2B3LA

Crystal structure of type i human methionine aminopeptidase in the apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
305
structure length
305
Chain Sequence
PYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 305
sequence length 305
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3lA00
2B3KA 4IPAA 2B3LA 4IU6A 1B59A 3CB6A 2HOWA 1CHMA 1O0XA 2EA2A 4U6JA 4IKTA 1B6AA 2B3HA 2V6CA 1C24A 4IF7A 2V3XA 1PV9A 2GG8A 3PKBA 2BB7A 5JHUA 2BHBA 1XGNA 3TB5A 1MATA 3FMRA 2GU7A 2GU5A 3RORA 2P98A 2ZSGA 4ZWOA 4U75A 4JUQA 1JAWA 4FO7A 3S6BA 1BN5A 4FLJA 5E5BA 1C23A 3FMQA 4S00A 4Z7MA 1Y1NA 2P99A 4IKRA 4PNCA 2GG3A 2V3YA 1YJ3A 4FLKA 1C22A 1YW7A 2IW2A 2OKNA 2ADUA 1WBQA 4OOKA 4KM3A 1XGSA 1QXYA 1XNZA 2Q94A 1R5HA 1YW9A 2GZ5A 4PV4A 5CNXA 1KQ9A 1WL6A 1WLRA 3PKDA 5CDVA 1QXZA 1WY2A 3PKAA 2GG7A 1BOAA 4HXXA 1R58A 4R60A 1QZYA 4U6ZA 4FO8A 2NQ6A 2Q8KA 3MX6A 1WN1A 2BHCA 2GU4A 2BWWA 2P9AA 1W2MA 1QXWA 2BWXA 2G6PA 3BIQA 4B28A 4FKCA 5JI6A 2GTXA 5CDLA 3Q6DA 3L7GA 4IECA 2V3ZA 4RGZ1 3CB5A 3PKCA 3IU9A 5D6FA 5FCHA 2BN7A 4U76A 2BHAA 1WL9A 2DFIA 2GGCA 2EVMA 2GGBA 1N51A 2BWVA 4S01A 2GG5A 4S2RP 2OAZA 2BWUA 2BH3A 1A16A 3IU8A 4FUKA 5CIKA 1M35A 3PKEA 4U6EA 2Q95A 4RZZA 4A6VA 3MR1A 1KP0A 2MATA 2GG9A 4U6WA 5D6EA 3IG4A 2GU6A 1YVMA 3RVAA 4S2TP 4EGEA 3IU7A 1C27A 2Q93A 2BWTA 2GG0A 1WKMA 4QR8A 4U70A 4ZWPA 2NQ7A 4U73A 3L24A 4FLLA 1XGOA 4IKSA 2BWYA 1W7VA 4U1BA 4FLIA 1XGMA 2GG2A 1KQ0A 3MATA 4ZNGA 2Q92A 1YW8A 5CDEA 4A6WA 2Q96A 4RZYA 3BIPA 4U6CA 3FM3A 2GA2A 2BWSA 5CE6A 5FCFA 2BHDA 3TAVA 2EVOA 4IDYA 5CLSA 1R5GA 5JFRA 4IKUA 4ZWUA 3D27A 3BITA 4U69A 2EA4A 4U71A 4MATA 2EVCA 1C21A 3CTZA
chains in the Genus database with same CATH superfamily
2B3KA 4IPAA 2B3LA 4IU6A 1B59A 3CB6A 2HOWA 1CHMA 1O0XA 2EA2A 4U6JA 4IKTA 1B6AA 2B3HA 2V6CA 1C24A 4IF7A 2V3XA 1PV9A 2GG8A 3PKBA 2BB7A 5JHUA 2BHBA 1XGNA 3TB5A 1MATA 3FMRA 2GU7A 2GU5A 3RORA 2P98A 2ZSGA 4ZWOA 4U75A 4JUQA 1JAWA 4FO7A 3S6BA 1BN5A 4FLJA 5E5BA 1C23A 3FMQA 4S00A 4Z7MA 1Y1NA 2P99A 4IKRA 4PNCA 2GG3A 2V3YA 1YJ3A 4FLKA 1C22A 1YW7A 2IW2A 2OKNA 2ADUA 1WBQA 4OOKA 4KM3A 1XGSA 1QXYA 