2B3LA

Crystal structure of type i human methionine aminopeptidase in the apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
305
structure length
305
Chain Sequence
b'PYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 305
sequence length 305
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3lA00
3TAVA 1KP0A 2GGCA 2BHAA 2V6CA 4FO7A 1XGOA 2IW2A 1XGMA 4RZZA 4U1BA 2BHBA 2GGBA 4ZWPA 4B28A 4FLLA 1YW9A 2V3YA 1XNZA 4Z7MA 3MATA 2EA4A 2GU4A 5CDLA 1XGSA 1C27A 5CLSA 4U69A 2V3ZA 4S01A 4OOKA 1B6AA 2GG7A 2GG9A 4IKUA 4EGEA 4PV4A 2GZ5A 1QXYA 1Y1NA 1YW8A 4A6VA 2BWWA 3PKCA 2BWUA 1YJ3A 2OAZA 3BITA 4IF7A 1XGNA 2HOWA 2P99A 4R60A 5CNXA 4U6JA 4U71A 1B59A 3L7GA 4ZWUA 2GU5A 3FMQA 2EVOA 1KQ9A 1YW7A 1QXWA 1W2MA 1WL9A 1N51A 5JHUA 4S00A 3IU7A 4IDYA 4FLIA 3PKDA 1C22A 2BWTA 3CTZA 5CE6A 4U6CA 3MR1A 1MATA 1QXZA 1C21A 1WKMA 5E5BA 1M35A 3L24A 1BOAA 2Q93A 1BN5A 2GU6A 5D6FA 3CB5A 2BWVA 2BH3A 4IPAA 1WY2A 2GG3A 4MATA 3D27A 4QR8A 2B3LA 5JFRA 5FCHA 1QZYA 2DFIA 2GG0A 1C23A 2BB7A 3BIQA 2GG5A 2NQ7A 2BN7A 1W7VA 1YVMA 2B3KA 4U73A 5CDEA 4FLKA 4JUQA 4FLJA 2BHCA 5D6EA 3TB5A 2Q94A 4U6ZA 3RVAA 2GG8A 3S6BA 2ZSGA 2BWXA 2BWSA 2GU7A 5JI6A 4S2TP 1R58A 2ADUA 4ZNGA 5FCFA 4S2RP 1CHMA 4U75A 1R5HA 4PNCA 2BHDA 2GA2A 1R5GA 2BWYA 4FKCA 2OKNA 2Q95A 1KQ0A 1O0XA 4IKTA 4RZYA 1WL6A 2GG2A 4U70A 3MX6A 4U6WA 2EVMA 2P9AA 2P98A 1PV9A 4KM3A 3CB6A 2Q8KA 3BIPA 1JAWA 4IECA 3Q6DA 3IG4A 1C24A 4FO8A 2Q92A 1WBQA 4U6EA 3IU9A 2Q96A 1WN1A 2EVCA 5CIKA 2NQ6A 4U76A 2G6PA 3PKBA 3IU8A 1A16A 1WLRA 4HXXA 2GTXA 2B3HA 3RORA 2MATA 4A6WA 2EA2A 4IKSA 3PKAA 4IKRA 3FMRA 4ZWOA 3PKEA 4IU6A 4RGZ1 3FM3A 2V3XA 5CDVA 4FUKA
chains in the Genus database with same CATH superfamily
3TAVA 1KP0A 2GGCA 2BHAA 2V6CA 4FO7A 1XGOA 2IW2A 1XGMA 4RZZA 4U1BA 2BHBA 2GGBA 4ZWPA 4B28A 4FLLA 1YW9A 2V3YA 1XNZA 4Z7MA 3MATA 2EA4A 2GU4A 5CDLA 1XGSA 1C27A 5CLSA 4U69A 2V3ZA 4S01A 4OOKA 1B6AA 2GG7A 2GG9A 4IKUA 4EGEA 4PV4A 2GZ5A 1QXYA 1Y1NA 1YW8A 4A6VA 2BWWA 3PKCA 2BWUA 1YJ3A 2OAZA 3BITA 4IF7A 1XGNA 2HOWA 2P99A 4R60A 5CNXA 4U6JA 4U71A 1B59A 3L7GA 4ZWUA 2GU5A 3FMQA 2EVOA 1KQ9A 1YW7A 