4IKUA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with 2-((5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)amino)-3-phenylpropanamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4ikuA00
2GGBA 2V3ZA 2GU4A 4ZWOA 5CE6A 3PKEA 2BWTA 4IPAA 1KP0A 1BN5A 3PKCA 2P9AA 2BHDA 4MATA 3BIQA 4S01A 4FLKA 4A6VA 3L24A 1MATA 3CTZA 4FUKA 3IU7A 3S6BA 1XGOA 3MATA 3PKDA 1R5HA 3FMRA 4PV4A 4A6WA 2DFIA 2IW2A 2EVCA 1YW8A 3IU8A 1C24A 4U1BA 2BWSA 2BH3A 4FLJA 3FM3A 2GG7A 2BN7A 5D6FA 5CDEA 1WLRA 2V3YA 1W7VA 1WY2A 2OKNA 2EVMA 2GG8A 1W2MA 1JAWA 1R58A 2EA4A 2P99A 3TAVA 4QR8A 3CB6A 2EA2A 1WBQA 1PV9A 1KQ0A 2OAZA 3IU9A 2BWVA 1YW7A 2NQ6A 2GGCA 4S2TP 2BB7A 2BHAA 3CB5A 5JHUA 1WKMA 1XGSA 4U6JA 4U6ZA 5CLSA 2GU5A 2GU7A 3BIPA 3TB5A 2BHCA 2V6CA 4FO8A 5CIKA 2BWXA 5FCHA 2EVOA 2G6PA 3BITA 4R60A 1M35A 4IDYA 1B59A 4RZYA 4U69A 1YW9A 2V3XA 3Q6DA 4IKUA 2Q93A 1XGNA 4RGZ1 4HXXA 1QXZA 2B3LA 2GZ5A 4U76A 2B3HA 2GG9A 2BHBA 4S2RP 2BWYA 2GG0A 4U75A 2Q95A 1XNZA 1C23A 5JFRA 1Y1NA 4JUQA 4EGEA 4U73A 3D27A 1CHMA 3IG4A 1QXYA 4KM3A 3PKAA 5CDVA 2BWUA 3L7GA 4IKSA 2Q96A 4RZZA 4FLIA 1QZYA 1KQ9A 1YVMA 4IECA 1WL9A 4Z7MA 2ADUA 2Q8KA 1YJ3A 3FMQA 1R5GA 1A16A 2GTXA 1N51A 3MR1A 4U6EA 4U70A 2GA2A 4IKTA 4IU6A 2B3KA 4B28A 2NQ7A 4PNCA 2P98A 1B6AA 2GG3A 2Q94A 1O0XA 2Q92A 4U6WA 3RVAA 2GG2A 5D6EA 4U6CA 1C22A 2ZSGA 5JI6A 1WN1A 4FLLA 2GG5A 4OOKA 1XGMA 4U71A 4ZWPA 5CDLA 4IKRA 4ZNGA 2BWWA 2GU6A 4IF7A 3PKBA 1QXWA 3MX6A 1WL6A 4FO7A 4FKCA 5CNXA 3RORA 1BOAA 1C27A 4S00A 5E5BA 2MATA 4ZWUA 2HOWA 1C21A 5FCFA
chains in the Genus database with same CATH superfamily
2GGBA 2V3ZA 2GU4A 4ZWOA 5CE6A 3PKEA 2BWTA 4IPAA 1KP0A 1BN5A 3PKCA 2P9AA 2BHDA 4MATA 3BIQA 4S01A 4FLKA 4A6VA 3L24A 1MATA 3CTZA 4FUKA 3IU7A 3S6BA 1XGOA 3MATA 3PKDA 1R5HA 3FMRA 4PV4A 4A6WA 2DFIA 2IW2A 2EVCA 1YW8A 3IU8A 1C24A 4U1BA 2BWSA 2BH3A 4FLJA 3FM3A 2GG7A 2BN7A 5D6FA 5CDEA 