2B3LA

Crystal structure of type i human methionine aminopeptidase in the apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
305
structure length
305
Chain Sequence
PYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Functional Differences between Type I and Type II Human Methionine Aminopeptidases(,).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 98
structure length 305
sequence length 305
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2b3lA00
4MATA 2EVMA 5CE6A 3S6BA 4JUQA 2B3KA 2BWUA 1R5HA 5D6FA 1A16A 1QXZA 5CDLA 1BOAA 3PKEA 1MATA 1QXWA 4ZWPA 2GG2A 4FLJA 4HXXA 3BIQA 2GU5A 4OOKA 4RGZ1 4IDYA 1R5GA 2BN7A 3BIPA 2BHBA 4U73A 2BWSA 2BWYA 2GU4A 1YW8A 2V3ZA 1BN5A 4IKSA 5E5BA 2EA4A 2V3YA 1PV9A 1C22A 4IECA 4RZYA 3MX6A 4U6JA 4FLIA 3RORA 1B59A 4A6VA 1XGOA 1XNZA 2EVOA 2MATA 4IKRA 2P99A 2OKNA 4FLKA 1W7VA 4U76A 2GG8A 2GG5A 4U1BA 2GU7A 4U6ZA 4ZWUA 1C23A 2GGCA 4S00A 2Q95A 3CB6A 5CIKA 2GG9A 4FKCA 2BHDA 3BITA 3MR1A 1R58A 1XGMA 3MATA 2NQ7A 1WKMA 3IU8A 3PKDA 4IF7A 2OAZA 4U6WA 4IU6A 2DFIA 1XGNA 1WY2A 4FO7A 4KM3A 1WL6A 1W2MA 3PKBA 4U6EA 2GG3A 1B6AA 1KQ0A 2EVCA 4ZNGA 4FUKA 1QXYA 2BHAA 5FCFA 1WLRA 2Q94A 3IU7A 4S2RP 3TAVA 2GG7A 4RZZA 4B28A 5JFRA 2BHCA 1O0XA 2BWWA 1Y1NA 4PNCA 2Q92A 1M35A 1C21A 4U70A 1YW9A 5CLSA 2NQ6A 2BWTA 2G6PA 3TB5A 3FM3A 4FO8A 5FCHA 2BB7A 1YW7A 4IKUA 2B3HA 2BH3A 1N51A 4FLLA 4EGEA 4PV4A 4IKTA 1C24A 1QZYA 3FMRA 4ZWOA 3L7GA 4R60A 5D6EA 2EA2A 1KQ9A 2BWVA 1KP0A 4U6CA 2P9AA 2GU6A 4S01A 2HOWA 4A6WA 3D27A 2GZ5A 3IG4A 2GA2A 4IPAA 2Q8KA 5CDVA 2V3XA 2IW2A 2ZSGA 5JHUA 4U71A 1JAWA 4U75A 2Q96A 3FMQA 3PKCA 4S2TP 5CNXA 2GG0A 1WN1A 1YJ3A 2ADUA 1CHMA 3PKAA 2BWXA 5JI6A 2P98A 1WL9A 2GGBA 2V6CA 5CDEA 2Q93A 4QR8A 3CTZA 3L24A 3RVAA 1WBQA 3IU9A 4U69A 2GTXA 1YVMA 1XGSA 4Z7MA 3CB5A 2B3LA 1C27A 3Q6DA
chains in the Genus database with same CATH superfamily