1QXWA 1W2MA 1WL9A 1N51A 5JHUA 4S00A 3IU7A 4IDYA 4FLIA 3PKDA 1C22A 2BWTA 3CTZA 5CE6A 4U6CA 3MR1A 1MATA 1QXZA 1C21A 1WKMA 5E5BA 1M35A 3L24A 1BOAA 2Q93A 1BN5A 2GU6A 5D6FA 3CB5A 2BWVA 2BH3A 4IPAA 1WY2A 2GG3A 4MATA 3D27A 4QR8A 2B3LA 5JFRA 5FCHA 1QZYA 2DFIA 2GG0A 1C23A 2BB7A 3BIQA 2GG5A 2NQ7A 2BN7A 1W7VA 1YVMA 2B3KA 4U73A 5CDEA 4FLKA 4JUQA 4FLJA 2BHCA 5D6EA 3TB5A 2Q94A 4U6ZA 3RVAA 2GG8A 3S6BA 2ZSGA 2BWXA 2BWSA 2GU7A 5JI6A 4S2TP 1R58A 2ADUA 4ZNGA 5FCFA 4S2RP 1CHMA 4U75A 1R5HA 4PNCA 2BHDA 2GA2A 1R5GA 2BWYA 4FKCA 2OKNA 2Q95A 1KQ0A 1O0XA 4IKTA 4RZYA 1WL6A 2GG2A 4U70A 3MX6A 4U6WA 2EVMA 2P9AA 2P98A 1PV9A 4KM3A 3CB6A 2Q8KA 3BIPA 1JAWA 4IECA 3Q6DA 3IG4A 1C24A 4FO8A 2Q92A 1WBQA 4U6EA 3IU9A 2Q96A 1WN1A 2EVCA 5CIKA 2NQ6A 4U76A 2G6PA 3PKBA 3IU8A 1A16A 1WLRA 4HXXA 2GTXA 2B3HA 3RORA 2MATA 4A6WA 2EA2A 4IKSA 3PKAA 4IKRA 3FMRA 4ZWOA 3PKEA 4IU6A 4RGZ1 3FM3A 2V3XA 5CDVA 4FUKA
chains in the Genus database with same CATH topology
3TAVA 1KP0A 2GGCA 2BHAA 2V6CA 4FO7A 1XGOA 2IW2A 1XGMA 4RZZA 4U1BA 2BHBA 2GGBA 4ZWPA 4B28A 4FLLA 1YW9A 2V3YA 1XNZA 4Z7MA 3MATA 2EA4A 2GU4A 5CDLA 1XGSA 1C27A 5CLSA 4U69A 2V3ZA 4S01A 4OOKA 1B6AA 2GG7A 2GG9A 4IKUA 4EGEA 4PV4A 2GZ5A 1QXYA 1Y1NA 1YW8A 4A6VA 2BWWA 3PKCA 2BWUA 1YJ3A 2OAZA 3BITA 4IF7A 1XGNA 2HOWA 2P99A 4R60A 5CNXA 4U6JA 4U71A 1B59A 3L7GA 4ZWUA 2GU5A 3FMQA 2EVOA 1KQ9A 1YW7A 1QXWA 1W2MA 1WL9A 1N51A 5JHUA 4S00A 3IU7A 4IDYA 4FLIA 3PKDA 1C22A 2BWTA 3CTZA 5CE6A 4U6CA 3MR1A 1MATA 1QXZA 1C21A 1WKMA 5E5BA 1M35A 3L24A 1BOAA 2Q93A 1BN5A 2GU6A 5D6FA 3CB5A 2BWVA 2BH3A 4IPAA 1WY2A 2GG3A 4MATA 3D27A 4QR8A 2B3LA 5JFRA 5FCHA 1QZYA 2DFIA 2GG0A 1C23A 2BB7A 3BIQA 2GG5A 2NQ7A 2BN7A 1W7VA 1YVMA 2B3KA 4U73A 5CDEA 4FLKA 4JUQA 4FLJA 2BHCA 5D6EA 3TB5A 2Q94A 4U6ZA 3RVAA 2GG8A 3S6BA 2ZSGA 2BWXA 2BWSA 2GU7A 5JI6A 4S2TP 1R58A 2ADUA 4ZNGA 5FCFA 4S2RP 1CHMA 4U75A 1R5HA 4PNCA 2BHDA 2GA2A 1R5GA 2BWYA 4FKCA 2OKNA 2Q95A 1KQ0A 1O0XA 4IKTA 4RZYA 1WL6A 2GG2A 4U70A 3MX6A 4U6WA 2EVMA 2P9AA 2P98A 1PV9A 4KM3A 3CB6A 2Q8KA 3BIPA 1JAWA 4IECA 3Q6DA 3IG4A 1C24A 4FO8A 2Q92A 1WBQA 4U6EA 3IU9A 2Q96A 1WN1A 