2B3LA

Crystal structure of type i human methionine aminopeptidase in the apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
305
structure length
305
Chain Sequence
PYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 305
sequence length 305
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3lA00
4IPAA 1C24A 2BHAA 1JAWA 4JUQA 1QXYA 4FLIA 4FLJA 1C23A 1XGMA 2BWYA 3CTZA 3S6BA 5FCHA 2OKNA 2P98A 1WBQA 4RGZ1 1Y1NA 3PKAA 1W2MA 5CDEA 3CB5A 4ZWOA 1A16A 2ADUA 4S2TP 3MATA 5CNXA 1KQ0A 4R60A 4U70A 1PV9A 2GG8A 4FLKA 1W7VA 2B3LA 4S2RP 2BWTA 4PNCA 4EGEA 3IU7A 2BWWA 2BWUA 3TAVA 2GG7A 3BITA 5D6FA 1WKMA 4FLLA 2EVMA 1WN1A 3MR1A 1YW9A 4ZWPA 2BWVA 4U6EA 5JI6A 3FM3A 2GGBA 1YJ3A 2BH3A 2P99A 2V3YA 3FMQA 1B59A 1B6AA 2GG3A 3PKEA 4OOKA 2P9AA 5FCFA 4ZWUA 2Q92A 2B3KA 2GG0A 2NQ6A 3IU9A 3L24A 2BB7A 4U73A 1QXWA 2DFIA 4KM3A 2BN7A 2Q93A 1YW7A 1MATA 1R58A 3L7GA 5JFRA 3PKCA 3IG4A 1N51A 2Q8KA 3RVAA 3D27A 3FMRA 1M35A 3PKBA 4MATA 3MX6A 1KP0A 2GZ5A 1R5HA 2V3XA 2GGCA 2MATA 1XGOA 2GTXA 4S01A 2GU6A 3BIPA 3BIQA 4HXXA 4RZZA 5CDVA 2G6PA 1XNZA 4U6JA 2HOWA 4U69A 4Z7MA 1O0XA 4A6VA 1C27A 4U6CA 4U71A 3PKDA 2EA4A 2ZSGA 2GU7A 4FKCA 1WY2A 2GU4A 5E5BA 2GU5A 1XGNA 4ZNGA 1KQ9A 2GG2A 2BWXA 1C21A 5CE6A 2BHDA 2EA2A 2NQ7A 4U6ZA 1QXZA 2BHCA 4FUKA 5CLSA 2OAZA 2Q94A 4FO8A 1WLRA 1BOAA 2BWSA 1R5GA 1C22A 4PV4A 2IW2A 1BN5A 3CB6A 1XGSA 1CHMA 1YW8A 2Q96A 4A6WA 4IKTA 2EVCA 4QR8A 5D6EA 1QZYA 4IDYA 4S00A 5CIKA 4U75A 3RORA 4IU6A 1YVMA 4IKSA 4U1BA 3TB5A 5CDLA 2B3HA 5JHUA 4IKRA 4B28A 2V3ZA 4RZYA 2GG9A 4U6WA 1WL9A 2GG5A 3IU8A 2V6CA 4IECA 2GA2A 4FO7A 2BHBA 1WL6A 4U76A 4IKUA 3Q6DA 2EVOA 2Q95A 4IF7A
chains in the Genus database with same CATH superfamily
4IPAA 1C24A 2BHAA 1JAWA 4JUQA 1QXYA 4FLIA 4FLJA 1C23A 1XGMA 2BWYA 3CTZA 3S6BA 5FCHA 2OKNA 2P98A 1WBQA 4RGZ1 1Y1NA 3PKAA 1W2MA 5CDEA 3CB5A 4ZWOA 1A16A 2ADUA 4S2TP 3MATA 5CNXA 1KQ0A 4R60A 4U70A 1PV9A 2GG8A 4FLKA 1W7VA 2B3LA 4S2RP 2BWTA 4PNCA 4EGEA 3IU7A 2BWWA 2BWUA 3TAVA 2GG7A 3BITA 5D6FA 1WKMA 4FLLA 2EVMA 1WN1A 3MR1A 1YW9A 4ZWPA 2BWVA 4U6EA 5JI6A 3FM3A 2GGBA 1YJ3A 2BH3A 2P99A 2V3YA 