2B3LA

Crystal structure of type i human methionine aminopeptidase in the apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
305
structure length
305
Chain Sequence
PYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 305
sequence length 305
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3lA00
2BH3A 2BHDA 5CLSA 1MATA 2BWUA 2Q93A 2Q92A 3FM3A 1R5HA 2BHAA 2B3LA 5JHUA 4IKUA 2EA2A 2P9AA 3MX6A 4QR8A 4EGEA 1WL9A 4RZYA 4Z7MA 2ZSGA 3Q6DA 1XGOA 4U6CA 5CDLA 3IG4A 4U6EA 1PV9A 4S00A 5FCHA 4U75A 4FLJA 1WL6A 5D6FA 1A16A 4IF7A 4A6WA 1KP0A 2B3KA 4IECA 2V6CA 2G6PA 1W2MA 4U6JA 2BWWA 3PKBA 3PKAA 4IKTA 4OOKA 4B28A 3L7GA 1WKMA 1YJ3A 1Y1NA 2GG0A 5JI6A 4U71A 4RZZA 2B3HA 4ZWPA 1WLRA 5FCFA 2EVOA 3TAVA 1YW8A 2BN7A 4RGZ1 2BHCA 3D27A 3L24A 4KM3A 4IKSA 2EVMA 1XGMA 3BIQA 4JUQA 3BIPA 5CNXA 2Q8KA 4IKRA 1C24A 3PKEA 4FKCA 4MATA 1QXYA 3CB5A 2ADUA 3IU9A 4FUKA 1R5GA 3CTZA 4U6WA 4FLIA 1QXWA 2GU4A 2MATA 3PKCA 1KQ9A 4U69A 4FO8A 1WN1A 4U76A 4ZWUA 1C22A 2BWYA 2Q95A 3FMRA 4PNCA 5CDVA 3PKDA 1C23A 1WBQA 2GG2A 2V3XA 2HOWA 2GU7A 2GU5A 1CHMA 1QZYA 2GA2A 2GG3A 2GU6A 1KQ0A 1BN5A 1M35A 3IU8A 1C21A 4ZNGA 2IW2A 2Q94A 1YW9A 1XNZA 2EA4A 2V3YA 5D6EA 4IDYA 4IU6A 4U6ZA 3S6BA 4FO7A 5JFRA 2Q96A 3RVAA 2GG9A 4R60A 1XGNA 2BB7A 2GG5A 2BWVA 1W7VA 1WY2A 2BHBA 4S2RP 1O0XA 2NQ7A 2EVCA 2GGCA 2OAZA 3MATA 4FLKA 2OKNA 3MR1A 4IPAA 5CDEA 4FLLA 2BWTA 1YW7A 5E5BA 1B59A 4U70A 1R58A 2DFIA 1B6AA 1XGSA 2P99A 3RORA 2P98A 4S01A 1QXZA 3BITA 4PV4A 1YVMA 1BOAA 2GTXA 3CB6A 4U1BA 4A6VA 4HXXA 4ZWOA 1C27A 3IU7A 2GG8A 2BWSA 2GZ5A 2GGBA 4U73A 3FMQA 2BWXA 3TB5A 1N51A 5CIKA 1JAWA 2V3ZA 5CE6A 2GG7A 4S2TP 2NQ6A
chains in the Genus database with same CATH superfamily
2BH3A 2BHDA 5CLSA 1MATA 2BWUA 2Q93A 2Q92A 3FM3A 1R5HA 2BHAA 2B3LA 5JHUA 4IKUA 2EA2A 2P9AA 3MX6A 4QR8A 4EGEA 1WL9A 4RZYA 4Z7MA 2ZSGA 3Q6DA 1XGOA 4U6CA 5CDLA 3IG4A 4U6EA 1PV9A 4S00A 5FCHA 4U75A 4FLJA 1WL6A 5D6FA 1A16A 4IF7A 4A6WA 1KP0A 2B3KA 4IECA 2V6CA 2G6PA 1W2MA 4U6JA 2BWWA 3PKBA 3PKAA 4IKTA 4OOKA 4B28A 3L7GA 1WKMA 1YJ3A 1Y1NA 2GG0A 5JI6A 4U71A 4RZZA 2B3HA 4ZWPA 1WLRA 5FCFA 2EVOA 