1WLRA 2V3YA 1W7VA 1WY2A 2OKNA 2EVMA 2GG8A 1W2MA 1JAWA 1R58A 2EA4A 2P99A 3TAVA 4QR8A 3CB6A 2EA2A 1WBQA 1PV9A 1KQ0A 2OAZA 3IU9A 2BWVA 1YW7A 2NQ6A 2GGCA 4S2TP 2BB7A 2BHAA 3CB5A 5JHUA 1WKMA 1XGSA 4U6JA 4U6ZA 5CLSA 2GU5A 2GU7A 3BIPA 3TB5A 2BHCA 2V6CA 4FO8A 5CIKA 2BWXA 5FCHA 2EVOA 2G6PA 3BITA 4R60A 1M35A 4IDYA 1B59A 4RZYA 4U69A 1YW9A 2V3XA 3Q6DA 4IKUA 2Q93A 1XGNA 4RGZ1 4HXXA 1QXZA 2B3LA 2GZ5A 4U76A 2B3HA 2GG9A 2BHBA 4S2RP 2BWYA 2GG0A 4U75A 2Q95A 1XNZA 1C23A 5JFRA 1Y1NA 4JUQA 4EGEA 4U73A 3D27A 1CHMA 3IG4A 1QXYA 4KM3A 3PKAA 5CDVA 2BWUA 3L7GA 4IKSA 2Q96A 4RZZA 4FLIA 1QZYA 1KQ9A 1YVMA 4IECA 1WL9A 4Z7MA 2ADUA 2Q8KA 1YJ3A 3FMQA 1R5GA 1A16A 2GTXA 1N51A 3MR1A 4U6EA 4U70A 2GA2A 4IKTA 4IU6A 2B3KA 4B28A 2NQ7A 4PNCA 2P98A 1B6AA 2GG3A 2Q94A 1O0XA 2Q92A 4U6WA 3RVAA 2GG2A 5D6EA 4U6CA 1C22A 2ZSGA 5JI6A 1WN1A 4FLLA 2GG5A 4OOKA 1XGMA 4U71A 4ZWPA 5CDLA 4IKRA 4ZNGA 2BWWA 2GU6A 4IF7A 3PKBA 1QXWA 3MX6A 1WL6A 4FO7A 4FKCA 5CNXA 3RORA 1BOAA 1C27A 4S00A 5E5BA 2MATA 4ZWUA 2HOWA 1C21A 5FCFA
chains in the Genus database with same CATH topology
2GGBA 2V3ZA 2GU4A 4ZWOA 5CE6A 3PKEA 2BWTA 4IPAA 1KP0A 1BN5A 3PKCA 2P9AA 2BHDA 4MATA 3BIQA 4S01A 4FLKA 4A6VA 3L24A 1MATA 3CTZA 4FUKA 3IU7A 3S6BA 1XGOA 3MATA 3PKDA 1R5HA 3FMRA 4PV4A 4A6WA 2DFIA 2IW2A 2EVCA 1YW8A 3IU8A 1C24A 4U1BA 2BWSA 2BH3A 4FLJA 3FM3A 2GG7A 2BN7A 5D6FA 5CDEA 1WLRA 2V3YA 1W7VA 1WY2A 2OKNA 2EVMA 2GG8A 1W2MA 1JAWA 1R58A 2EA4A 2P99A 3TAVA 4QR8A 3CB6A 2EA2A 1WBQA 1PV9A 1KQ0A 2OAZA 3IU9A 2BWVA 1YW7A 2NQ6A 2GGCA 4S2TP 2BB7A 2BHAA 3CB5A 5JHUA 1WKMA 1XGSA 4U6JA 4U6ZA 5CLSA 2GU5A 2GU7A 3BIPA 3TB5A 2BHCA 2V6CA 4FO8A 5CIKA 2BWXA 5FCHA 2EVOA 2G6PA 3BITA 4R60A 1M35A 4IDYA 1B59A 4RZYA 4U69A 1YW9A 2V3XA 3Q6DA 4IKUA 2Q93A 1XGNA 4RGZ1 4HXXA 1QXZA 2B3LA 2GZ5A 4U76A 2B3HA 2GG9A 2BHBA 4S2RP 2BWYA 2GG0A 4U75A 2Q95A 1XNZA 1C23A 5JFRA 1Y1NA 4JUQA 4EGEA 4U73A 