 2V3ZA 1WY2A 4FLLA 4S00A 4U6JA 2BN7A 2GG7A 3PKDA 1BOAA 1QXWA 2BH3A 4RGZ1 2DFIA 2Q95A 2GGBA 4A6VA 4ZWOA 5FCHA 2NQ6A 2GGCA 3IU9A 4FUKA 1CHMA 3PKEA 2Q8KA 1R58A 5CNXA 1XNZA 3TB5A 5D6EA 5CDVA 3BIQA 4RZYA 1W7VA 2BHDA 4U6WA 5CDLA 5FCFA 1QZYA 5JHUA 4U6ZA 4A6WA 1B59A 2V3XA 4PV4A 1WL6A 2BHAA 3Q6DA 4U6EA 1M35A 2Q93A 2GU4A 2EVOA 4ZWUA 1Y1NA 2GG5A 4OOKA 3D27A 2P98A 1C21A 4FLKA 3PKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWU A;  1R5H A;  3FMR A;  3L24 A;  4Z7M A;  1R5G A;  2HOW A;  2NQ7 A;  5CLS A;  3IU7 A;  2BWX A;  2GG2 A;  2GU5 A;  3FM3 A;  5CDE A;  3ROR A;  4S01 A;  4FO8 A;  3CTZ A;  2EA2 A;  3MAT A;  1YW7 A;  2BWV A;  2GG8 A;  1WN1 A;  4U75 A;  4IPA A;  1XGN A;  1A16 A;  1KP0 A;  2EVC A;  4IKT A;  1C27 A;  1WLR A;  4R60 A;  4RZZ A;  1WL9 A;  2ZSG A;  3RVA A;  4IF7 A;  3IU8 A;  1C24 A;  1W2M A;  3S6B A;  2Q94 A;  4S2R P;  4ZNG A;  4IKU A;  5CIK A;  4U6C A;  2B3K A;  2EA4 A;  3L7G A;  4IU6 A;  2MAT A;  3CB6 A;  3MR1 A;  1KQ9 A;  1MAT A;  4FO7 A;  3BIT A;  4QR8 A;  2BHB A;  5D6F A;  2GTX A;  4KM3 A;  4IDY A;  3TAV A;  1YW9 A;  2GA2 A;  4FLI A;  4MAT A;  3CB5 A;  2P9A A;  4U69 A;  2GU6 A;  2V6C A;  1C23 A;  4U71 A;  2BWW A;  2OAZ A;  3BIP A;  3PKA A;  1YVM A;  4IKR A;  3FMQ A;  2BB7 A;  2IW2 A;  3IG4 A;  1PV9 A;  1KQ0 A;  4IEC A;  1JAW A;  4FLJ A;  2GG0 A;  2GG9 A;  1YJ3 A;  4JUQ A;  4S2T P;  2B3L A;  2ADU A;  4FKC A;  4U73 A;  1XGS A;  4IKS A;  2OKN A;  2G6P A;  2GG3 A;  2B3H A;  1C22 A;  5JFR A;  1BN5 A;  4PNC A;  4HXX A;  5E5B A;  2GZ5 A;  4ZWP A;  2V3Y A;  4U1B A;  4B28 A;  2Q96 A;  1B6A A;  1WKM A;  2BWY A;  5CE6 A;  4U70 A;  3MX6 A;  5JI6 A;  1XGO A;  1XGM A;  2BHC A;  4U76 A;  2BWS A;  1WBQ A;  1QXZ A;  4EGE A;  2P99 A;  3PKC A;  2GU7 A;  2EVM A;  1N51 A;  1YW8 A;  1O0X A;  1QXY A;  2BWT A;  2Q92 A;  2V3Z A;  1WY2 A;  4FLL A;  4S00 A;  4U6J A;  2BN7 A;  2GG7 A;  3PKD A;  1BOA A;  1QXW A;  2BH3 A;  4RGZ 1;  2DFI A;  2Q95 A;  2GGB A;  4A6V A;  4ZWO A;  5FCH A;  2NQ6 A;  2GGC A;  3IU9 A;  4FUK A;  1CHM A;  3PKE A;  2Q8K A;  1R58 A;  5CNX A;  1XNZ A;  3TB5 A;  5D6E A;  5CDV A;  3BIQ A;  4RZY A;  1W7V A;  2BHD A;  4U6W A;  5CDL A;  5FCF A;  1QZY A;  5JHU A;  4U6Z A;  4A6W A;  1B59 A;  2V3X A;  4PV4 A;  1WL6 A;  2BHA A;  3Q6D A;  4U6E A;  1M35 A;  2Q93 A;  2GU4 A;  2EVO A;  4ZWU A;  1Y1N A;  2GG5 A;  4OOK A;  3D27 A;  2P98 A;  1C21 A;  4FLK A;  3PKB A; 