3TAVA 1YW8A 2BN7A 4RGZ1 2BHCA 3D27A 3L24A 4KM3A 4IKSA 2EVMA 1XGMA 3BIQA 4JUQA 3BIPA 5CNXA 2Q8KA 4IKRA 1C24A 3PKEA 4FKCA 4MATA 1QXYA 3CB5A 2ADUA 3IU9A 4FUKA 1R5GA 3CTZA 4U6WA 4FLIA 1QXWA 2GU4A 2MATA 3PKCA 1KQ9A 4U69A 4FO8A 1WN1A 4U76A 4ZWUA 1C22A 2BWYA 2Q95A 3FMRA 4PNCA 5CDVA 3PKDA 1C23A 1WBQA 2GG2A 2V3XA 2HOWA 2GU7A 2GU5A 1CHMA 1QZYA 2GA2A 2GG3A 2GU6A 1KQ0A 1BN5A 1M35A 3IU8A 1C21A 4ZNGA 2IW2A 2Q94A 1YW9A 1XNZA 2EA4A 2V3YA 5D6EA 4IDYA 4IU6A 4U6ZA 3S6BA 4FO7A 5JFRA 2Q96A 3RVAA 2GG9A 4R60A 1XGNA 2BB7A 2GG5A 2BWVA 1W7VA 1WY2A 2BHBA 4S2RP 1O0XA 2NQ7A 2EVCA 2GGCA 2OAZA 3MATA 4FLKA 2OKNA 3MR1A 4IPAA 5CDEA 4FLLA 2BWTA 1YW7A 5E5BA 1B59A 4U70A 1R58A 2DFIA 1B6AA 1XGSA 2P99A 3RORA 2P98A 4S01A 1QXZA 3BITA 4PV4A 1YVMA 1BOAA 2GTXA 3CB6A 4U1BA 4A6VA 4HXXA 4ZWOA 1C27A 3IU7A 2GG8A 2BWSA 2GZ5A 2GGBA 4U73A 3FMQA 2BWXA 3TB5A 1N51A 5CIKA 1JAWA 2V3ZA 5CE6A 2GG7A 4S2TP 2NQ6A
chains in the Genus database with same CATH topology
2BH3A 2BHDA 5CLSA 1MATA 2BWUA 2Q93A 2Q92A 3FM3A 1R5HA 2BHAA 2B3LA 5JHUA 4IKUA 2EA2A 2P9AA 3MX6A 4QR8A 4EGEA 1WL9A 4RZYA 4Z7MA 2ZSGA 3Q6DA 1XGOA 4U6CA 5CDLA 3IG4A 4U6EA 1PV9A 4S00A 5FCHA 4U75A 4FLJA 1WL6A 5D6FA 1A16A 4IF7A 4A6WA 1KP0A 2B3KA 4IECA 2V6CA 2G6PA 1W2MA 4U6JA 2BWWA 3PKBA 3PKAA 4IKTA 4OOKA 4B28A 3L7GA 1WKMA 1YJ3A 1Y1NA 2GG0A 5JI6A 4U71A 4RZZA 2B3HA 4ZWPA 1WLRA 5FCFA 2EVOA 3TAVA 1YW8A 2BN7A 4RGZ1 2BHCA 3D27A 3L24A 4KM3A 4IKSA 2EVMA 1XGMA 3BIQA 4JUQA 3BIPA 5CNXA 2Q8KA 4IKRA 1C24A 3PKEA 4FKCA 4MATA 1QXYA 3CB5A 2ADUA 3IU9A 4FUKA 1R5GA 3CTZA 4U6WA 4FLIA 1QXWA 2GU4A 2MATA 3PKCA 1KQ9A 4U69A 4FO8A 1WN1A 4U76A 4ZWUA 1C22A 2BWYA 2Q95A 3FMRA 4PNCA 5CDVA 3PKDA 1C23A 1WBQA 2GG2A 2V3XA 2HOWA 2GU7A 2GU5A 1CHMA 1QZYA 2GA2A 2GG3A 2GU6A 1KQ0A 1BN5A 1M35A 3IU8A 1C21A 4ZNGA 2IW2A 2Q94A 1YW9A 1XNZA 2EA4A 2V3YA 5D6EA 4IDYA 4IU6A 4U6ZA 3S6BA 4FO7A 5JFRA 2Q96A 3RVAA 2GG9A 4R60A 1XGNA 2BB7A 2GG5A 2BWVA 1W7VA 1WY2A 2BHBA 4S2RP 1O0XA 2NQ7A 2EVCA 2GGCA 2OAZA 3MATA 4FLKA 2OKNA 3MR1A 4IPAA 5CDEA 4FLLA 2BWTA 1YW7A 5E5BA 1B59A 4U70A 1R58A 2DFIA 1B6AA 1XGSA 2P99A 3RORA 2P98A 4S01A 1QXZA 