4IKUA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with 2-((5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)amino)-3-phenylpropanamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4ikuA00
1MATA 5CIKA 5CE6A 1YW9A 2GU4A 2ADUA 2GTXA 3CB6A 3PKBA 4JUQA 4QR8A 1BOAA 1R5GA 4U6CA 2B3KA 4IECA 3FMRA 1WBQA 3PKDA 2DFIA 2V3XA 1WL6A 4S2RP 4U71A 1C21A 1A16A 2Q93A 2ZSGA 4ZWOA 4FO8A 1W2MA 2EA2A 2BHAA 1WY2A 4B28A 5CDVA 1YJ3A 4U69A 4U76A 5D6EA 2Q8KA 3PKCA 3FMQA 2BWSA 1XGNA 4U6EA 4U6ZA 2BHCA 2BWUA 3MATA 3FM3A 1W7VA 1R5HA 2GG8A 4RZZA 1YW8A 1KP0A 1BN5A 2BWWA 3IG4A 1WKMA 2EVOA 3IU7A 4ZNGA 5FCHA 3BIQA 1JAWA 2B3HA 2V3ZA 4FLLA 3CTZA 1KQ0A 3BIPA 4S00A 4FLKA 2P9AA 2BHDA 4U1BA 3TB5A 2BWTA 1M35A 2NQ6A 3CB5A 1YW7A 3IU8A 4U6WA 3IU9A 2P99A 4ZWPA 4EGEA 1C23A 1XGMA 5CDLA 2BWXA 4FLIA 4IKUA 4U70A 1CHMA 1QZYA 2BN7A 2BH3A 2IW2A 3MX6A 4FUKA 5D6FA 5E5BA 1KQ9A 4PV4A 2NQ7A 4U6JA 5CDEA 2GU6A 2Q95A 4IPAA 4A6WA 4MATA 2V3YA 2G6PA 3Q6DA 4IKRA 2B3LA 4KM3A 4U73A 1Y1NA 2OAZA 2GG5A 2HOWA 2GG7A 3RVAA 1XGOA 4RGZ1 4S2TP 2GG9A 1C24A 1YVMA 4R60A 2GZ5A 2GA2A 4OOKA 3PKEA 4PNCA 4IU6A 4Z7MA 4HXXA 2MATA 4RZYA 2OKNA 3L24A 4A6VA 1N51A 2GG3A 3MR1A 5JI6A 2BHBA 2GGBA 2Q92A 2GGCA 5JFRA 1WLRA 2GG0A 4IDYA 4IF7A 2GG2A 4IKTA 2EVMA 2P98A 1PV9A 3S6BA 1QXZA 3D27A 4S01A 2Q96A 4FKCA 5JHUA 3RORA 2EA4A 4IKSA 4U75A 5CLSA 3TAVA 5CNXA 3PKAA 3L7GA 1XGSA 4ZWUA 1B6AA 2BB7A 1O0XA 1B59A 4FLJA 3BITA 2BWVA 2Q94A 4FO7A 2GU7A 1R58A 1C27A 1WL9A 1QXYA 1C22A 1XNZA 1WN1A 2BWYA 2GU5A 5FCFA 1QXWA 2EVCA 2V6CA
chains in the Genus database with same CATH superfamily
1MATA 5CIKA 5CE6A 1YW9A 2GU4A 2ADUA 2GTXA 3CB6A 3PKBA 4JUQA 4QR8A 1BOAA 1R5GA 4U6CA 2B3KA 4IECA 3FMRA 1WBQA 3PKDA 2DFIA 2V3XA 1WL6A 4S2RP 4U71A 1C21A 1A16A 2Q93A 2ZSGA 4ZWOA 4FO8A 1W2MA 2EA2A 2BHAA 1WY2A 4B28A 5CDVA 1YJ3A 4U69A 4U76A 5D6EA 2Q8KA 3PKCA 3FMQA 2BWSA 1XGNA 4U6EA 4U6ZA 2BHCA 2BWUA 3MATA 3FM3A 1W7VA 1R5HA 2GG8A 4RZZA 1YW8A 1KP0A 1BN5A 2BWWA 3IG4A 1WKMA 2EVOA 3IU7A 4ZNGA 5FCHA 3BIQA 1JAWA 2B3HA 2V3ZA 4FLLA 3CTZA 1KQ0A 3BIPA 4S00A 4FLKA 2P9AA 2BHDA 4U1BA 