4MATA 2EVMA 5CE6A 3S6BA 4JUQA 2B3KA 2BWUA 1R5HA 5D6FA 1A16A 1QXZA 5CDLA 1BOAA 3PKEA 1MATA 1QXWA 4ZWPA 2GG2A 4FLJA 4HXXA 3BIQA 2GU5A 4OOKA 4RGZ1 4IDYA 1R5GA 2BN7A 3BIPA 2BHBA 4U73A 2BWSA 2BWYA 2GU4A 1YW8A 2V3ZA 1BN5A 4IKSA 5E5BA 2EA4A 2V3YA 1PV9A 1C22A 4IECA 4RZYA 3MX6A 4U6JA 4FLIA 3RORA 1B59A 4A6VA 1XGOA 1XNZA 2EVOA 2MATA 4IKRA 2P99A 2OKNA 4FLKA 1W7VA 4U76A 2GG8A 2GG5A 4U1BA 2GU7A 4U6ZA 4ZWUA 1C23A 2GGCA 4S00A 2Q95A 3CB6A 5CIKA 2GG9A 4FKCA 2BHDA 3BITA 3MR1A 1R58A 1XGMA 3MATA 2NQ7A 1WKMA 3IU8A 3PKDA 4IF7A 2OAZA 4U6WA 4IU6A 2DFIA 1XGNA 1WY2A 4FO7A 4KM3A 1WL6A 1W2MA 3PKBA 4U6EA 2GG3A 1B6AA 1KQ0A 2EVCA 4ZNGA 4FUKA 1QXYA 2BHAA 5FCFA 1WLRA 2Q94A 3IU7A 4S2RP 3TAVA 2GG7A 4RZZA 4B28A 5JFRA 2BHCA 1O0XA 2BWWA 1Y1NA 4PNCA 2Q92A 1M35A 1C21A 4U70A 1YW9A 5CLSA 2NQ6A 2BWTA 2G6PA 3TB5A 3FM3A 4FO8A 5FCHA 2BB7A 1YW7A 4IKUA 2B3HA 2BH3A 1N51A 4FLLA 4EGEA 4PV4A 4IKTA 1C24A 1QZYA 3FMRA 4ZWOA 3L7GA 4R60A 5D6EA 2EA2A 1KQ9A 2BWVA 1KP0A 4U6CA 2P9AA 2GU6A 4S01A 2HOWA 4A6WA 3D27A 2GZ5A 3IG4A 2GA2A 4IPAA 2Q8KA 5CDVA 2V3XA 2IW2A 2ZSGA 5JHUA 4U71A 1JAWA 4U75A 2Q96A 3FMQA 3PKCA 4S2TP 5CNXA 2GG0A 1WN1A 1YJ3A 2ADUA 1CHMA 3PKAA 2BWXA 5JI6A 2P98A 1WL9A 2GGBA 2V6CA 5CDEA 2Q93A 4QR8A 3CTZA 3L24A 3RVAA 1WBQA 3IU9A 4U69A 2GTXA 1YVMA 1XGSA 4Z7MA 3CB5A 2B3LA 1C27A 3Q6DA
chains in the Genus database with same CATH topology
4MATA 2EVMA 5CE6A 3S6BA 4JUQA 2B3KA 2BWUA 1R5HA 5D6FA 1A16A 1QXZA 5CDLA 1BOAA 3PKEA 1MATA 1QXWA 4ZWPA 2GG2A 4FLJA 4HXXA 3BIQA 2GU5A 4OOKA 4RGZ1 4IDYA 1R5GA 2BN7A 3BIPA 2BHBA 4U73A 2BWSA 2BWYA 2GU4A 1YW8A 2V3ZA 1BN5A 4IKSA 5E5BA 2EA4A 2V3YA 1PV9A 1C22A 4IECA 4RZYA 3MX6A 4U6JA 4FLIA 3RORA 1B59A 4A6VA 1XGOA 1XNZA 2EVOA 2MATA 4IKRA 2P99A 2OKNA 4FLKA 1W7VA 4U76A 2GG8A 2GG5A 4U1BA 2GU7A 4U6ZA 4ZWUA 1C23A 2GGCA 4S00A 2Q95A 3CB6A 5CIKA 2GG9A 4FKCA 2BHDA 3BITA 3MR1A 1R58A 1XGMA 3MATA 2NQ7A 1WKMA 3IU8A 3PKDA 4IF7A 2OAZA 4U6WA 4IU6A 2DFIA 1XGNA 1WY2A 4FO7A 4KM3A 1WL6A 1W2MA 3PKBA 4U6EA 2GG3A 1B6AA 1KQ0A 2EVCA 4ZNGA 4FUKA 1QXYA 2BHAA 5FCFA 1WLRA 2Q94A 3IU7A 4S2RP 3TAVA 2GG7A 4RZZA 4B28A 5JFRA 2BHCA 1O0XA 2BWWA 1Y1NA 4PNCA 2Q92A 1M35A 1C21A 4U70A 1YW9A 5CLSA 2NQ6A 2BWTA 2G6PA 3TB5A 3FM3A 4FO8A 5FCHA 2BB7A 1YW7A 4IKUA 2B3HA 2BH3A 1N51A 4FLLA 4EGEA 4PV4A 4IKTA 1C24A 1QZYA 3FMRA 4ZWOA 3L7GA 4R60A 5D6EA 2EA2A 1KQ9A 2BWVA 1KP0A 4U6CA 2P9AA 2GU6A 4S01A 2HOWA 4A6WA 3D27A 2GZ5A 3IG4A 2GA2A 