3BITA 4PV4A 1YVMA 1BOAA 2GTXA 3CB6A 4U1BA 4A6VA 4HXXA 4ZWOA 1C27A 3IU7A 2GG8A 2BWSA 2GZ5A 2GGBA 4U73A 3FMQA 2BWXA 3TB5A 1N51A 5CIKA 1JAWA 2V3ZA 5CE6A 2GG7A 4S2TP 2NQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH3 A;  2BHD A;  5CLS A;  1MAT A;  2BWU A;  2Q93 A;  2Q92 A;  3FM3 A;  1R5H A;  2BHA A;  2B3L A;  5JHU A;  4IKU A;  2EA2 A;  2P9A A;  3MX6 A;  4QR8 A;  4EGE A;  1WL9 A;  4RZY A;  4Z7M A;  2ZSG A;  3Q6D A;  1XGO A;  4U6C A;  5CDL A;  3IG4 A;  4U6E A;  1PV9 A;  4S00 A;  5FCH A;  4U75 A;  4FLJ A;  1WL6 A;  5D6F A;  1A16 A;  4IF7 A;  4A6W A;  1KP0 A;  2B3K A;  4IEC A;  2V6C A;  2G6P A;  1W2M A;  4U6J A;  2BWW A;  3PKB A;  3PKA A;  4IKT A;  4OOK A;  4B28 A;  3L7G A;  1WKM A;  1YJ3 A;  1Y1N A;  2GG0 A;  5JI6 A;  4U71 A;  4RZZ A;  2B3H A;  4ZWP A;  1WLR A;  5FCF A;  2EVO A;  3TAV A;  1YW8 A;  2BN7 A;  4RGZ 1;  2BHC A;  3D27 A;  3L24 A;  4KM3 A;  4IKS A;  2EVM A;  1XGM A;  3BIQ A;  4JUQ A;  3BIP A;  5CNX A;  2Q8K A;  4IKR A;  1C24 A;  3PKE A;  4FKC A;  4MAT A;  1QXY A;  3CB5 A;  2ADU A;  3IU9 A;  4FUK A;  1R5G A;  3CTZ A;  4U6W A;  4FLI A;  1QXW A;  2GU4 A;  2MAT A;  3PKC A;  1KQ9 A;  4U69 A;  4FO8 A;  1WN1 A;  4U76 A;  4ZWU A;  1C22 A;  2BWY A;  2Q95 A;  3FMR A;  4PNC A;  5CDV A;  3PKD A;  1C23 A;  1WBQ A;  2GG2 A;  2V3X A;  2HOW A;  2GU7 A;  2GU5 A;  1CHM A;  1QZY A;  2GA2 A;  2GG3 A;  2GU6 A;  1KQ0 A;  1BN5 A;  1M35 A;  3IU8 A;  1C21 A;  4ZNG A;  2IW2 A;  2Q94 A;  1YW9 A;  1XNZ A;  2EA4 A;  2V3Y A;  5D6E A;  4IDY A;  4IU6 A;  4U6Z A;  3S6B A;  4FO7 A;  5JFR A;  2Q96 A;  3RVA A;  2GG9 A;  4R60 A;  1XGN A;  2BB7 A;  2GG5 A;  2BWV A;  1W7V A;  1WY2 A;  2BHB A;  4S2R P;  1O0X A;  2NQ7 A;  2EVC A;  2GGC A;  2OAZ A;  3MAT A;  4FLK A;  2OKN A;  3MR1 A;  4IPA A;  5CDE A;  4FLL A;  2BWT A;  1YW7 A;  5E5B A;  1B59 A;  4U70 A;  1R58 A;  2DFI A;  1B6A A;  1XGS A;  2P99 A;  3ROR A;  2P98 A;  4S01 A;  1QXZ A;  3BIT A;  4PV4 A;  1YVM A;  1BOA A;  2GTX A;  3CB6 A;  4U1B A;  4A6V A;  4HXX A;  4ZWO A;  1C27 A;  3IU7 A;  2GG8 A;  2BWS A;  2GZ5 A;  2GGB A;  4U73 A;  3FMQ A;  2BWX A;  3TB5 A;  1N51 A;  5CIK A;  1JAW A;  2V3Z A;  5CE6 A;  2GG7 A;  4S2T P;  2NQ6 A; 