1XNZA 2Q94A 1R5HA 1YW9A 2GZ5A 4PV4A 5CNXA 1KQ9A 1WL6A 1WLRA 3PKDA 5CDVA 1QXZA 1WY2A 3PKAA 2GG7A 1BOAA 4HXXA 1R58A 4R60A 1QZYA 4U6ZA 4FO8A 2NQ6A 2Q8KA 3MX6A 1WN1A 2BHCA 2GU4A 2BWWA 2P9AA 1W2MA 1QXWA 2BWXA 2G6PA 3BIQA 4B28A 4FKCA 5JI6A 2GTXA 5CDLA 3Q6DA 3L7GA 4IECA 2V3ZA 4RGZ1 3CB5A 3PKCA 3IU9A 5D6FA 5FCHA 2BN7A 4U76A 2BHAA 1WL9A 2DFIA 2GGCA 2EVMA 2GGBA 1N51A 2BWVA 4S01A 2GG5A 4S2RP 2OAZA 2BWUA 2BH3A 1A16A 3IU8A 4FUKA 5CIKA 1M35A 3PKEA 4U6EA 2Q95A 4RZZA 4A6VA 3MR1A 1KP0A 2MATA 2GG9A 4U6WA 5D6EA 3IG4A 2GU6A 1YVMA 3RVAA 4S2TP 4EGEA 3IU7A 1C27A 2Q93A 2BWTA 2GG0A 1WKMA 4QR8A 4U70A 4ZWPA 2NQ7A 4U73A 3L24A 4FLLA 1XGOA 4IKSA 2BWYA 1W7VA 4U1BA 4FLIA 1XGMA 2GG2A 1KQ0A 3MATA 4ZNGA 2Q92A 1YW8A 5CDEA 4A6WA 2Q96A 4RZYA 3BIPA 4U6CA 3FM3A 2GA2A 2BWSA 5CE6A 5FCFA 2BHDA 3TAVA 2EVOA 4IDYA 5CLSA 1R5GA 5JFRA 4IKUA 4ZWUA 3D27A 3BITA 4U69A 2EA4A 4U71A 4MATA 2EVCA 1C21A 3CTZA
chains in the Genus database with same CATH topology
2B3KA 4IPAA 2B3LA 4IU6A 1B59A 3CB6A 2HOWA 1CHMA 1O0XA 2EA2A 4U6JA 4IKTA 1B6AA 2B3HA 2V6CA 1C24A 4IF7A 2V3XA 1PV9A 2GG8A 3PKBA 2BB7A 5JHUA 2BHBA 1XGNA 3TB5A 1MATA 3FMRA 2GU7A 2GU5A 3RORA 2P98A 2ZSGA 4ZWOA 4U75A 4JUQA 1JAWA 4FO7A 3S6BA 1BN5A 4FLJA 5E5BA 1C23A 3FMQA 4S00A 4Z7MA 1Y1NA 2P99A 4IKRA 4PNCA 2GG3A 2V3YA 1YJ3A 4FLKA 1C22A 1YW7A 2IW2A 2OKNA 2ADUA 1WBQA 4OOKA 4KM3A 1XGSA 1QXYA 1XNZA 2Q94A 1R5HA 1YW9A 2GZ5A 4PV4A 5CNXA 1KQ9A 1WL6A 1WLRA 3PKDA 5CDVA 1QXZA 1WY2A 3PKAA 2GG7A 1BOAA 4HXXA 1R58A 4R60A 1QZYA 4U6ZA 4FO8A 2NQ6A 2Q8KA 3MX6A 1WN1A 2BHCA 2GU4A 2BWWA 2P9AA 1W2MA 1QXWA 2BWXA 2G6PA 3BIQA 4B28A 4FKCA 5JI6A 2GTXA 5CDLA 3Q6DA 3L7GA 4IECA 2V3ZA 4RGZ1 3CB5A 3PKCA 3IU9A 5D6FA 5FCHA 2BN7A 4U76A 2BHAA 1WL9A 2DFIA 2GGCA 2EVMA 2GGBA 1N51A 2BWVA 4S01A 2GG5A 4S2RP 2OAZA 2BWUA 2BH3A 1A16A 3IU8A 4FUKA 5CIKA 1M35A 3PKEA 4U6EA 2Q95A 4RZZA 4A6VA 3MR1A 1KP0A 2MATA 2GG9A 4U6WA 5D6EA 3IG4A 2GU6A 1YVMA 3RVAA 4S2TP 4EGEA 3IU7A 1C27A 2Q93A 2BWTA 2GG0A 1WKMA 4QR8A 4U70A 4ZWPA 2NQ7A 4U73A 3L24A 4FLLA 1XGOA 4IKSA 2BWYA 1W7VA 4U1BA 4FLIA 1XGMA 2GG2A 1KQ0A 3MATA 4ZNGA 2Q92A 1YW8A 5CDEA 