3TB5A 2BWTA 1M35A 2NQ6A 3CB5A 1YW7A 3IU8A 4U6WA 3IU9A 2P99A 4ZWPA 4EGEA 1C23A 1XGMA 5CDLA 2BWXA 4FLIA 4IKUA 4U70A 1CHMA 1QZYA 2BN7A 2BH3A 2IW2A 3MX6A 4FUKA 5D6FA 5E5BA 1KQ9A 4PV4A 2NQ7A 4U6JA 5CDEA 2GU6A 2Q95A 4IPAA 4A6WA 4MATA 2V3YA 2G6PA 3Q6DA 4IKRA 2B3LA 4KM3A 4U73A 1Y1NA 2OAZA 2GG5A 2HOWA 2GG7A 3RVAA 1XGOA 4RGZ1 4S2TP 2GG9A 1C24A 1YVMA 4R60A 2GZ5A 2GA2A 4OOKA 3PKEA 4PNCA 4IU6A 4Z7MA 4HXXA 2MATA 4RZYA 2OKNA 3L24A 4A6VA 1N51A 2GG3A 3MR1A 5JI6A 2BHBA 2GGBA 2Q92A 2GGCA 5JFRA 1WLRA 2GG0A 4IDYA 4IF7A 2GG2A 4IKTA 2EVMA 2P98A 1PV9A 3S6BA 1QXZA 3D27A 4S01A 2Q96A 4FKCA 5JHUA 3RORA 2EA4A 4IKSA 4U75A 5CLSA 3TAVA 5CNXA 3PKAA 3L7GA 1XGSA 4ZWUA 1B6AA 2BB7A 1O0XA 1B59A 4FLJA 3BITA 2BWVA 2Q94A 4FO7A 2GU7A 1R58A 1C27A 1WL9A 1QXYA 1C22A 1XNZA 1WN1A 2BWYA 2GU5A 5FCFA 1QXWA 2EVCA 2V6CA
chains in the Genus database with same CATH topology
1MATA 5CIKA 5CE6A 1YW9A 2GU4A 2ADUA 2GTXA 3CB6A 3PKBA 4JUQA 4QR8A 1BOAA 1R5GA 4U6CA 2B3KA 4IECA 3FMRA 1WBQA 3PKDA 2DFIA 2V3XA 1WL6A 4S2RP 4U71A 1C21A 1A16A 2Q93A 2ZSGA 4ZWOA 4FO8A 1W2MA 2EA2A 2BHAA 1WY2A 4B28A 5CDVA 1YJ3A 4U69A 4U76A 5D6EA 2Q8KA 3PKCA 3FMQA 2BWSA 1XGNA 4U6EA 4U6ZA 2BHCA 2BWUA 3MATA 3FM3A 1W7VA 1R5HA 2GG8A 4RZZA 1YW8A 1KP0A 1BN5A 2BWWA 3IG4A 1WKMA 2EVOA 3IU7A 4ZNGA 5FCHA 3BIQA 1JAWA 2B3HA 2V3ZA 4FLLA 3CTZA 1KQ0A 3BIPA 4S00A 4FLKA 2P9AA 2BHDA 4U1BA 3TB5A 2BWTA 1M35A 2NQ6A 3CB5A 1YW7A 3IU8A 4U6WA 3IU9A 2P99A 4ZWPA 4EGEA 1C23A 1XGMA 5CDLA 2BWXA 4FLIA 4IKUA 4U70A 1CHMA 1QZYA 2BN7A 2BH3A 2IW2A 3MX6A 4FUKA 5D6FA 5E5BA 1KQ9A 4PV4A 2NQ7A 4U6JA 5CDEA 2GU6A 2Q95A 4IPAA 4A6WA 4MATA 2V3YA 2G6PA 3Q6DA 4IKRA 2B3LA 4KM3A 4U73A 1Y1NA 2OAZA 2GG5A 2HOWA 2GG7A 3RVAA 1XGOA 4RGZ1 4S2TP 2GG9A 1C24A 1YVMA 4R60A 2GZ5A 2GA2A 4OOKA 3PKEA 4PNCA 4IU6A 4Z7MA 4HXXA 2MATA 4RZYA 2OKNA 3L24A 4A6VA 1N51A 2GG3A 3MR1A 5JI6A 2BHBA 2GGBA 2Q92A 2GGCA 5JFRA 1WLRA 2GG0A 4IDYA 4IF7A 2GG2A 4IKTA 2EVMA 2P98A 1PV9A 3S6BA 1QXZA 3D27A 4S01A 2Q96A 4FKCA 5JHUA 3RORA 2EA4A 4IKSA 4U75A 5CLSA 3TAVA 5CNXA 3PKAA 3L7GA 1XGSA 4ZWUA 1B6AA 2BB7A 1O0XA 1B59A 4FLJA 