3FMQA 1B59A 1B6AA 2GG3A 3PKEA 4OOKA 2P9AA 5FCFA 4ZWUA 2Q92A 2B3KA 2GG0A 2NQ6A 3IU9A 3L24A 2BB7A 4U73A 1QXWA 2DFIA 4KM3A 2BN7A 2Q93A 1YW7A 1MATA 1R58A 3L7GA 5JFRA 3PKCA 3IG4A 1N51A 2Q8KA 3RVAA 3D27A 3FMRA 1M35A 3PKBA 4MATA 3MX6A 1KP0A 2GZ5A 1R5HA 2V3XA 2GGCA 2MATA 1XGOA 2GTXA 4S01A 2GU6A 3BIPA 3BIQA 4HXXA 4RZZA 5CDVA 2G6PA 1XNZA 4U6JA 2HOWA 4U69A 4Z7MA 1O0XA 4A6VA 1C27A 4U6CA 4U71A 3PKDA 2EA4A 2ZSGA 2GU7A 4FKCA 1WY2A 2GU4A 5E5BA 2GU5A 1XGNA 4ZNGA 1KQ9A 2GG2A 2BWXA 1C21A 5CE6A 2BHDA 2EA2A 2NQ7A 4U6ZA 1QXZA 2BHCA 4FUKA 5CLSA 2OAZA 2Q94A 4FO8A 1WLRA 1BOAA 2BWSA 1R5GA 1C22A 4PV4A 2IW2A 1BN5A 3CB6A 1XGSA 1CHMA 1YW8A 2Q96A 4A6WA 4IKTA 2EVCA 4QR8A 5D6EA 1QZYA 4IDYA 4S00A 5CIKA 4U75A 3RORA 4IU6A 1YVMA 4IKSA 4U1BA 3TB5A 5CDLA 2B3HA 5JHUA 4IKRA 4B28A 2V3ZA 4RZYA 2GG9A 4U6WA 1WL9A 2GG5A 3IU8A 2V6CA 4IECA 2GA2A 4FO7A 2BHBA 1WL6A 4U76A 4IKUA 3Q6DA 2EVOA 2Q95A 4IF7A
chains in the Genus database with same CATH topology
4IPAA 1C24A 2BHAA 1JAWA 4JUQA 1QXYA 4FLIA 4FLJA 1C23A 1XGMA 2BWYA 3CTZA 3S6BA 5FCHA 2OKNA 2P98A 1WBQA 4RGZ1 1Y1NA 3PKAA 1W2MA 5CDEA 3CB5A 4ZWOA 1A16A 2ADUA 4S2TP 3MATA 5CNXA 1KQ0A 4R60A 4U70A 1PV9A 2GG8A 4FLKA 1W7VA 2B3LA 4S2RP 2BWTA 4PNCA 4EGEA 3IU7A 2BWWA 2BWUA 3TAVA 2GG7A 3BITA 5D6FA 1WKMA 4FLLA 2EVMA 1WN1A 3MR1A 1YW9A 4ZWPA 2BWVA 4U6EA 5JI6A 3FM3A 2GGBA 1YJ3A 2BH3A 2P99A 2V3YA 3FMQA 1B59A 1B6AA 2GG3A 3PKEA 4OOKA 2P9AA 5FCFA 4ZWUA 2Q92A 2B3KA 2GG0A 2NQ6A 3IU9A 3L24A 2BB7A 4U73A 1QXWA 2DFIA 4KM3A 2BN7A 2Q93A 1YW7A 1MATA 1R58A 3L7GA 5JFRA 3PKCA 3IG4A 1N51A 2Q8KA 3RVAA 3D27A 3FMRA 1M35A 3PKBA 4MATA 3MX6A 1KP0A 2GZ5A 1R5HA 2V3XA 2GGCA 2MATA 1XGOA 2GTXA 4S01A 2GU6A 3BIPA 3BIQA 4HXXA 4RZZA 5CDVA 2G6PA 1XNZA 4U6JA 2HOWA 4U69A 4Z7MA 1O0XA 4A6VA 1C27A 4U6CA 4U71A 3PKDA 2EA4A 2ZSGA 2GU7A 4FKCA 1WY2A 2GU4A 5E5BA 2GU5A 1XGNA 4ZNGA 1KQ9A 2GG2A 2BWXA 1C21A 5CE6A 2BHDA 2EA2A 2NQ7A 4U6ZA 1QXZA 2BHCA 4FUKA 5CLSA 2OAZA 2Q94A 4FO8A 1WLRA 1BOAA 2BWSA 1R5GA 1C22A 4PV4A 2IW2A 1BN5A 3CB6A 1XGSA 1CHMA 1YW8A 2Q96A 4A6WA 4IKTA 2EVCA 4QR8A 5D6EA 1QZYA 4IDYA 4S00A 5CIKA 4U75A 3RORA 4IU6A 