4IPAA 2Q8KA 5CDVA 2V3XA 2IW2A 2ZSGA 5JHUA 4U71A 1JAWA 4U75A 2Q96A 3FMQA 3PKCA 4S2TP 5CNXA 2GG0A 1WN1A 1YJ3A 2ADUA 1CHMA 3PKAA 2BWXA 5JI6A 2P98A 1WL9A 2GGBA 2V6CA 5CDEA 2Q93A 4QR8A 3CTZA 3L24A 3RVAA 1WBQA 3IU9A 4U69A 2GTXA 1YVMA 1XGSA 4Z7MA 3CB5A 2B3LA 1C27A 3Q6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAT A;  2EVM A;  5CE6 A;  3S6B A;  4JUQ A;  2B3K A;  2BWU A;  1R5H A;  5D6F A;  1A16 A;  1QXZ A;  5CDL A;  1BOA A;  3PKE A;  1MAT A;  1QXW A;  4ZWP A;  2GG2 A;  4FLJ A;  4HXX A;  3BIQ A;  2GU5 A;  4OOK A;  4RGZ 1;  4IDY A;  1R5G A;  2BN7 A;  3BIP A;  2BHB A;  4U73 A;  2BWS A;  2BWY A;  2GU4 A;  1YW8 A;  2V3Z A;  1BN5 A;  4IKS A;  5E5B A;  2EA4 A;  2V3Y A;  1PV9 A;  1C22 A;  4IEC A;  4RZY A;  3MX6 A;  4U6J A;  4FLI A;  3ROR A;  1B59 A;  4A6V A;  1XGO A;  1XNZ A;  2EVO A;  2MAT A;  4IKR A;  2P99 A;  2OKN A;  4FLK A;  1W7V A;  4U76 A;  2GG8 A;  2GG5 A;  4U1B A;  2GU7 A;  4U6Z A;  4ZWU A;  1C23 A;  2GGC A;  4S00 A;  2Q95 A;  3CB6 A;  5CIK A;  2GG9 A;  4FKC A;  2BHD A;  3BIT A;  3MR1 A;  1R58 A;  1XGM A;  3MAT A;  2NQ7 A;  1WKM A;  3IU8 A;  3PKD A;  4IF7 A;  2OAZ A;  4U6W A;  4IU6 A;  2DFI A;  1XGN A;  1WY2 A;  4FO7 A;  4KM3 A;  1WL6 A;  1W2M A;  3PKB A;  4U6E A;  2GG3 A;  1B6A A;  1KQ0 A;  2EVC A;  4ZNG A;  4FUK A;  1QXY A;  2BHA A;  5FCF A;  1WLR A;  2Q94 A;  3IU7 A;  4S2R P;  3TAV A;  2GG7 A;  4RZZ A;  4B28 A;  5JFR A;  2BHC A;  1O0X A;  2BWW A;  1Y1N A;  4PNC A;  2Q92 A;  1M35 A;  1C21 A;  4U70 A;  1YW9 A;  5CLS A;  2NQ6 A;  2BWT A;  2G6P A;  3TB5 A;  3FM3 A;  4FO8 A;  5FCH A;  2BB7 A;  1YW7 A;  4IKU A;  2B3H A;  2BH3 A;  1N51 A;  4FLL A;  4EGE A;  4PV4 A;  4IKT A;  1C24 A;  1QZY A;  3FMR A;  4ZWO A;  3L7G A;  4R60 A;  5D6E A;  2EA2 A;  1KQ9 A;  2BWV A;  1KP0 A;  4U6C A;  2P9A A;  2GU6 A;  4S01 A;  2HOW A;  4A6W A;  3D27 A;  2GZ5 A;  3IG4 A;  2GA2 A;  4IPA A;  2Q8K A;  5CDV A;  2V3X A;  2IW2 A;  2ZSG A;  5JHU A;  4U71 A;  1JAW A;  4U75 A;  2Q96 A;  3FMQ A;  3PKC A;  4S2T P;  5CNX A;  2GG0 A;  1WN1 A;  1YJ3 A;  2ADU A;  1CHM A;  3PKA A;  2BWX A;  5JI6 A;  2P98 A;  1WL9 A;  2GGB A;  2V6C A;  5CDE A;  2Q93 A;  4QR8 A;  3CTZ A;  3L24 A;  3RVA A;  1WBQ A;  3IU9 A;  4U69 A;  2GTX A;  1YVM A;  1XGS A;  4Z7M A;  3CB5 A;  2B3L A;  1C27 A;  3Q6D A; 