3BITA 2BWVA 2Q94A 4FO7A 2GU7A 1R58A 1C27A 1WL9A 1QXYA 1C22A 1XNZA 1WN1A 2BWYA 2GU5A 5FCFA 1QXWA 2EVCA 2V6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAT A;  5CIK A;  5CE6 A;  1YW9 A;  2GU4 A;  2ADU A;  2GTX A;  3CB6 A;  3PKB A;  4JUQ A;  4QR8 A;  1BOA A;  1R5G A;  4U6C A;  2B3K A;  4IEC A;  3FMR A;  1WBQ A;  3PKD A;  2DFI A;  2V3X A;  1WL6 A;  4S2R P;  4U71 A;  1C21 A;  1A16 A;  2Q93 A;  2ZSG A;  4ZWO A;  4FO8 A;  1W2M A;  2EA2 A;  2BHA A;  1WY2 A;  4B28 A;  5CDV A;  1YJ3 A;  4U69 A;  4U76 A;  5D6E A;  2Q8K A;  3PKC A;  3FMQ A;  2BWS A;  1XGN A;  4U6E A;  4U6Z A;  2BHC A;  2BWU A;  3MAT A;  3FM3 A;  1W7V A;  1R5H A;  2GG8 A;  4RZZ A;  1YW8 A;  1KP0 A;  1BN5 A;  2BWW A;  3IG4 A;  1WKM A;  2EVO A;  3IU7 A;  4ZNG A;  5FCH A;  3BIQ A;  1JAW A;  2B3H A;  2V3Z A;  4FLL A;  3CTZ A;  1KQ0 A;  3BIP A;  4S00 A;  4FLK A;  2P9A A;  2BHD A;  4U1B A;  3TB5 A;  2BWT A;  1M35 A;  2NQ6 A;  3CB5 A;  1YW7 A;  3IU8 A;  4U6W A;  3IU9 A;  2P99 A;  4ZWP A;  4EGE A;  1C23 A;  1XGM A;  5CDL A;  2BWX A;  4FLI A;  4IKU A;  4U70 A;  1CHM A;  1QZY A;  2BN7 A;  2BH3 A;  2IW2 A;  3MX6 A;  4FUK A;  5D6F A;  5E5B A;  1KQ9 A;  4PV4 A;  2NQ7 A;  4U6J A;  5CDE A;  2GU6 A;  2Q95 A;  4IPA A;  4A6W A;  4MAT A;  2V3Y A;  2G6P A;  3Q6D A;  4IKR A;  2B3L A;  4KM3 A;  4U73 A;  1Y1N A;  2OAZ A;  2GG5 A;  2HOW A;  2GG7 A;  3RVA A;  1XGO A;  4RGZ 1;  4S2T P;  2GG9 A;  1C24 A;  1YVM A;  4R60 A;  2GZ5 A;  2GA2 A;  4OOK A;  3PKE A;  4PNC A;  4IU6 A;  4Z7M A;  4HXX A;  2MAT A;  4RZY A;  2OKN A;  3L24 A;  4A6V A;  1N51 A;  2GG3 A;  3MR1 A;  5JI6 A;  2BHB A;  2GGB A;  2Q92 A;  2GGC A;  5JFR A;  1WLR A;  2GG0 A;  4IDY A;  4IF7 A;  2GG2 A;  4IKT A;  2EVM A;  2P98 A;  1PV9 A;  3S6B A;  1QXZ A;  3D27 A;  4S01 A;  2Q96 A;  4FKC A;  5JHU A;  3ROR A;  2EA4 A;  4IKS A;  4U75 A;  5CLS A;  3TAV A;  5CNX A;  3PKA A;  3L7G A;  1XGS A;  4ZWU A;  1B6A A;  2BB7 A;  1O0X A;  1B59 A;  4FLJ A;  3BIT A;  2BWV A;  2Q94 A;  4FO7 A;  2GU7 A;  1R58 A;  1C27 A;  1WL9 A;  1QXY A;  1C22 A;  1XNZ A;  1WN1 A;  2BWY A;  2GU5 A;  5FCF A;  1QXW A;  2EVC A;  2V6C A; 