#chains in the Genus database with same CATH topology
 2BWU A;  1R5H A;  3FMR A;  3L24 A;  4Z7M A;  1R5G A;  2HOW A;  2NQ7 A;  5CLS A;  3IU7 A;  2BWX A;  2GG2 A;  2GU5 A;  3FM3 A;  5CDE A;  3ROR A;  4S01 A;  4FO8 A;  3CTZ A;  2EA2 A;  3MAT A;  1YW7 A;  2BWV A;  2GG8 A;  1WN1 A;  4U75 A;  4IPA A;  1XGN A;  1A16 A;  1KP0 A;  2EVC A;  4IKT A;  1C27 A;  1WLR A;  4R60 A;  4RZZ A;  1WL9 A;  2ZSG A;  3RVA A;  4IF7 A;  3IU8 A;  1C24 A;  1W2M A;  3S6B A;  2Q94 A;  4S2R P;  4ZNG A;  4IKU A;  5CIK A;  4U6C A;  2B3K A;  2EA4 A;  3L7G A;  4IU6 A;  2MAT A;  3CB6 A;  3MR1 A;  1KQ9 A;  1MAT A;  4FO7 A;  3BIT A;  4QR8 A;  2BHB A;  5D6F A;  2GTX A;  4KM3 A;  4IDY A;  3TAV A;  1YW9 A;  2GA2 A;  4FLI A;  4MAT A;  3CB5 A;  2P9A A;  4U69 A;  2GU6 A;  2V6C A;  1C23 A;  4U71 A;  2BWW A;  2OAZ A;  3BIP A;  3PKA A;  1YVM A;  4IKR A;  3FMQ A;  2BB7 A;  2IW2 A;  3IG4 A;  1PV9 A;  1KQ0 A;  4IEC A;  1JAW A;  4FLJ A;  2GG0 A;  2GG9 A;  1YJ3 A;  4JUQ A;  4S2T P;  2B3L A;  2ADU A;  4FKC A;  4U73 A;  1XGS A;  4IKS A;  2OKN A;  2G6P A;  2GG3 A;  2B3H A;  1C22 A;  5JFR A;  1BN5 A;  4PNC A;  4HXX A;  5E5B A;  2GZ5 A;  4ZWP A;  2V3Y A;  4U1B A;  4B28 A;  2Q96 A;  1B6A A;  1WKM A;  2BWY A;  5CE6 A;  4U70 A;  3MX6 A;  5JI6 A;  1XGO A;  1XGM A;  2BHC A;  4U76 A;  2BWS A;  1WBQ A;  1QXZ A;  4EGE A;  2P99 A;  3PKC A;  2GU7 A;  2EVM A;  1N51 A;  1YW8 A;  1O0X A;  1QXY A;  2BWT A;  2Q92 A;  2V3Z A;  1WY2 A;  4FLL A;  4S00 A;  4U6J A;  2BN7 A;  2GG7 A;  3PKD A;  1BOA A;  1QXW A;  2BH3 A;  4RGZ 1;  2DFI A;  2Q95 A;  2GGB A;  4A6V A;  4ZWO A;  5FCH A;  2NQ6 A;  2GGC A;  3IU9 A;  4FUK A;  1CHM A;  3PKE A;  2Q8K A;  1R58 A;  5CNX A;  1XNZ A;  3TB5 A;  5D6E A;  5CDV A;  3BIQ A;  4RZY A;  1W7V A;  2BHD A;  4U6W A;  5CDL A;  5FCF A;  1QZY A;  5JHU A;  4U6Z A;  4A6W A;  1B59 A;  2V3X A;  4PV4 A;  1WL6 A;  2BHA A;  3Q6D A;  4U6E A;  1M35 A;  2Q93 A;  2GU4 A;  2EVO A;  4ZWU A;  1Y1N A;  2GG5 A;  4OOK A;  3D27 A;  2P98 A;  1C21 A;  4FLK A;  3PKB A; 