4A6WA 2Q96A 4RZYA 3BIPA 4U6CA 3FM3A 2GA2A 2BWSA 5CE6A 5FCFA 2BHDA 3TAVA 2EVOA 4IDYA 5CLSA 1R5GA 5JFRA 4IKUA 4ZWUA 3D27A 3BITA 4U69A 2EA4A 4U71A 4MATA 2EVCA 1C21A 3CTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3K A;  4IPA A;  2B3L A;  4IU6 A;  1B59 A;  3CB6 A;  2HOW A;  1CHM A;  1O0X A;  2EA2 A;  4U6J A;  4IKT A;  1B6A A;  2B3H A;  2V6C A;  1C24 A;  4IF7 A;  2V3X A;  1PV9 A;  2GG8 A;  3PKB A;  2BB7 A;  5JHU A;  2BHB A;  1XGN A;  3TB5 A;  1MAT A;  3FMR A;  2GU7 A;  2GU5 A;  3ROR A;  2P98 A;  2ZSG A;  4ZWO A;  4U75 A;  4JUQ A;  1JAW A;  4FO7 A;  3S6B A;  1BN5 A;  4FLJ A;  5E5B A;  1C23 A;  3FMQ A;  4S00 A;  4Z7M A;  1Y1N A;  2P99 A;  4IKR A;  4PNC A;  2GG3 A;  2V3Y A;  1YJ3 A;  4FLK A;  1C22 A;  1YW7 A;  2IW2 A;  2OKN A;  2ADU A;  1WBQ A;  4OOK A;  4KM3 A;  1XGS A;  1QXY A;  1XNZ A;  2Q94 A;  1R5H A;  1YW9 A;  2GZ5 A;  4PV4 A;  5CNX A;  1KQ9 A;  1WL6 A;  1WLR A;  3PKD A;  5CDV A;  1QXZ A;  1WY2 A;  3PKA A;  2GG7 A;  1BOA A;  4HXX A;  1R58 A;  4R60 A;  1QZY A;  4U6Z A;  4FO8 A;  2NQ6 A;  2Q8K A;  3MX6 A;  1WN1 A;  2BHC A;  2GU4 A;  2BWW A;  2P9A A;  1W2M A;  1QXW A;  2BWX A;  2G6P A;  3BIQ A;  4B28 A;  4FKC A;  5JI6 A;  2GTX A;  5CDL A;  3Q6D A;  3L7G A;  4IEC A;  2V3Z A;  4RGZ 1;  3CB5 A;  3PKC A;  3IU9 A;  5D6F A;  5FCH A;  2BN7 A;  4U76 A;  2BHA A;  1WL9 A;  2DFI A;  2GGC A;  2EVM A;  2GGB A;  1N51 A;  2BWV A;  4S01 A;  2GG5 A;  4S2R P;  2OAZ A;  2BWU A;  2BH3 A;  1A16 A;  3IU8 A;  4FUK A;  5CIK A;  1M35 A;  3PKE A;  4U6E A;  2Q95 A;  4RZZ A;  4A6V A;  3MR1 A;  1KP0 A;  2MAT A;  2GG9 A;  4U6W A;  5D6E A;  3IG4 A;  2GU6 A;  1YVM A;  3RVA A;  4S2T P;  4EGE A;  3IU7 A;  1C27 A;  2Q93 A;  2BWT A;  2GG0 A;  1WKM A;  4QR8 A;  4U70 A;  4ZWP A;  2NQ7 A;  4U73 A;  3L24 A;  4FLL A;  1XGO A;  4IKS A;  2BWY A;  1W7V A;  4U1B A;  4FLI A;  1XGM A;  2GG2 A;  1KQ0 A;  3MAT A;  4ZNG A;  2Q92 A;  1YW8 A;  5CDE A;  4A6W A;  2Q96 A;  4RZY A;  3BIP A;  4U6C A;  3FM3 A;  2GA2 A;  2BWS A;  5CE6 A;  5FCF A;  2BHD A;  3TAV A;  2EVO A;  4IDY A;  5CLS A;  1R5G A;  5JFR A;  4IKU A;  4ZWU A;  3D27 A;  3BIT A;  4U69 A;  2EA4 A;  4U71 A;  4MAT A;  2EVC A;  1C21 A;  3CTZ A; 
