4IKUA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with 2-((5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)amino)-3-phenylpropanamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4ikuA00
2Q95A 4FLJA 2V3XA 4FLIA 4PNCA 5JFRA 2BH3A 2BWYA 3RVAA 3IU7A 4FO8A 2BWUA 1YW7A 4HXXA 4U75A 1QXZA 2IW2A 5CNXA 4U69A 2BHDA 4S2RP 4A6VA 3IU8A 2GA2A 1KQ0A 4S00A 3D27A 4IDYA 2GU4A 1R5GA 2OAZA 3L7GA 2Q94A 4FUKA 4U6CA 1WLRA 4U6WA 4FLKA 4Z7MA 1MATA 2GG7A 3CB6A 2Q92A 2NQ6A 3RORA 1YVMA 2ZSGA 4IPAA 1KQ9A 3BITA 2EA4A 1C21A 1WL9A 2GG9A 1PV9A 2GU7A 4R60A 1WL6A 2BWTA 3BIQA 1XGOA 1WBQA 1C22A 2BB7A 2HOWA 3TAVA 5CLSA 2Q96A 2EA2A 2GGBA 1C23A 1QZYA 2BWXA 1A16A 2V6CA 2P98A 2BN7A 2GG5A 2MATA 2OKNA 4U73A 1QXWA 2EVMA 4U70A 1C27A 1YW9A 4MATA 4ZWPA 2B3LA 2BHAA 2GU6A 5CDEA 1C24A 1WKMA 4IKSA 4U76A 3MR1A 2B3HA 2ADUA 3CB5A 3FMQA 2BWWA 2GZ5A 2V3YA 4RGZ1 4U6JA 5CDVA 3TB5A 3PKEA 2BHBA 4IU6A 1XGMA 2P99A 4JUQA 4S2TP 5FCHA 2G6PA 1WN1A 2DFIA 5CIKA 1JAWA 2EVCA 3FM3A 1YW8A 2B3KA 2GTXA 3PKCA 4QR8A 5JI6A 3PKAA 4EGEA 3BIPA 4ZWUA 4IKUA 4U1BA 1QXYA 3PKBA 1XNZA 3PKDA 4U71A 2GG0A 1BN5A 3S6BA 2Q93A 4FKCA 2GGCA 4PV4A 1W2MA 3Q6DA 3IU9A 3L24A 4S01A 1XGNA 5E5BA 2GG2A 4IECA 1XGSA 4RZZA 1CHMA 2NQ7A 2P9AA 5CDLA 1O0XA 3IG4A 2GG3A 2EVOA 4RZYA 5D6FA 2GU5A 2V3ZA 1W7VA 2BWSA 4FLLA 1Y1NA 2GG8A 4ZNGA 5FCFA 3FMRA 4B28A 2Q8KA 4U6EA 3MATA 4IF7A 4IKRA 1B59A 5D6EA 1R58A 4A6WA 2BWVA 2BHCA 1BOAA 1KP0A 3MX6A 4ZWOA 4OOKA 4KM3A 1WY2A 5CE6A 1R5HA 1M35A 1B6AA 1YJ3A 5JHUA 4U6ZA 4FO7A 3CTZA 4IKTA 1N51A
chains in the Genus database with same CATH superfamily
2Q95A 4FLJA 2V3XA 4FLIA 4PNCA 5JFRA 2BH3A 2BWYA 3RVAA 3IU7A 4FO8A 2BWUA 1YW7A 4HXXA 4U75A 1QXZA 2IW2A 5CNXA 4U69A 2BHDA 4S2RP 4A6VA 3IU8A 2GA2A 1KQ0A 4S00A 3D27A 4IDYA 2GU4A 1R5GA 2OAZA 3L7GA 2Q94A 4FUKA 4U6CA 1WLRA 4U6WA 4FLKA 4Z7MA 1MATA 2GG7A 3CB6A 2Q92A 2NQ6A 3RORA 1YVMA 2ZSGA 4IPAA 1KQ9A 3BITA 2EA4A 1C21A 1WL9A 2GG9A 1PV9A 2GU7A 4R60A 1WL6A 2BWTA 3BIQA 1XGOA 1WBQA 1C22A 2BB7A 2HOWA 3TAVA 5CLSA 2Q96A 2EA2A 2GGBA 1C23A 1QZYA 2BWXA 1A16A 2V6CA 2P98A 2BN7A 2GG5A 