#chains in the Genus database with same CATH topology
 2BH3 A;  2BHD A;  5CLS A;  1MAT A;  2BWU A;  2Q93 A;  2Q92 A;  3FM3 A;  1R5H A;  2BHA A;  2B3L A;  5JHU A;  4IKU A;  2EA2 A;  2P9A A;  3MX6 A;  4QR8 A;  4EGE A;  1WL9 A;  4RZY A;  4Z7M A;  2ZSG A;  3Q6D A;  1XGO A;  4U6C A;  5CDL A;  3IG4 A;  4U6E A;  1PV9 A;  4S00 A;  5FCH A;  4U75 A;  4FLJ A;  1WL6 A;  5D6F A;  1A16 A;  4IF7 A;  4A6W A;  1KP0 A;  2B3K A;  4IEC A;  2V6C A;  2G6P A;  1W2M A;  4U6J A;  2BWW A;  3PKB A;  3PKA A;  4IKT A;  4OOK A;  4B28 A;  3L7G A;  1WKM A;  1YJ3 A;  1Y1N A;  2GG0 A;  5JI6 A;  4U71 A;  4RZZ A;  2B3H A;  4ZWP A;  1WLR A;  5FCF A;  2EVO A;  3TAV A;  1YW8 A;  2BN7 A;  4RGZ 1;  2BHC A;  3D27 A;  3L24 A;  4KM3 A;  4IKS A;  2EVM A;  1XGM A;  3BIQ A;  4JUQ A;  3BIP A;  5CNX A;  2Q8K A;  4IKR A;  1C24 A;  3PKE A;  4FKC A;  4MAT A;  1QXY A;  3CB5 A;  2ADU A;  3IU9 A;  4FUK A;  1R5G A;  3CTZ A;  4U6W A;  4FLI A;  1QXW A;  2GU4 A;  2MAT A;  3PKC A;  1KQ9 A;  4U69 A;  4FO8 A;  1WN1 A;  4U76 A;  4ZWU A;  1C22 A;  2BWY A;  2Q95 A;  3FMR A;  4PNC A;  5CDV A;  3PKD A;  1C23 A;  1WBQ A;  2GG2 A;  2V3X A;  2HOW A;  2GU7 A;  2GU5 A;  1CHM A;  1QZY A;  2GA2 A;  2GG3 A;  2GU6 A;  1KQ0 A;  1BN5 A;  1M35 A;  3IU8 A;  1C21 A;  4ZNG A;  2IW2 A;  2Q94 A;  1YW9 A;  1XNZ A;  2EA4 A;  2V3Y A;  5D6E A;  4IDY A;  4IU6 A;  4U6Z A;  3S6B A;  4FO7 A;  5JFR A;  2Q96 A;  3RVA A;  2GG9 A;  4R60 A;  1XGN A;  2BB7 A;  2GG5 A;  2BWV A;  1W7V A;  1WY2 A;  2BHB A;  4S2R P;  1O0X A;  2NQ7 A;  2EVC A;  2GGC A;  2OAZ A;  3MAT A;  4FLK A;  2OKN A;  3MR1 A;  4IPA A;  5CDE A;  4FLL A;  2BWT A;  1YW7 A;  5E5B A;  1B59 A;  4U70 A;  1R58 A;  2DFI A;  1B6A A;  1XGS A;  2P99 A;  3ROR A;  2P98 A;  4S01 A;  1QXZ A;  3BIT A;  4PV4 A;  1YVM A;  1BOA A;  2GTX A;  3CB6 A;  4U1B A;  4A6V A;  4HXX A;  4ZWO A;  1C27 A;  3IU7 A;  2GG8 A;  2BWS A;  2GZ5 A;  2GGB A;  4U73 A;  3FMQ A;  2BWX A;  3TB5 A;  1N51 A;  5CIK A;  1JAW A;  2V3Z A;  5CE6 A;  2GG7 A;  4S2T P;  2NQ6 A; 