#chains in the Genus database with same CATH topology
 2B3K A;  4IPA A;  2B3L A;  4IU6 A;  1B59 A;  3CB6 A;  2HOW A;  1CHM A;  1O0X A;  2EA2 A;  4U6J A;  4IKT A;  1B6A A;  2B3H A;  2V6C A;  1C24 A;  4IF7 A;  2V3X A;  1PV9 A;  2GG8 A;  3PKB A;  2BB7 A;  5JHU A;  2BHB A;  1XGN A;  3TB5 A;  1MAT A;  3FMR A;  2GU7 A;  2GU5 A;  3ROR A;  2P98 A;  2ZSG A;  4ZWO A;  4U75 A;  4JUQ A;  1JAW A;  4FO7 A;  3S6B A;  1BN5 A;  4FLJ A;  5E5B A;  1C23 A;  3FMQ A;  4S00 A;  4Z7M A;  1Y1N A;  2P99 A;  4IKR A;  4PNC A;  2GG3 A;  2V3Y A;  1YJ3 A;  4FLK A;  1C22 A;  1YW7 A;  2IW2 A;  2OKN A;  2ADU A;  1WBQ A;  4OOK A;  4KM3 A;  1XGS A;  1QXY A;  1XNZ A;  2Q94 A;  1R5H A;  1YW9 A;  2GZ5 A;  4PV4 A;  5CNX A;  1KQ9 A;  1WL6 A;  1WLR A;  3PKD A;  5CDV A;  1QXZ A;  1WY2 A;  3PKA A;  2GG7 A;  1BOA A;  4HXX A;  1R58 A;  4R60 A;  1QZY A;  4U6Z A;  4FO8 A;  2NQ6 A;  2Q8K A;  3MX6 A;  1WN1 A;  2BHC A;  2GU4 A;  2BWW A;  2P9A A;  1W2M A;  1QXW A;  2BWX A;  2G6P A;  3BIQ A;  4B28 A;  4FKC A;  5JI6 A;  2GTX A;  5CDL A;  3Q6D A;  3L7G A;  4IEC A;  2V3Z A;  4RGZ 1;  3CB5 A;  3PKC A;  3IU9 A;  5D6F A;  5FCH A;  2BN7 A;  4U76 A;  2BHA A;  1WL9 A;  2DFI A;  2GGC A;  2EVM A;  2GGB A;  1N51 A;  2BWV A;  4S01 A;  2GG5 A;  4S2R P;  2OAZ A;  2BWU A;  2BH3 A;  1A16 A;  3IU8 A;  4FUK A;  5CIK A;  1M35 A;  3PKE A;  4U6E A;  2Q95 A;  4RZZ A;  4A6V A;  3MR1 A;  1KP0 A;  2MAT A;  2GG9 A;  4U6W A;  5D6E A;  3IG4 A;  2GU6 A;  1YVM A;  3RVA A;  4S2T P;  4EGE A;  3IU7 A;  1C27 A;  2Q93 A;  2BWT A;  2GG0 A;  1WKM A;  4QR8 A;  4U70 A;  4ZWP A;  2NQ7 A;  4U73 A;  3L24 A;  4FLL A;  1XGO A;  4IKS A;  2BWY A;  1W7V A;  4U1B A;  4FLI A;  1XGM A;  2GG2 A;  1KQ0 A;  3MAT A;  4ZNG A;  2Q92 A;  1YW8 A;  5CDE A;  4A6W A;  2Q96 A;  4RZY A;  3BIP A;  4U6C A;  3FM3 A;  2GA2 A;  2BWS A;  5CE6 A;  5FCF A;  2BHD A;  3TAV A;  2EVO A;  4IDY A;  5CLS A;  1R5G A;  5JFR A;  4IKU A;  4ZWU A;  3D27 A;  3BIT A;  4U69 A;  2EA4 A;  4U71 A;  4MAT A;  2EVC A;  1C21 A;  3CTZ A; 