3D27A 1CHMA 3IG4A 1QXYA 4KM3A 3PKAA 5CDVA 2BWUA 3L7GA 4IKSA 2Q96A 4RZZA 4FLIA 1QZYA 1KQ9A 1YVMA 4IECA 1WL9A 4Z7MA 2ADUA 2Q8KA 1YJ3A 3FMQA 1R5GA 1A16A 2GTXA 1N51A 3MR1A 4U6EA 4U70A 2GA2A 4IKTA 4IU6A 2B3KA 4B28A 2NQ7A 4PNCA 2P98A 1B6AA 2GG3A 2Q94A 1O0XA 2Q92A 4U6WA 3RVAA 2GG2A 5D6EA 4U6CA 1C22A 2ZSGA 5JI6A 1WN1A 4FLLA 2GG5A 4OOKA 1XGMA 4U71A 4ZWPA 5CDLA 4IKRA 4ZNGA 2BWWA 2GU6A 4IF7A 3PKBA 1QXWA 3MX6A 1WL6A 4FO7A 4FKCA 5CNXA 3RORA 1BOAA 1C27A 4S00A 5E5BA 2MATA 4ZWUA 2HOWA 1C21A 5FCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGB A;  2V3Z A;  2GU4 A;  4ZWO A;  5CE6 A;  3PKE A;  2BWT A;  4IPA A;  1KP0 A;  1BN5 A;  3PKC A;  2P9A A;  2BHD A;  4MAT A;  3BIQ A;  4S01 A;  4FLK A;  4A6V A;  3L24 A;  1MAT A;  3CTZ A;  4FUK A;  3IU7 A;  3S6B A;  1XGO A;  3MAT A;  3PKD A;  1R5H A;  3FMR A;  4PV4 A;  4A6W A;  2DFI A;  2IW2 A;  2EVC A;  1YW8 A;  3IU8 A;  1C24 A;  4U1B A;  2BWS A;  2BH3 A;  4FLJ A;  3FM3 A;  2GG7 A;  2BN7 A;  5D6F A;  5CDE A;  1WLR A;  2V3Y A;  1W7V A;  1WY2 A;  2OKN A;  2EVM A;  2GG8 A;  1W2M A;  1JAW A;  1R58 A;  2EA4 A;  2P99 A;  3TAV A;  4QR8 A;  3CB6 A;  2EA2 A;  1WBQ A;  1PV9 A;  1KQ0 A;  2OAZ A;  3IU9 A;  2BWV A;  1YW7 A;  2NQ6 A;  2GGC A;  4S2T P;  2BB7 A;  2BHA A;  3CB5 A;  5JHU A;  1WKM A;  1XGS A;  4U6J A;  4U6Z A;  5CLS A;  2GU5 A;  2GU7 A;  3BIP A;  3TB5 A;  2BHC A;  2V6C A;  4FO8 A;  5CIK A;  2BWX A;  5FCH A;  2EVO A;  2G6P A;  3BIT A;  4R60 A;  1M35 A;  4IDY A;  1B59 A;  4RZY A;  4U69 A;  1YW9 A;  2V3X A;  3Q6D A;  4IKU A;  2Q93 A;  1XGN A;  4RGZ 1;  4HXX A;  1QXZ A;  2B3L A;  2GZ5 A;  4U76 A;  2B3H A;  2GG9 A;  2BHB A;  4S2R P;  2BWY A;  2GG0 A;  4U75 A;  2Q95 A;  1XNZ A;  1C23 A;  5JFR A;  1Y1N A;  4JUQ A;  4EGE A;  4U73 A;  3D27 A;  1CHM A;  3IG4 A;  1QXY A;  4KM3 A;  3PKA A;  5CDV A;  2BWU A;  3L7G A;  4IKS A;  2Q96 A;  4RZZ A;  4FLI