2MATA 2OKNA 4U73A 1QXWA 2EVMA 4U70A 1C27A 1YW9A 4MATA 4ZWPA 2B3LA 2BHAA 2GU6A 5CDEA 1C24A 1WKMA 4IKSA 4U76A 3MR1A 2B3HA 2ADUA 3CB5A 3FMQA 2BWWA 2GZ5A 2V3YA 4RGZ1 4U6JA 5CDVA 3TB5A 3PKEA 2BHBA 4IU6A 1XGMA 2P99A 4JUQA 4S2TP 5FCHA 2G6PA 1WN1A 2DFIA 5CIKA 1JAWA 2EVCA 3FM3A 1YW8A 2B3KA 2GTXA 3PKCA 4QR8A 5JI6A 3PKAA 4EGEA 3BIPA 4ZWUA 4IKUA 4U1BA 1QXYA 3PKBA 1XNZA 3PKDA 4U71A 2GG0A 1BN5A 3S6BA 2Q93A 4FKCA 2GGCA 4PV4A 1W2MA 3Q6DA 3IU9A 3L24A 4S01A 1XGNA 5E5BA 2GG2A 4IECA 1XGSA 4RZZA 1CHMA 2NQ7A 2P9AA 5CDLA 1O0XA 3IG4A 2GG3A 2EVOA 4RZYA 5D6FA 2GU5A 2V3ZA 1W7VA 2BWSA 4FLLA 1Y1NA 2GG8A 4ZNGA 5FCFA 3FMRA 4B28A 2Q8KA 4U6EA 3MATA 4IF7A 4IKRA 1B59A 5D6EA 1R58A 4A6WA 2BWVA 2BHCA 1BOAA 1KP0A 3MX6A 4ZWOA 4OOKA 4KM3A 1WY2A 5CE6A 1R5HA 1M35A 1B6AA 1YJ3A 5JHUA 4U6ZA 4FO7A 3CTZA 4IKTA 1N51A
chains in the Genus database with same CATH topology
2Q95A 4FLJA 2V3XA 4FLIA 4PNCA 5JFRA 2BH3A 2BWYA 3RVAA 3IU7A 4FO8A 2BWUA 1YW7A 4HXXA 4U75A 1QXZA 2IW2A 5CNXA 4U69A 2BHDA 4S2RP 4A6VA 3IU8A 2GA2A 1KQ0A 4S00A 3D27A 4IDYA 2GU4A 1R5GA 2OAZA 3L7GA 2Q94A 4FUKA 4U6CA 1WLRA 4U6WA 4FLKA 4Z7MA 1MATA 2GG7A 3CB6A 2Q92A 2NQ6A 3RORA 1YVMA 2ZSGA 4IPAA 1KQ9A 3BITA 2EA4A 1C21A 1WL9A 2GG9A 1PV9A 2GU7A 4R60A 1WL6A 2BWTA 3BIQA 1XGOA 1WBQA 1C22A 2BB7A 2HOWA 3TAVA 5CLSA 2Q96A 2EA2A 2GGBA 1C23A 1QZYA 2BWXA 1A16A 2V6CA 2P98A 2BN7A 2GG5A 2MATA 2OKNA 4U73A 1QXWA 2EVMA 4U70A 1C27A 1YW9A 4MATA 4ZWPA 2B3LA 2BHAA 2GU6A 5CDEA 1C24A 1WKMA 4IKSA 4U76A 3MR1A 2B3HA 2ADUA 3CB5A 3FMQA 2BWWA 2GZ5A 2V3YA 4RGZ1 4U6JA 5CDVA 3TB5A 3PKEA 2BHBA 4IU6A 1XGMA 2P99A 4JUQA 4S2TP 5FCHA 2G6PA 1WN1A 2DFIA 5CIKA 1JAWA 2EVCA 3FM3A 1YW8A 2B3KA 2GTXA 3PKCA 4QR8A 5JI6A 3PKAA 4EGEA 3BIPA 4ZWUA 4IKUA 4U1BA 1QXYA 3PKBA 1XNZA 3PKDA 4U71A 2GG0A 1BN5A 3S6BA 2Q93A 4FKCA 2GGCA 4PV4A 1W2MA 3Q6DA 3IU9A 3L24A 4S01A 1XGNA 5E5BA 2GG2A 4IECA 1XGSA 4RZZA 1CHMA 2NQ7A 2P9AA 5CDLA 1O0XA 3IG4A 2GG3A 2EVOA 4RZYA 5D6FA 2GU5A 2V3ZA 1W7VA 2BWSA 4FLLA 1Y1NA 2GG8A 4ZNGA 5FCFA 3FMRA 4B28A 2Q8KA 4U6EA 3MATA 4IF7A 4IKRA 1B59A 5D6EA 1R58A 4A6WA 2BWVA 2BHCA 1BOAA 