1YVMA 4IKSA 4U1BA 3TB5A 5CDLA 2B3HA 5JHUA 4IKRA 4B28A 2V3ZA 4RZYA 2GG9A 4U6WA 1WL9A 2GG5A 3IU8A 2V6CA 4IECA 2GA2A 4FO7A 2BHBA 1WL6A 4U76A 4IKUA 3Q6DA 2EVOA 2Q95A 4IF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPA A;  1C24 A;  2BHA A;  1JAW A;  4JUQ A;  1QXY A;  4FLI A;  4FLJ A;  1C23 A;  1XGM A;  2BWY A;  3CTZ A;  3S6B A;  5FCH A;  2OKN A;  2P98 A;  1WBQ A;  4RGZ 1;  1Y1N A;  3PKA A;  1W2M A;  5CDE A;  3CB5 A;  4ZWO A;  1A16 A;  2ADU A;  4S2T P;  3MAT A;  5CNX A;  1KQ0 A;  4R60 A;  4U70 A;  1PV9 A;  2GG8 A;  4FLK A;  1W7V A;  2B3L A;  4S2R P;  2BWT A;  4PNC A;  4EGE A;  3IU7 A;  2BWW A;  2BWU A;  3TAV A;  2GG7 A;  3BIT A;  5D6F A;  1WKM A;  4FLL A;  2EVM A;  1WN1 A;  3MR1 A;  1YW9 A;  4ZWP A;  2BWV A;  4U6E A;  5JI6 A;  3FM3 A;  2GGB A;  1YJ3 A;  2BH3 A;  2P99 A;  2V3Y A;  3FMQ A;  1B59 A;  1B6A A;  2GG3 A;  3PKE A;  4OOK A;  2P9A A;  5FCF A;  4ZWU A;  2Q92 A;  2B3K A;  2GG0 A;  2NQ6 A;  3IU9 A;  3L24 A;  2BB7 A;  4U73 A;  1QXW A;  2DFI A;  4KM3 A;  2BN7 A;  2Q93 A;  1YW7 A;  1MAT A;  1R58 A;  3L7G A;  5JFR A;  3PKC A;  3IG4 A;  1N51 A;  2Q8K A;  3RVA A;  3D27 A;  3FMR A;  1M35 A;  3PKB A;  4MAT A;  3MX6 A;  1KP0 A;  2GZ5 A;  1R5H A;  2V3X A;  2GGC A;  2MAT A;  1XGO A;  2GTX A;  4S01 A;  2GU6 A;  3BIP A;  3BIQ A;  4HXX A;  4RZZ A;  5CDV A;  2G6P A;  1XNZ A;  4U6J A;  2HOW A;  4U69 A;  4Z7M A;  1O0X A;  4A6V A;  1C27 A;  4U6C A;  4U71 A;  3PKD A;  2EA4 A;  2ZSG A;  2GU7 A;  4FKC A;  1WY2 A;  2GU4 A;  5E5B A;  2GU5 A;  1XGN A;  4ZNG A;  1KQ9 A;  2GG2 A;  2BWX A;  1C21 A;  5CE6 A;  2BHD A;  2EA2 A;  2NQ7 A;  4U6Z A;  1QXZ A;  2BHC A;  4FUK A;  5CLS A;  2OAZ A;  2Q94 A;  4FO8 A;  1WLR A;  1BOA A;  2BWS A;  1R5G A;  1C22 A;  4PV4 A;  2IW2 A;  1BN5 A;  3CB6 A;  1XGS A;  1CHM A;  1YW8 A;  2Q96 A;  4A6W A;  4IKT A;  2EVC A;  4QR8 A;  5D6E A;  1QZY A;  4IDY A;  4S00 A;  5CIK A;  4U75 A;  3ROR A;  4IU6 A;  1YVM A;  4IKS A;  4U1B A;  3TB5 A;  5CDL A;  2B3H A;  5JHU A;  4IKR A;  4B28 A;  2V3Z A;  4RZY A;  2GG9 A;  4U6W A;  1WL9 A;  2GG5 A;  3IU8 A;  2V6C A;  4IEC A;  2GA2 A;  4FO7 A;  2BHB A;  1WL6 A;  4U76 A;  4IKU A;  3Q6D A;  2EVO A;  2Q95 A;  4IF7 A; 