2EVCA 5CIKA 2NQ6A 4U76A 2G6PA 3PKBA 3IU8A 1A16A 1WLRA 4HXXA 2GTXA 2B3HA 3RORA 2MATA 4A6WA 2EA2A 4IKSA 3PKAA 4IKRA 3FMRA 4ZWOA 3PKEA 4IU6A 4RGZ1 3FM3A 2V3XA 5CDVA 4FUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAV A;  1KP0 A;  2GGC A;  2BHA A;  2V6C A;  4FO7 A;  1XGO A;  2IW2 A;  1XGM A;  4RZZ A;  4U1B A;  2BHB A;  2GGB A;  4ZWP A;  4B28 A;  4FLL A;  1YW9 A;  2V3Y A;  1XNZ A;  4Z7M A;  3MAT A;  2EA4 A;  2GU4 A;  5CDL A;  1XGS A;  1C27 A;  5CLS A;  4U69 A;  2V3Z A;  4S01 A;  4OOK A;  1B6A A;  2GG7 A;  2GG9 A;  4IKU A;  4EGE A;  4PV4 A;  2GZ5 A;  1QXY A;  1Y1N A;  1YW8 A;  4A6V A;  2BWW A;  3PKC A;  2BWU A;  1YJ3 A;  2OAZ A;  3BIT A;  4IF7 A;  1XGN A;  2HOW A;  2P99 A;  4R60 A;  5CNX A;  4U6J A;  4U71 A;  1B59 A;  3L7G A;  4ZWU A;  2GU5 A;  3FMQ A;  2EVO A;  1KQ9 A;  1YW7 A;  1QXW A;  1W2M A;  1WL9 A;  1N51 A;  5JHU A;  4S00 A;  3IU7 A;  4IDY A;  4FLI A;  3PKD A;  1C22 A;  2BWT A;  3CTZ A;  5CE6 A;  4U6C A;  3MR1 A;  1MAT A;  1QXZ A;  1C21 A;  1WKM A;  5E5B A;  1M35 A;  3L24 A;  1BOA A;  2Q93 A;  1BN5 A;  2GU6 A;  5D6F A;  3CB5 A;  2BWV A;  2BH3 A;  4IPA A;  1WY2 A;  2GG3 A;  4MAT A;  3D27 A;  4QR8 A;  2B3L A;  5JFR A;  5FCH A;  1QZY A;  2DFI A;  2GG0 A;  1C23 A;  2BB7 A;  3BIQ A;  2GG5 A;  2NQ7 A;  2BN7 A;  1W7V A;  1YVM A;  2B3K A;  4U73 A;  5CDE A;  4FLK A;  4JUQ A;  4FLJ A;  2BHC A;  5D6E A;  3TB5 A;  2Q94 A;  4U6Z A;  3RVA A;  2GG8 A;  3S6B A;  2ZSG A;  2BWX A;  2BWS A;  2GU7 A;  5JI6 A;  4S2T P;  1R58 A;  2ADU A;  4ZNG A;  5FCF A;  4S2R P;  1CHM A;  4U75 A;  1R5H A;  4PNC A;  2BHD A;  2GA2 A;  1R5G A;  2BWY A;  4FKC A;  2OKN A;  2Q95 A;  1KQ0 A;  1O0X A;  4IKT A;  4RZY A;  1WL6 A;  2GG2 A;  4U70 A;  3MX6 A;  4U6W A;  2EVM A;  2P9A A;  2P98 A;  1PV9 A;  4KM3 A;  3CB6 A;  2Q8K A;  3BIP A;  1JAW A;  4IEC A;  3Q6D A;  3IG4 A;  1C24 A;  4FO8 A;  2Q92 A;  1WBQ A;  4U6E A;  3IU9 A;  2Q96 A;  1WN1 A;  2EVC A;  5CIK A;  2NQ6 A;  4U76 A;  2G6P A;  3PKB A;  3IU8 A;  1A16 A;  1WLR A;  4HXX A;  2GTX A;  2B3H A;  3ROR A;  2MAT A;  4A6W A;  2EA2 A;  4IKS A;  3PKA A;  4IKR A;  3FMR A;  4ZWO A;  3PKE A;  4IU6 A;  4RGZ 1;  3FM3 A;  2V3X A;  5CDV A;  4FUK A; 