1KP0A 3MX6A 4ZWOA 4OOKA 4KM3A 1WY2A 5CE6A 1R5HA 1M35A 1B6AA 1YJ3A 5JHUA 4U6ZA 4FO7A 3CTZA 4IKTA 1N51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q95 A;  4FLJ A;  2V3X A;  4FLI A;  4PNC A;  5JFR A;  2BH3 A;  2BWY A;  3RVA A;  3IU7 A;  4FO8 A;  2BWU A;  1YW7 A;  4HXX A;  4U75 A;  1QXZ A;  2IW2 A;  5CNX A;  4U69 A;  2BHD A;  4S2R P;  4A6V A;  3IU8 A;  2GA2 A;  1KQ0 A;  4S00 A;  3D27 A;  4IDY A;  2GU4 A;  1R5G A;  2OAZ A;  3L7G A;  2Q94 A;  4FUK A;  4U6C A;  1WLR A;  4U6W A;  4FLK A;  4Z7M A;  1MAT A;  2GG7 A;  3CB6 A;  2Q92 A;  2NQ6 A;  3ROR A;  1YVM A;  2ZSG A;  4IPA A;  1KQ9 A;  3BIT A;  2EA4 A;  1C21 A;  1WL9 A;  2GG9 A;  1PV9 A;  2GU7 A;  4R60 A;  1WL6 A;  2BWT A;  3BIQ A;  1XGO A;  1WBQ A;  1C22 A;  2BB7 A;  2HOW A;  3TAV A;  5CLS A;  2Q96 A;  2EA2 A;  2GGB A;  1C23 A;  1QZY A;  2BWX A;  1A16 A;  2V6C A;  2P98 A;  2BN7 A;  2GG5 A;  2MAT A;  2OKN A;  4U73 A;  1QXW A;  2EVM A;  4U70 A;  1C27 A;  1YW9 A;  4MAT A;  4ZWP A;  2B3L A;  2BHA A;  2GU6 A;  5CDE A;  1C24 A;  1WKM A;  4IKS A;  4U76 A;  3MR1 A;  2B3H A;  2ADU A;  3CB5 A;  3FMQ A;  2BWW A;  2GZ5 A;  2V3Y A;  4RGZ 1;  4U6J A;  5CDV A;  3TB5 A;  3PKE A;  2BHB A;  4IU6 A;  1XGM A;  2P99 A;  4JUQ A;  4S2T P;  5FCH A;  2G6P A;  1WN1 A;  2DFI A;  5CIK A;  1JAW A;  2EVC A;  3FM3 A;  1YW8 A;  2B3K A;  2GTX A;  3PKC A;  4QR8 A;  5JI6 A;  3PKA A;  4EGE A;  3BIP A;  4ZWU A;  4IKU A;  4U1B A;  1QXY A;  3PKB A;  1XNZ A;  3PKD A;  4U71 A;  2GG0 A;  1BN5 A;  3S6B A;  2Q93 A;  4FKC A;  2GGC A;  4PV4 A;  1W2M A;  3Q6D A;  3IU9 A;  3L24 A;  4S01 A;  1XGN A;  5E5B A;  2GG2 A;  4IEC A;  1XGS A;  4RZZ A;  1CHM A;  2NQ7 A;  2P9A A;  5CDL A;  1O0X A;  3IG4 A;  2GG3 A;  2EVO A;  4RZY A;  5D6F A;  2GU5 A;  2V3Z A;  1W7V A;  2BWS A;  4FLL A;  1Y1N A;  2GG8 A;  4ZNG A;  5FCF A;  3FMR A;  4B28 A;  2Q8K A;  4U6E A;  3MAT A;  4IF7 A;  4IKR A;  1B59 A;  5D6E A;  1R58 A;  4A6W A;  2BWV A;  2BHC A;  1BOA A;  1KP0 A;  3MX6 A;  4ZWO A;  4OOK A;  4KM3 A;  1WY2 A;  5CE6 A;  1R5H A;  1M35 A;  1B6A A;  1YJ3 A;  5JHU A;  4U6Z A;  4FO7 A;  3CTZ A;  4IKT A;  1N51 A; 