#chains in the Genus database with same CATH topology
 1MAT A;  5CIK A;  5CE6 A;  1YW9 A;  2GU4 A;  2ADU A;  2GTX A;  3CB6 A;  3PKB A;  4JUQ A;  4QR8 A;  1BOA A;  1R5G A;  4U6C A;  2B3K A;  4IEC A;  3FMR A;  1WBQ A;  3PKD A;  2DFI A;  2V3X A;  1WL6 A;  4S2R P;  4U71 A;  1C21 A;  1A16 A;  2Q93 A;  2ZSG A;  4ZWO A;  4FO8 A;  1W2M A;  2EA2 A;  2BHA A;  1WY2 A;  4B28 A;  5CDV A;  1YJ3 A;  4U69 A;  4U76 A;  5D6E A;  2Q8K A;  3PKC A;  3FMQ A;  2BWS A;  1XGN A;  4U6E A;  4U6Z A;  2BHC A;  2BWU A;  3MAT A;  3FM3 A;  1W7V A;  1R5H A;  2GG8 A;  4RZZ A;  1YW8 A;  1KP0 A;  1BN5 A;  2BWW A;  3IG4 A;  1WKM A;  2EVO A;  3IU7 A;  4ZNG A;  5FCH A;  3BIQ A;  1JAW A;  2B3H A;  2V3Z A;  4FLL A;  3CTZ A;  1KQ0 A;  3BIP A;  4S00 A;  4FLK A;  2P9A A;  2BHD A;  4U1B A;  3TB5 A;  2BWT A;  1M35 A;  2NQ6 A;  3CB5 A;  1YW7 A;  3IU8 A;  4U6W A;  3IU9 A;  2P99 A;  4ZWP A;  4EGE A;  1C23 A;  1XGM A;  5CDL A;  2BWX A;  4FLI A;  4IKU A;  4U70 A;  1CHM A;  1QZY A;  2BN7 A;  2BH3 A;  2IW2 A;  3MX6 A;  4FUK A;  5D6F A;  5E5B A;  1KQ9 A;  4PV4 A;  2NQ7 A;  4U6J A;  5CDE A;  2GU6 A;  2Q95 A;  4IPA A;  4A6W A;  4MAT A;  2V3Y A;  2G6P A;  3Q6D A;  4IKR A;  2B3L A;  4KM3 A;  4U73 A;  1Y1N A;  2OAZ A;  2GG5 A;  2HOW A;  2GG7 A;  3RVA A;  1XGO A;  4RGZ 1;  4S2T P;  2GG9 A;  1C24 A;  1YVM A;  4R60 A;  2GZ5 A;  2GA2 A;  4OOK A;  3PKE A;  4PNC A;  4IU6 A;  4Z7M A;  4HXX A;  2MAT A;  4RZY A;  2OKN A;  3L24 A;  4A6V A;  1N51 A;  2GG3 A;  3MR1 A;  5JI6 A;  2BHB A;  2GGB A;  2Q92 A;  2GGC A;  5JFR A;  1WLR A;  2GG0 A;  4IDY A;  4IF7 A;  2GG2 A;  4IKT A;  2EVM A;  2P98 A;  1PV9 A;  3S6B A;  1QXZ A;  3D27 A;  4S01 A;  2Q96 A;  4FKC A;  5JHU A;  3ROR A;  2EA4 A;  4IKS A;  4U75 A;  5CLS A;  3TAV A;  5CNX A;  3PKA A;  3L7G A;  1XGS A;  4ZWU A;  1B6A A;  2BB7 A;  1O0X A;  1B59 A;  4FLJ A;  3BIT A;  2BWV A;  2Q94 A;  4FO7 A;  2GU7 A;  1R58 A;  1C27 A;  1WL9 A;  1QXY A;  1C22 A;  1XNZ A;  1WN1 A;  2BWY A;  2GU5 A;  5FCF A;  1QXW A;  2EVC A;  2V6C A; 