#chains in the Genus database with same CATH topology
 3TAV A;  1KP0 A;  2GGC A;  2BHA A;  2V6C A;  4FO7 A;  1XGO A;  2IW2 A;  1XGM A;  4RZZ A;  4U1B A;  2BHB A;  2GGB A;  4ZWP A;  4B28 A;  4FLL A;  1YW9 A;  2V3Y A;  1XNZ A;  4Z7M A;  3MAT A;  2EA4 A;  2GU4 A;  5CDL A;  1XGS A;  1C27 A;  5CLS A;  4U69 A;  2V3Z A;  4S01 A;  4OOK A;  1B6A A;  2GG7 A;  2GG9 A;  4IKU A;  4EGE A;  4PV4 A;  2GZ5 A;  1QXY A;  1Y1N A;  1YW8 A;  4A6V A;  2BWW A;  3PKC A;  2BWU A;  1YJ3 A;  2OAZ A;  3BIT A;  4IF7 A;  1XGN A;  2HOW A;  2P99 A;  4R60 A;  5CNX A;  4U6J A;  4U71 A;  1B59 A;  3L7G A;  4ZWU A;  2GU5 A;  3FMQ A;  2EVO A;  1KQ9 A;  1YW7 A;  1QXW A;  1W2M A;  1WL9 A;  1N51 A;  5JHU A;  4S00 A;  3IU7 A;  4IDY A;  4FLI A;  3PKD A;  1C22 A;  2BWT A;  3CTZ A;  5CE6 A;  4U6C A;  3MR1 A;  1MAT A;  1QXZ A;  1C21 A;  1WKM A;  5E5B A;  1M35 A;  3L24 A;  1BOA A;  2Q93 A;  1BN5 A;  2GU6 A;  5D6F A;  3CB5 A;  2BWV A;  2BH3 A;  4IPA A;  1WY2 A;  2GG3 A;  4MAT A;  3D27 A;  4QR8 A;  2B3L A;  5JFR A;  5FCH A;  1QZY A;  2DFI A;  2GG0 A;  1C23 A;  2BB7 A;  3BIQ A;  2GG5 A;  2NQ7 A;  2BN7 A;  1W7V A;  1YVM A;  2B3K A;  4U73 A;  5CDE A;  4FLK A;  4JUQ A;  4FLJ A;  2BHC A;  5D6E A;  3TB5 A;  2Q94 A;  4U6Z A;  3RVA A;  2GG8 A;  3S6B A;  2ZSG A;  2BWX A;  2BWS A;  2GU7 A;  5JI6 A;  4S2T P;  1R58 A;  2ADU A;  4ZNG A;  5FCF A;  4S2R P;  1CHM A;  4U75 A;  1R5H A;  4PNC A;  2BHD A;  2GA2 A;  1R5G A;  2BWY A;  4FKC A;  2OKN A;  2Q95 A;  1KQ0 A;  1O0X A;  4IKT A;  4RZY A;  1WL6 A;  2GG2 A;  4U70 A;  3MX6 A;  4U6W A;  2EVM A;  2P9A A;  2P98 A;  1PV9 A;  4KM3 A;  3CB6 A;  2Q8K A;  3BIP A;  1JAW A;  4IEC A;  3Q6D A;  3IG4 A;  1C24 A;  4FO8 A;  2Q92 A;  1WBQ A;  4U6E A;  3IU9 A;  2Q96 A;  1WN1 A;  2EVC A;  5CIK A;  2NQ6 A;  4U76 A;  2G6P A;  3PKB A;  3IU8 A;  1A16 A;  1WLR A;  4HXX A;  2GTX A;  2B3H A;  3ROR A;  2MAT A;  4A6W A;  2EA2 A;  4IKS A;  3PKA A;  4IKR A;  3FMR A;  4ZWO A;  3PKE A;  4IU6 A;  4RGZ 1;  3FM3 A;  2V3X A;  5CDV A;  4FUK A; 