#chains in the Genus database with same CATH topology
 2Q95 A;  4FLJ A;  2V3X A;  4FLI A;  4PNC A;  5JFR A;  2BH3 A;  2BWY A;  3RVA A;  3IU7 A;  4FO8 A;  2BWU A;  1YW7 A;  4HXX A;  4U75 A;  1QXZ A;  2IW2 A;  5CNX A;  4U69 A;  2BHD A;  4S2R P;  4A6V A;  3IU8 A;  2GA2 A;  1KQ0 A;  4S00 A;  3D27 A;  4IDY A;  2GU4 A;  1R5G A;  2OAZ A;  3L7G A;  2Q94 A;  4FUK A;  4U6C A;  1WLR A;  4U6W A;  4FLK A;  4Z7M A;  1MAT A;  2GG7 A;  3CB6 A;  2Q92 A;  2NQ6 A;  3ROR A;  1YVM A;  2ZSG A;  4IPA A;  1KQ9 A;  3BIT A;  2EA4 A;  1C21 A;  1WL9 A;  2GG9 A;  1PV9 A;  2GU7 A;  4R60 A;  1WL6 A;  2BWT A;  3BIQ A;  1XGO A;  1WBQ A;  1C22 A;  2BB7 A;  2HOW A;  3TAV A;  5CLS A;  2Q96 A;  2EA2 A;  2GGB A;  1C23 A;  1QZY A;  2BWX A;  1A16 A;  2V6C A;  2P98 A;  2BN7 A;  2GG5 A;  2MAT A;  2OKN A;  4U73 A;  1QXW A;  2EVM A;  4U70 A;  1C27 A;  1YW9 A;  4MAT A;  4ZWP A;  2B3L A;  2BHA A;  2GU6 A;  5CDE A;  1C24 A;  1WKM A;  4IKS A;  4U76 A;  3MR1 A;  2B3H A;  2ADU A;  3CB5 A;  3FMQ A;  2BWW A;  2GZ5 A;  2V3Y A;  4RGZ 1;  4U6J A;  5CDV A;  3TB5 A;  3PKE A;  2BHB A;  4IU6 A;  1XGM A;  2P99 A;  4JUQ A;  4S2T P;  5FCH A;  2G6P A;  1WN1 A;  2DFI A;  5CIK A;  1JAW A;  2EVC A;  3FM3 A;  1YW8 A;  2B3K A;  2GTX A;  3PKC A;  4QR8 A;  5JI6 A;  3PKA A;  4EGE A;  3BIP A;  4ZWU A;  4IKU A;  4U1B A;  1QXY A;  3PKB A;  1XNZ A;  3PKD A;  4U71 A;  2GG0 A;  1BN5 A;  3S6B A;  2Q93 A;  4FKC A;  2GGC A;  4PV4 A;  1W2M A;  3Q6D A;  3IU9 A;  3L24 A;  4S01 A;  1XGN A;  5E5B A;  2GG2 A;  4IEC A;  1XGS A;  4RZZ A;  1CHM A;  2NQ7 A;  2P9A A;  5CDL A;  1O0X A;  3IG4 A;  2GG3 A;  2EVO A;  4RZY A;  5D6F A;  2GU5 A;  2V3Z A;  1W7V A;  2BWS A;  4FLL A;  1Y1N A;  2GG8 A;  4ZNG A;  5FCF A;  3FMR A;  4B28 A;  2Q8K A;  4U6E A;  3MAT A;  4IF7 A;  4IKR A;  1B59 A;  5D6E A;  1R58 A;  4A6W A;  2BWV A;  2BHC A;  1BOA A;  1KP0 A;  3MX6 A;  4ZWO A;  4OOK A;  4KM3 A;  1WY2 A;  5CE6 A;  1R5H A;  1M35 A;  1B6A A;  1YJ3 A;  5JHU A;  4U6Z A;  4FO7 A;  3CTZ A;  4IKT A;  1N51 A; 