#chains in the Genus database with same CATH homology
 2BH3 A;  2BHD A;  5CLS A;  1MAT A;  2BWU A;  2Q93 A;  2Q92 A;  3FM3 A;  1R5H A;  2BHA A;  2B3L A;  5JHU A;  4IKU A;  2EA2 A;  2P9A A;  3MX6 A;  4QR8 A;  4EGE A;  1WL9 A;  4RZY A;  4Z7M A;  2ZSG A;  3Q6D A;  1XGO A;  4U6C A;  5CDL A;  3IG4 A;  4U6E A;  1PV9 A;  4S00 A;  5FCH A;  4U75 A;  4FLJ A;  1WL6 A;  5D6F A;  1A16 A;  4IF7 A;  4A6W A;  1KP0 A;  2B3K A;  4IEC A;  2V6C A;  2G6P A;  1W2M A;  4U6J A;  2BWW A;  3PKB A;  3PKA A;  4IKT A;  4OOK A;  4B28 A;  3L7G A;  1WKM A;  1YJ3 A;  1Y1N A;  2GG0 A;  5JI6 A;  4U71 A;  4RZZ A;  2B3H A;  4ZWP A;  1WLR A;  5FCF A;  2EVO A;  3TAV A;  1YW8 A;  2BN7 A;  4RGZ 1;  2BHC A;  3D27 A;  3L24 A;  4KM3 A;  4IKS A;  2EVM A;  1XGM A;  3BIQ A;  4JUQ A;  3BIP A;  5CNX A;  2Q8K A;  4IKR A;  1C24 A;  3PKE A;  4FKC A;  4MAT A;  1QXY A;  3CB5 A;  2ADU A;  3IU9 A;  4FUK A;  1R5G A;  3CTZ A;  4U6W A;  4FLI A;  1QXW A;  2GU4 A;  2MAT A;  3PKC A;  1KQ9 A;  4U69 A;  4FO8 A;  1WN1 A;  4U76 A;  4ZWU A;  1C22 A;  2BWY A;  2Q95 A;  3FMR A;  4PNC A;  5CDV A;  3PKD A;  1C23 A;  1WBQ A;  2GG2 A;  2V3X A;  2HOW A;  2GU7 A;  2GU5 A;  1CHM A;  1QZY A;  2GA2 A;  2GG3 A;  2GU6 A;  1KQ0 A;  1BN5 A;  1M35 A;  3IU8 A;  1C21 A;  4ZNG A;  2IW2 A;  2Q94 A;  1YW9 A;  1XNZ A;  2EA4 A;  2V3Y A;  5D6E A;  4IDY A;  4IU6 A;  4U6Z A;  3S6B A;  4FO7 A;  5JFR A;  2Q96 A;  3RVA A;  2GG9 A;  4R60 A;  1XGN A;  2BB7 A;  2GG5 A;  2BWV A;  1W7V A;  1WY2 A;  2BHB A;  4S2R P;  1O0X A;  2NQ7 A;  2EVC A;  2GGC A;  2OAZ A;  3MAT A;  4FLK A;  2OKN A;  3MR1 A;  4IPA A;  5CDE A;  4FLL A;  2BWT A;  1YW7 A;  5E5B A;  1B59 A;  4U70 A;  1R58 A;  2DFI A;  1B6A A;  1XGS A;  2P99 A;  3ROR A;  2P98 A;  4S01 A;  1QXZ A;  3BIT A;  4PV4 A;  1YVM A;  1BOA A;  2GTX A;  3CB6 A;  4U1B A;  4A6V A;  4HXX A;  4ZWO A;  1C27 A;  3IU7 A;  2GG8 A;  2BWS A;  2GZ5 A;  2GGB A;  4U73 A;  3FMQ A;  2BWX A;  3TB5 A;  1N51 A;  5CIK A;  1JAW A;  2V3Z A;  5CE6 A;  2GG7 A;  4S2T P;  2NQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...