A;  1QZY A;  1KQ9 A;  1YVM A;  4IEC A;  1WL9 A;  4Z7M A;  2ADU A;  2Q8K A;  1YJ3 A;  3FMQ A;  1R5G A;  1A16 A;  2GTX A;  1N51 A;  3MR1 A;  4U6E A;  4U70 A;  2GA2 A;  4IKT A;  4IU6 A;  2B3K A;  4B28 A;  2NQ7 A;  4PNC A;  2P98 A;  1B6A A;  2GG3 A;  2Q94 A;  1O0X A;  2Q92 A;  4U6W A;  3RVA A;  2GG2 A;  5D6E A;  4U6C A;  1C22 A;  2ZSG A;  5JI6 A;  1WN1 A;  4FLL A;  2GG5 A;  4OOK A;  1XGM A;  4U71 A;  4ZWP A;  5CDL A;  4IKR A;  4ZNG A;  2BWW A;  2GU6 A;  4IF7 A;  3PKB A;  1QXW A;  3MX6 A;  1WL6 A;  4FO7 A;  4FKC A;  5CNX A;  3ROR A;  1BOA A;  1C27 A;  4S00 A;  5E5B A;  2MAT A;  4ZWU A;  2HOW A;  1C21 A;  5FCF A; 
#chains in the Genus database with same CATH topology
 2GGB A;  2V3Z A;  2GU4 A;  4ZWO A;  5CE6 A;  3PKE A;  2BWT A;  4IPA A;  1KP0 A;  1BN5 A;  3PKC A;  2P9A A;  2BHD A;  4MAT A;  3BIQ A;  4S01 A;  4FLK A;  4A6V A;  3L24 A;  1MAT A;  3CTZ A;  4FUK A;  3IU7 A;  3S6B A;  1XGO A;  3MAT A;  3PKD A;  1R5H A;  3FMR A;  4PV4 A;  4A6W A;  2DFI A;  2IW2 A;  2EVC A;  1YW8 A;  3IU8 A;  1C24 A;  4U1B A;  2BWS A;  2BH3 A;  4FLJ A;  3FM3 A;  2GG7 A;  2BN7 A;  5D6F A;  5CDE A;  1WLR A;  2V3Y A;  1W7V A;  1WY2 A;  2OKN A;  2EVM A;  2GG8 A;  1W2M A;  1JAW A;  1R58 A;  2EA4 A;  2P99 A;  3TAV A;  4QR8 A;  3CB6 A;  2EA2 A;  1WBQ A;  1PV9 A;  1KQ0 A;  2OAZ A;  3IU9 A;  2BWV A;  1YW7 A;  2NQ6 A;  2GGC A;  4S2T P;  2BB7 A;  2BHA A;  3CB5 A;  5JHU A;  1WKM A;  1XGS A;  4U6J A;  4U6Z A;  5CLS A;  2GU5 A;  2GU7 A;  3BIP A;  3TB5 A;  2BHC A;  2V6C A;  4FO8 A;  5CIK A;  2BWX A;  5FCH A;  2EVO A;  2G6P A;  3BIT A;  4R60 A;  1M35 A;  4IDY A;  1B59 A;  4RZY A;  4U69 A;  1YW9 A;  2V3X A;  3Q6D A;  4IKU A;  2Q93 A;  1XGN A;  4RGZ 1;  4HXX A;  1QXZ A;  2B3L A;  2GZ5 A;  4U76 A;  2B3H A;  2GG9 A;  2BHB A;  4S2R P;  2BWY A;  2GG0 A;  4U75 A;  2Q95 A;  1XNZ A;  1C23 A;  5JFR A;  1Y1N