#chains in the Genus database with same CATH homology
 3TAV A;  1KP0 A;  2GGC A;  2BHA A;  2V6C A;  4FO7 A;  1XGO A;  2IW2 A;  1XGM A;  4RZZ A;  4U1B A;  2BHB A;  2GGB A;  4ZWP A;  4B28 A;  4FLL A;  1YW9 A;  2V3Y A;  1XNZ A;  4Z7M A;  3MAT A;  2EA4 A;  2GU4 A;  5CDL A;  1XGS A;  1C27 A;  5CLS A;  4U69 A;  2V3Z A;  4S01 A;  4OOK A;  1B6A A;  2GG7 A;  2GG9 A;  4IKU A;  4EGE A;  4PV4 A;  2GZ5 A;  1QXY A;  1Y1N A;  1YW8 A;  4A6V A;  2BWW A;  3PKC A;  2BWU A;  1YJ3 A;  2OAZ A;  3BIT A;  4IF7 A;  1XGN A;  2HOW A;  2P99 A;  4R60 A;  5CNX A;  4U6J A;  4U71 A;  1B59 A;  3L7G A;  4ZWU A;  2GU5 A;  3FMQ A;  2EVO A;  1KQ9 A;  1YW7 A;  1QXW A;  1W2M A;  1WL9 A;  1N51 A;  5JHU A;  4S00 A;  3IU7 A;  4IDY A;  4FLI A;  3PKD A;  1C22 A;  2BWT A;  3CTZ A;  5CE6 A;  4U6C A;  3MR1 A;  1MAT A;  1QXZ A;  1C21 A;  1WKM A;  5E5B A;  1M35 A;  3L24 A;  1BOA A;  2Q93 A;  1BN5 A;  2GU6 A;  5D6F A;  3CB5 A;  2BWV A;  2BH3 A;  4IPA A;  1WY2 A;  2GG3 A;  4MAT A;  3D27 A;  4QR8 A;  2B3L A;  5JFR A;  5FCH A;  1QZY A;  2DFI A;  2GG0 A;  1C23 A;  2BB7 A;  3BIQ A;  2GG5 A;  2NQ7 A;  2BN7 A;  1W7V A;  1YVM A;  2B3K A;  4U73 A;  5CDE A;  4FLK A;  4JUQ A;  4FLJ A;  2BHC A;  5D6E A;  3TB5 A;  2Q94 A;  4U6Z A;  3RVA A;  2GG8 A;  3S6B A;  2ZSG A;  2BWX A;  2BWS A;  2GU7 A;  5JI6 A;  4S2T P;  1R58 A;  2ADU A;  4ZNG A;  5FCF A;  4S2R P;  1CHM A;  4U75 A;  1R5H A;  4PNC A;  2BHD A;  2GA2 A;  1R5G A;  2BWY A;  4FKC A;  2OKN A;  2Q95 A;  1KQ0 A;  1O0X A;  4IKT A;  4RZY A;  1WL6 A;  2GG2 A;  4U70 A;  3MX6 A;  4U6W A;  2EVM A;  2P9A A;  2P98 A;  1PV9 A;  4KM3 A;  3CB6 A;  2Q8K A;  3BIP A;  1JAW A;  4IEC A;  3Q6D A;  3IG4 A;  1C24 A;  4FO8 A;  2Q92 A;  1WBQ A;  4U6E A;  3IU9 A;  2Q96 A;  1WN1 A;  2EVC A;  5CIK A;  2NQ6 A;  4U76 A;  2G6P A;  3PKB A;  3IU8 A;  1A16 A;  1WLR A;  4HXX A;  2GTX A;  2B3H A;  3ROR A;  2MAT A;  4A6W A;  2EA2 A;  4IKS A;  3PKA A;  4IKR A;  3FMR A;  4ZWO A;  3PKE A;  4IU6 A;  4RGZ 1;  3FM3 A;  2V3X A;  5CDV A;  4FUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...