#chains in the Genus database with same CATH homology
 2B3K A;  4IPA A;  2B3L A;  4IU6 A;  1B59 A;  3CB6 A;  2HOW A;  1CHM A;  1O0X A;  2EA2 A;  4U6J A;  4IKT A;  1B6A A;  2B3H A;  2V6C A;  1C24 A;  4IF7 A;  2V3X A;  1PV9 A;  2GG8 A;  3PKB A;  2BB7 A;  5JHU A;  2BHB A;  1XGN A;  3TB5 A;  1MAT A;  3FMR A;  2GU7 A;  2GU5 A;  3ROR A;  2P98 A;  2ZSG A;  4ZWO A;  4U75 A;  4JUQ A;  1JAW A;  4FO7 A;  3S6B A;  1BN5 A;  4FLJ A;  5E5B A;  1C23 A;  3FMQ A;  4S00 A;  4Z7M A;  1Y1N A;  2P99 A;  4IKR A;  4PNC A;  2GG3 A;  2V3Y A;  1YJ3 A;  4FLK A;  1C22 A;  1YW7 A;  2IW2 A;  2OKN A;  2ADU A;  1WBQ A;  4OOK A;  4KM3 A;  1XGS A;  1QXY A;  1XNZ A;  2Q94 A;  1R5H A;  1YW9 A;  2GZ5 A;  4PV4 A;  5CNX A;  1KQ9 A;  1WL6 A;  1WLR A;  3PKD A;  5CDV A;  1QXZ A;  1WY2 A;  3PKA A;  2GG7 A;  1BOA A;  4HXX A;  1R58 A;  4R60 A;  1QZY A;  4U6Z A;  4FO8 A;  2NQ6 A;  2Q8K A;  3MX6 A;  1WN1 A;  2BHC A;  2GU4 A;  2BWW A;  2P9A A;  1W2M A;  1QXW A;  2BWX A;  2G6P A;  3BIQ A;  4B28 A;  4FKC A;  5JI6 A;  2GTX A;  5CDL A;  3Q6D A;  3L7G A;  4IEC A;  2V3Z A;  4RGZ 1;  3CB5 A;  3PKC A;  3IU9 A;  5D6F A;  5FCH A;  2BN7 A;  4U76 A;  2BHA A;  1WL9 A;  2DFI A;  2GGC A;  2EVM A;  2GGB A;  1N51 A;  2BWV A;  4S01 A;  2GG5 A;  4S2R P;  2OAZ A;  2BWU A;  2BH3 A;  1A16 A;  3IU8 A;  4FUK A;  5CIK A;  1M35 A;  3PKE A;  4U6E A;  2Q95 A;  4RZZ A;  4A6V A;  3MR1 A;  1KP0 A;  2MAT A;  2GG9 A;  4U6W A;  5D6E A;  3IG4 A;  2GU6 A;  1YVM A;  3RVA A;  4S2T P;  4EGE A;  3IU7 A;  1C27 A;  2Q93 A;  2BWT A;  2GG0 A;  1WKM A;  4QR8 A;  4U70 A;  4ZWP A;  2NQ7 A;  4U73 A;  3L24 A;  4FLL A;  1XGO A;  4IKS A;  2BWY A;  1W7V A;  4U1B A;  4FLI A;  1XGM A;  2GG2 A;  1KQ0 A;  3MAT A;  4ZNG A;  2Q92 A;  1YW8 A;  5CDE A;  4A6W A;  2Q96 A;  4RZY A;  3BIP A;  4U6C A;  3FM3 A;  2GA2 A;  2BWS A;  5CE6 A;  5FCF A;  2BHD A;  3TAV A;  2EVO A;  4IDY A;  5CLS A;  1R5G A;  5JFR A;  4IKU A;  4ZWU A;  3D27 A;  3BIT A;  4U69 A;  2EA4 A;  4U71 A;  4MAT A;  2EVC A;  1C21 A;  3CTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...