#chains in the Genus database with same CATH topology
 4MAT A;  2EVM A;  5CE6 A;  3S6B A;  4JUQ A;  2B3K A;  2BWU A;  1R5H A;  5D6F A;  1A16 A;  1QXZ A;  5CDL A;  1BOA A;  3PKE A;  1MAT A;  1QXW A;  4ZWP A;  2GG2 A;  4FLJ A;  4HXX A;  3BIQ A;  2GU5 A;  4OOK A;  4RGZ 1;  4IDY A;  1R5G A;  2BN7 A;  3BIP A;  2BHB A;  4U73 A;  2BWS A;  2BWY A;  2GU4 A;  1YW8 A;  2V3Z A;  1BN5 A;  4IKS A;  5E5B A;  2EA4 A;  2V3Y A;  1PV9 A;  1C22 A;  4IEC A;  4RZY A;  3MX6 A;  4U6J A;  4FLI A;  3ROR A;  1B59 A;  4A6V A;  1XGO A;  1XNZ A;  2EVO A;  2MAT A;  4IKR A;  2P99 A;  2OKN A;  4FLK A;  1W7V A;  4U76 A;  2GG8 A;  2GG5 A;  4U1B A;  2GU7 A;  4U6Z A;  4ZWU A;  1C23 A;  2GGC A;  4S00 A;  2Q95 A;  3CB6 A;  5CIK A;  2GG9 A;  4FKC A;  2BHD A;  3BIT A;  3MR1 A;  1R58 A;  1XGM A;  3MAT A;  2NQ7 A;  1WKM A;  3IU8 A;  3PKD A;  4IF7 A;  2OAZ A;  4U6W A;  4IU6 A;  2DFI A;  1XGN A;  1WY2 A;  4FO7 A;  4KM3 A;  1WL6 A;  1W2M A;  3PKB A;  4U6E A;  2GG3 A;  1B6A A;  1KQ0 A;  2EVC A;  4ZNG A;  4FUK A;  1QXY A;  2BHA A;  5FCF A;  1WLR A;  2Q94 A;  3IU7 A;  4S2R P;  3TAV A;  2GG7 A;  4RZZ A;  4B28 A;  5JFR A;  2BHC A;  1O0X A;  2BWW A;  1Y1N A;  4PNC A;  2Q92 A;  1M35 A;  1C21 A;  4U70 A;  1YW9 A;  5CLS A;  2NQ6 A;  2BWT A;  2G6P A;  3TB5 A;  3FM3 A;  4FO8 A;  5FCH A;  2BB7 A;  1YW7 A;  4IKU A;  2B3H A;  2BH3 A;  1N51 A;  4FLL A;  4EGE A;  4PV4 A;  4IKT A;  1C24 A;  1QZY A;  3FMR A;  4ZWO A;  3L7G A;  4R60 A;  5D6E A;  2EA2 A;  1KQ9 A;  2BWV A;  1KP0 A;  4U6C A;  2P9A A;  2GU6 A;  4S01 A;  2HOW A;  4A6W A;  3D27 A;  2GZ5 A;  3IG4 A;  2GA2 A;  4IPA A;  2Q8K A;  5CDV A;  2V3X A;  2IW2 A;  2ZSG A;  5JHU A;  4U71 A;  1JAW A;  4U75 A;  2Q96 A;  3FMQ A;  3PKC A;  4S2T P;  5CNX A;  2GG0 A;  1WN1 A;  1YJ3 A;  2ADU A;  1CHM A;  3PKA A;  2BWX A;  5JI6 A;  2P98 A;  1WL9 A;  2GGB A;  2V6C A;  5CDE A;  2Q93 A;  4QR8 A;  3CTZ A;  3L24 A;  3RVA A;  1WBQ A;  3IU9 A;  4U69 A;  2GTX A;  1YVM A;  1XGS A;  4Z7M A;  3CB5 A;  2B3L A;  1C27 A;  3Q6D A; 