#chains in the Genus database with same CATH topology
 4IPA A;  1C24 A;  2BHA A;  1JAW A;  4JUQ A;  1QXY A;  4FLI A;  4FLJ A;  1C23 A;  1XGM A;  2BWY A;  3CTZ A;  3S6B A;  5FCH A;  2OKN A;  2P98 A;  1WBQ A;  4RGZ 1;  1Y1N A;  3PKA A;  1W2M A;  5CDE A;  3CB5 A;  4ZWO A;  1A16 A;  2ADU A;  4S2T P;  3MAT A;  5CNX A;  1KQ0 A;  4R60 A;  4U70 A;  1PV9 A;  2GG8 A;  4FLK A;  1W7V A;  2B3L A;  4S2R P;  2BWT A;  4PNC A;  4EGE A;  3IU7 A;  2BWW A;  2BWU A;  3TAV A;  2GG7 A;  3BIT A;  5D6F A;  1WKM A;  4FLL A;  2EVM A;  1WN1 A;  3MR1 A;  1YW9 A;  4ZWP A;  2BWV A;  4U6E A;  5JI6 A;  3FM3 A;  2GGB A;  1YJ3 A;  2BH3 A;  2P99 A;  2V3Y A;  3FMQ A;  1B59 A;  1B6A A;  2GG3 A;  3PKE A;  4OOK A;  2P9A A;  5FCF A;  4ZWU A;  2Q92 A;  2B3K A;  2GG0 A;  2NQ6 A;  3IU9 A;  3L24 A;  2BB7 A;  4U73 A;  1QXW A;  2DFI A;  4KM3 A;  2BN7 A;  2Q93 A;  1YW7 A;  1MAT A;  1R58 A;  3L7G A;  5JFR A;  3PKC A;  3IG4 A;  1N51 A;  2Q8K A;  3RVA A;  3D27 A;  3FMR A;  1M35 A;  3PKB A;  4MAT A;  3MX6 A;  1KP0 A;  2GZ5 A;  1R5H A;  2V3X A;  2GGC A;  2MAT A;  1XGO A;  2GTX A;  4S01 A;  2GU6 A;  3BIP A;  3BIQ A;  4HXX A;  4RZZ A;  5CDV A;  2G6P A;  1XNZ A;  4U6J A;  2HOW A;  4U69 A;  4Z7M A;  1O0X A;  4A6V A;  1C27 A;  4U6C A;  4U71 A;  3PKD A;  2EA4 A;  2ZSG A;  2GU7 A;  4FKC A;  1WY2 A;  2GU4 A;  5E5B A;  2GU5 A;  1XGN A;  4ZNG A;  1KQ9 A;  2GG2 A;  2BWX A;  1C21 A;  5CE6 A;  2BHD A;  2EA2 A;  2NQ7 A;  4U6Z A;  1QXZ A;  2BHC A;  4FUK A;  5CLS A;  2OAZ A;  2Q94 A;  4FO8 A;  1WLR A;  1BOA A;  2BWS A;  1R5G A;  1C22 A;  4PV4 A;  2IW2 A;  1BN5 A;  3CB6 A;  1XGS A;  1CHM A;  1YW8 A;  2Q96 A;  4A6W A;  4IKT A;  2EVC A;  4QR8 A;  5D6E A;  1QZY A;  4IDY A;  4S00 A;  5CIK A;  4U75 A;  3ROR A;  4IU6 A;  1YVM A;  4IKS A;  4U1B A;  3TB5 A;  5CDL A;  2B3H A;  5JHU A;  4IKR A;  4B28 A;  2V3Z A;  4RZY A;  2GG9 A;  4U6W A;  1WL9 A;  2GG5 A;  3IU8 A;  2V6C A;  4IEC A;  2GA2 A;  4FO7 A;  2BHB A;  1WL6 A;  4U76 A;  4IKU A;  3Q6D A;  2EVO A;  2Q95 A;  4IF7 A; 