#chains in the Genus database with same CATH homology
 2BWU A;  1R5H A;  3FMR A;  3L24 A;  4Z7M A;  1R5G A;  2HOW A;  2NQ7 A;  5CLS A;  3IU7 A;  2BWX A;  2GG2 A;  2GU5 A;  3FM3 A;  5CDE A;  3ROR A;  4S01 A;  4FO8 A;  3CTZ A;  2EA2 A;  3MAT A;  1YW7 A;  2BWV A;  2GG8 A;  1WN1 A;  4U75 A;  4IPA A;  1XGN A;  1A16 A;  1KP0 A;  2EVC A;  4IKT A;  1C27 A;  1WLR A;  4R60 A;  4RZZ A;  1WL9 A;  2ZSG A;  3RVA A;  4IF7 A;  3IU8 A;  1C24 A;  1W2M A;  3S6B A;  2Q94 A;  4S2R P;  4ZNG A;  4IKU A;  5CIK A;  4U6C A;  2B3K A;  2EA4 A;  3L7G A;  4IU6 A;  2MAT A;  3CB6 A;  3MR1 A;  1KQ9 A;  1MAT A;  4FO7 A;  3BIT A;  4QR8 A;  2BHB A;  5D6F A;  2GTX A;  4KM3 A;  4IDY A;  3TAV A;  1YW9 A;  2GA2 A;  4FLI A;  4MAT A;  3CB5 A;  2P9A A;  4U69 A;  2GU6 A;  2V6C A;  1C23 A;  4U71 A;  2BWW A;  2OAZ A;  3BIP A;  3PKA A;  1YVM A;  4IKR A;  3FMQ A;  2BB7 A;  2IW2 A;  3IG4 A;  1PV9 A;  1KQ0 A;  4IEC A;  1JAW A;  4FLJ A;  2GG0 A;  2GG9 A;  1YJ3 A;  4JUQ A;  4S2T P;  2B3L A;  2ADU A;  4FKC A;  4U73 A;  1XGS A;  4IKS A;  2OKN A;  2G6P A;  2GG3 A;  2B3H A;  1C22 A;  5JFR A;  1BN5 A;  4PNC A;  4HXX A;  5E5B A;  2GZ5 A;  4ZWP A;  2V3Y A;  4U1B A;  4B28 A;  2Q96 A;  1B6A A;  1WKM A;  2BWY A;  5CE6 A;  4U70 A;  3MX6 A;  5JI6 A;  1XGO A;  1XGM A;  2BHC A;  4U76 A;  2BWS A;  1WBQ A;  1QXZ A;  4EGE A;  2P99 A;  3PKC A;  2GU7 A;  2EVM A;  1N51 A;  1YW8 A;  1O0X A;  1QXY A;  2BWT A;  2Q92 A;  2V3Z A;  1WY2 A;  4FLL A;  4S00 A;  4U6J A;  2BN7 A;  2GG7 A;  3PKD A;  1BOA A;  1QXW A;  2BH3 A;  4RGZ 1;  2DFI A;  2Q95 A;  2GGB A;  4A6V A;  4ZWO A;  5FCH A;  2NQ6 A;  2GGC A;  3IU9 A;  4FUK A;  1CHM A;  3PKE A;  2Q8K A;  1R58 A;  5CNX A;  1XNZ A;  3TB5 A;  5D6E A;  5CDV A;  3BIQ A;  4RZY A;  1W7V A;  2BHD A;  4U6W A;  5CDL A;  5FCF A;  1QZY A;  5JHU A;  4U6Z A;  4A6W A;  1B59 A;  2V3X A;  4PV4 A;  1WL6 A;  2BHA A;  3Q6D A;  4U6E A;  1M35 A;  2Q93 A;  2GU4 A;  2EVO A;  4ZWU A;  1Y1N A;  2GG5 A;  4OOK A;  3D27 A;  2P98 A;  1C21 A;  4FLK A;  3PKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...