#chains in the Genus database with same CATH homology
 4MAT A;  2EVM A;  5CE6 A;  3S6B A;  4JUQ A;  2B3K A;  2BWU A;  1R5H A;  5D6F A;  1A16 A;  1QXZ A;  5CDL A;  1BOA A;  3PKE A;  1MAT A;  1QXW A;  4ZWP A;  2GG2 A;  4FLJ A;  4HXX A;  3BIQ A;  2GU5 A;  4OOK A;  4RGZ 1;  4IDY A;  1R5G A;  2BN7 A;  3BIP A;  2BHB A;  4U73 A;  2BWS A;  2BWY A;  2GU4 A;  1YW8 A;  2V3Z A;  1BN5 A;  4IKS A;  5E5B A;  2EA4 A;  2V3Y A;  1PV9 A;  1C22 A;  4IEC A;  4RZY A;  3MX6 A;  4U6J A;  4FLI A;  3ROR A;  1B59 A;  4A6V A;  1XGO A;  1XNZ A;  2EVO A;  2MAT A;  4IKR A;  2P99 A;  2OKN A;  4FLK A;  1W7V A;  4U76 A;  2GG8 A;  2GG5 A;  4U1B A;  2GU7 A;  4U6Z A;  4ZWU A;  1C23 A;  2GGC A;  4S00 A;  2Q95 A;  3CB6 A;  5CIK A;  2GG9 A;  4FKC A;  2BHD A;  3BIT A;  3MR1 A;  1R58 A;  1XGM A;  3MAT A;  2NQ7 A;  1WKM A;  3IU8 A;  3PKD A;  4IF7 A;  2OAZ A;  4U6W A;  4IU6 A;  2DFI A;  1XGN A;  1WY2 A;  4FO7 A;  4KM3 A;  1WL6 A;  1W2M A;  3PKB A;  4U6E A;  2GG3 A;  1B6A A;  1KQ0 A;  2EVC A;  4ZNG A;  4FUK A;  1QXY A;  2BHA A;  5FCF A;  1WLR A;  2Q94 A;  3IU7 A;  4S2R P;  3TAV A;  2GG7 A;  4RZZ A;  4B28 A;  5JFR A;  2BHC A;  1O0X A;  2BWW A;  1Y1N A;  4PNC A;  2Q92 A;  1M35 A;  1C21 A;  4U70 A;  1YW9 A;  5CLS A;  2NQ6 A;  2BWT A;  2G6P A;  3TB5 A;  3FM3 A;  4FO8 A;  5FCH A;  2BB7 A;  1YW7 A;  4IKU A;  2B3H A;  2BH3 A;  1N51 A;  4FLL A;  4EGE A;  4PV4 A;  4IKT A;  1C24 A;  1QZY A;  3FMR A;  4ZWO A;  3L7G A;  4R60 A;  5D6E A;  2EA2 A;  1KQ9 A;  2BWV A;  1KP0 A;  4U6C A;  2P9A A;  2GU6 A;  4S01 A;  2HOW A;  4A6W A;  3D27 A;  2GZ5 A;  3IG4 A;  2GA2 A;  4IPA A;  2Q8K A;  5CDV A;  2V3X A;  2IW2 A;  2ZSG A;  5JHU A;  4U71 A;  1JAW A;  4U75 A;  2Q96 A;  3FMQ A;  3PKC A;  4S2T P;  5CNX A;  2GG0 A;  1WN1 A;  1YJ3 A;  2ADU A;  1CHM A;  3PKA A;  2BWX A;  5JI6 A;  2P98 A;  1WL9 A;  2GGB A;  2V6C A;  5CDE A;  2Q93 A;  4QR8 A;  3CTZ A;  3L24 A;  3RVA A;  1WBQ A;  3IU9 A;  4U69 A;  2GTX A;  1YVM A;  1XGS A;  4Z7M A;  3CB5 A;  2B3L A;  1C27 A;  3Q6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...