#chains in the Genus database with same CATH homology
 4IPA A;  1C24 A;  2BHA A;  1JAW A;  4JUQ A;  1QXY A;  4FLI A;  4FLJ A;  1C23 A;  1XGM A;  2BWY A;  3CTZ A;  3S6B A;  5FCH A;  2OKN A;  2P98 A;  1WBQ A;  4RGZ 1;  1Y1N A;  3PKA A;  1W2M A;  5CDE A;  3CB5 A;  4ZWO A;  1A16 A;  2ADU A;  4S2T P;  3MAT A;  5CNX A;  1KQ0 A;  4R60 A;  4U70 A;  1PV9 A;  2GG8 A;  4FLK A;  1W7V A;  2B3L A;  4S2R P;  2BWT A;  4PNC A;  4EGE A;  3IU7 A;  2BWW A;  2BWU A;  3TAV A;  2GG7 A;  3BIT A;  5D6F A;  1WKM A;  4FLL A;  2EVM A;  1WN1 A;  3MR1 A;  1YW9 A;  4ZWP A;  2BWV A;  4U6E A;  5JI6 A;  3FM3 A;  2GGB A;  1YJ3 A;  2BH3 A;  2P99 A;  2V3Y A;  3FMQ A;  1B59 A;  1B6A A;  2GG3 A;  3PKE A;  4OOK A;  2P9A A;  5FCF A;  4ZWU A;  2Q92 A;  2B3K A;  2GG0 A;  2NQ6 A;  3IU9 A;  3L24 A;  2BB7 A;  4U73 A;  1QXW A;  2DFI A;  4KM3 A;  2BN7 A;  2Q93 A;  1YW7 A;  1MAT A;  1R58 A;  3L7G A;  5JFR A;  3PKC A;  3IG4 A;  1N51 A;  2Q8K A;  3RVA A;  3D27 A;  3FMR A;  1M35 A;  3PKB A;  4MAT A;  3MX6 A;  1KP0 A;  2GZ5 A;  1R5H A;  2V3X A;  2GGC A;  2MAT A;  1XGO A;  2GTX A;  4S01 A;  2GU6 A;  3BIP A;  3BIQ A;  4HXX A;  4RZZ A;  5CDV A;  2G6P A;  1XNZ A;  4U6J A;  2HOW A;  4U69 A;  4Z7M A;  1O0X A;  4A6V A;  1C27 A;  4U6C A;  4U71 A;  3PKD A;  2EA4 A;  2ZSG A;  2GU7 A;  4FKC A;  1WY2 A;  2GU4 A;  5E5B A;  2GU5 A;  1XGN A;  4ZNG A;  1KQ9 A;  2GG2 A;  2BWX A;  1C21 A;  5CE6 A;  2BHD A;  2EA2 A;  2NQ7 A;  4U6Z A;  1QXZ A;  2BHC A;  4FUK A;  5CLS A;  2OAZ A;  2Q94 A;  4FO8 A;  1WLR A;  1BOA A;  2BWS A;  1R5G A;  1C22 A;  4PV4 A;  2IW2 A;  1BN5 A;  3CB6 A;  1XGS A;  1CHM A;  1YW8 A;  2Q96 A;  4A6W A;  4IKT A;  2EVC A;  4QR8 A;  5D6E A;  1QZY A;  4IDY A;  4S00 A;  5CIK A;  4U75 A;  3ROR A;  4IU6 A;  1YVM A;  4IKS A;  4U1B A;  3TB5 A;  5CDL A;  2B3H A;  5JHU A;  4IKR A;  4B28 A;  2V3Z A;  4RZY A;  2GG9 A;  4U6W A;  1WL9 A;  2GG5 A;  3IU8 A;  2V6C A;  4IEC A;  2GA2 A;  4FO7 A;  2BHB A;  1WL6 A;  4U76 A;  4IKU A;  3Q6D A;  2EVO A;  2Q95 A;  4IF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...