#chains in the Genus database with same CATH homology
 1MAT A;  5CIK A;  5CE6 A;  1YW9 A;  2GU4 A;  2ADU A;  2GTX A;  3CB6 A;  3PKB A;  4JUQ A;  4QR8 A;  1BOA A;  1R5G A;  4U6C A;  2B3K A;  4IEC A;  3FMR A;  1WBQ A;  3PKD A;  2DFI A;  2V3X A;  1WL6 A;  4S2R P;  4U71 A;  1C21 A;  1A16 A;  2Q93 A;  2ZSG A;  4ZWO A;  4FO8 A;  1W2M A;  2EA2 A;  2BHA A;  1WY2 A;  4B28 A;  5CDV A;  1YJ3 A;  4U69 A;  4U76 A;  5D6E A;  2Q8K A;  3PKC A;  3FMQ A;  2BWS A;  1XGN A;  4U6E A;  4U6Z A;  2BHC A;  2BWU A;  3MAT A;  3FM3 A;  1W7V A;  1R5H A;  2GG8 A;  4RZZ A;  1YW8 A;  1KP0 A;  1BN5 A;  2BWW A;  3IG4 A;  1WKM A;  2EVO A;  3IU7 A;  4ZNG A;  5FCH A;  3BIQ A;  1JAW A;  2B3H A;  2V3Z A;  4FLL A;  3CTZ A;  1KQ0 A;  3BIP A;  4S00 A;  4FLK A;  2P9A A;  2BHD A;  4U1B A;  3TB5 A;  2BWT A;  1M35 A;  2NQ6 A;  3CB5 A;  1YW7 A;  3IU8 A;  4U6W A;  3IU9 A;  2P99 A;  4ZWP A;  4EGE A;  1C23 A;  1XGM A;  5CDL A;  2BWX A;  4FLI A;  4IKU A;  4U70 A;  1CHM A;  1QZY A;  2BN7 A;  2BH3 A;  2IW2 A;  3MX6 A;  4FUK A;  5D6F A;  5E5B A;  1KQ9 A;  4PV4 A;  2NQ7 A;  4U6J A;  5CDE A;  2GU6 A;  2Q95 A;  4IPA A;  4A6W A;  4MAT A;  2V3Y A;  2G6P A;  3Q6D A;  4IKR A;  2B3L A;  4KM3 A;  4U73 A;  1Y1N A;  2OAZ A;  2GG5 A;  2HOW A;  2GG7 A;  3RVA A;  1XGO A;  4RGZ 1;  4S2T P;  2GG9 A;  1C24 A;  1YVM A;  4R60 A;  2GZ5 A;  2GA2 A;  4OOK A;  3PKE A;  4PNC A;  4IU6 A;  4Z7M A;  4HXX A;  2MAT A;  4RZY A;  2OKN A;  3L24 A;  4A6V A;  1N51 A;  2GG3 A;  3MR1 A;  5JI6 A;  2BHB A;  2GGB A;  2Q92 A;  2GGC A;  5JFR A;  1WLR A;  2GG0 A;  4IDY A;  4IF7 A;  2GG2 A;  4IKT A;  2EVM A;  2P98 A;  1PV9 A;  3S6B A;  1QXZ A;  3D27 A;  4S01 A;  2Q96 A;  4FKC A;  5JHU A;  3ROR A;  2EA4 A;  4IKS A;  4U75 A;  5CLS A;  3TAV A;  5CNX A;  3PKA A;  3L7G A;  1XGS A;  4ZWU A;  1B6A A;  2BB7 A;  1O0X A;  1B59 A;  4FLJ A;  3BIT A;  2BWV A;  2Q94 A;  4FO7 A;  2GU7 A;  1R58 A;  1C27 A;  1WL9 A;  1QXY A;  1C22 A;  1XNZ A;  1WN1 A;  2BWY A;  2GU5 A;  5FCF A;  1QXW A;  2EVC A;  2V6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...