#chains in the Genus database with same CATH homology
 2Q95 A;  4FLJ A;  2V3X A;  4FLI A;  4PNC A;  5JFR A;  2BH3 A;  2BWY A;  3RVA A;  3IU7 A;  4FO8 A;  2BWU A;  1YW7 A;  4HXX A;  4U75 A;  1QXZ A;  2IW2 A;  5CNX A;  4U69 A;  2BHD A;  4S2R P;  4A6V A;  3IU8 A;  2GA2 A;  1KQ0 A;  4S00 A;  3D27 A;  4IDY A;  2GU4 A;  1R5G A;  2OAZ A;  3L7G A;  2Q94 A;  4FUK A;  4U6C A;  1WLR A;  4U6W A;  4FLK A;  4Z7M A;  1MAT A;  2GG7 A;  3CB6 A;  2Q92 A;  2NQ6 A;  3ROR A;  1YVM A;  2ZSG A;  4IPA A;  1KQ9 A;  3BIT A;  2EA4 A;  1C21 A;  1WL9 A;  2GG9 A;  1PV9 A;  2GU7 A;  4R60 A;  1WL6 A;  2BWT A;  3BIQ A;  1XGO A;  1WBQ A;  1C22 A;  2BB7 A;  2HOW A;  3TAV A;  5CLS A;  2Q96 A;  2EA2 A;  2GGB A;  1C23 A;  1QZY A;  2BWX A;  1A16 A;  2V6C A;  2P98 A;  2BN7 A;  2GG5 A;  2MAT A;  2OKN A;  4U73 A;  1QXW A;  2EVM A;  4U70 A;  1C27 A;  1YW9 A;  4MAT A;  4ZWP A;  2B3L A;  2BHA A;  2GU6 A;  5CDE A;  1C24 A;  1WKM A;  4IKS A;  4U76 A;  3MR1 A;  2B3H A;  2ADU A;  3CB5 A;  3FMQ A;  2BWW A;  2GZ5 A;  2V3Y A;  4RGZ 1;  4U6J A;  5CDV A;  3TB5 A;  3PKE A;  2BHB A;  4IU6 A;  1XGM A;  2P99 A;  4JUQ A;  4S2T P;  5FCH A;  2G6P A;  1WN1 A;  2DFI A;  5CIK A;  1JAW A;  2EVC A;  3FM3 A;  1YW8 A;  2B3K A;  2GTX A;  3PKC A;  4QR8 A;  5JI6 A;  3PKA A;  4EGE A;  3BIP A;  4ZWU A;  4IKU A;  4U1B A;  1QXY A;  3PKB A;  1XNZ A;  3PKD A;  4U71 A;  2GG0 A;  1BN5 A;  3S6B A;  2Q93 A;  4FKC A;  2GGC A;  4PV4 A;  1W2M A;  3Q6D A;  3IU9 A;  3L24 A;  4S01 A;  1XGN A;  5E5B A;  2GG2 A;  4IEC A;  1XGS A;  4RZZ A;  1CHM A;  2NQ7 A;  2P9A A;  5CDL A;  1O0X A;  3IG4 A;  2GG3 A;  2EVO A;  4RZY A;  5D6F A;  2GU5 A;  2V3Z A;  1W7V A;  2BWS A;  4FLL A;  1Y1N A;  2GG8 A;  4ZNG A;  5FCF A;  3FMR A;  4B28 A;  2Q8K A;  4U6E A;  3MAT A;  4IF7 A;  4IKR A;  1B59 A;  5D6E A;  1R58 A;  4A6W A;  2BWV A;  2BHC A;  1BOA A;  1KP0 A;  3MX6 A;  4ZWO A;  4OOK A;  4KM3 A;  1WY2 A;  5CE6 A;  1R5H A;  1M35 A;  1B6A A;  1YJ3 A;  5JHU A;  4U6Z A;  4FO7 A;  3CTZ A;  4IKT A;  1N51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...