A;  4JUQ A;  4EGE A;  4U73 A;  3D27 A;  1CHM A;  3IG4 A;  1QXY A;  4KM3 A;  3PKA A;  5CDV A;  2BWU A;  3L7G A;  4IKS A;  2Q96 A;  4RZZ A;  4FLI A;  1QZY A;  1KQ9 A;  1YVM A;  4IEC A;  1WL9 A;  4Z7M A;  2ADU A;  2Q8K A;  1YJ3 A;  3FMQ A;  1R5G A;  1A16 A;  2GTX A;  1N51 A;  3MR1 A;  4U6E A;  4U70 A;  2GA2 A;  4IKT A;  4IU6 A;  2B3K A;  4B28 A;  2NQ7 A;  4PNC A;  2P98 A;  1B6A A;  2GG3 A;  2Q94 A;  1O0X A;  2Q92 A;  4U6W A;  3RVA A;  2GG2 A;  5D6E A;  4U6C A;  1C22 A;  2ZSG A;  5JI6 A;  1WN1 A;  4FLL A;  2GG5 A;  4OOK A;  1XGM A;  4U71 A;  4ZWP A;  5CDL A;  4IKR A;  4ZNG A;  2BWW A;  2GU6 A;  4IF7 A;  3PKB A;  1QXW A;  3MX6 A;  1WL6 A;  4FO7 A;  4FKC A;  5CNX A;  3ROR A;  1BOA A;  1C27 A;  4S00 A;  5E5B A;  2MAT A;  4ZWU A;  2HOW A;  1C21 A;  5FCF A; 
#chains in the Genus database with same CATH homology
 2GGB A;  2V3Z A;  2GU4 A;  4ZWO A;  5CE6 A;  3PKE A;  2BWT A;  4IPA A;  1KP0 A;  1BN5 A;  3PKC A;  2P9A A;  2BHD A;  4MAT A;  3BIQ A;  4S01 A;  4FLK A;  4A6V A;  3L24 A;  1MAT A;  3CTZ A;  4FUK A;  3IU7 A;  3S6B A;  1XGO A;  3MAT A;  3PKD A;  1R5H A;  3FMR A;  4PV4 A;  4A6W A;  2DFI A;  2IW2 A;  2EVC A;  1YW8 A;  3IU8 A;  1C24 A;  4U1B A;  2BWS A;  2BH3 A;  4FLJ A;  3FM3 A;  2GG7 A;  2BN7 A;  5D6F A;  5CDE A;  1WLR A;  2V3Y A;  1W7V A;  1WY2 A;  2OKN A;  2EVM A;  2GG8 A;  1W2M A;  1JAW A;  1R58 A;  2EA4 A;  2P99 A;  3TAV A;  4QR8 A;  3CB6 A;  2EA2 A;  1WBQ A;  1PV9 A;  1KQ0 A;  2OAZ A;  3IU9 A;  2BWV A;  1YW7 A;  2NQ6 A;  2GGC A;  4S2T P;  2BB7 A;  2BHA A;  3CB5 A;  5JHU A;  1WKM A;  1XGS A;  4U6J A;  4U6Z A;  5CLS A;  2GU5 A;  2GU7 A;  3BIP A;  3TB5 A;  2BHC A;  2V6C A;  4FO8 A;  5CIK A;  2BWX A;  5FCH A;  2EVO A;  2G6P A;  3BIT A;  4R60 A;  1M35 A;  4IDY A;  1B59 A;  4RZY A;  4U69 A;  1YW9 A;  2V3X A;  3Q6D A;  4IKU A;  2Q93 A;  1XGN A;  4RGZ 1;  4HXX A;  1QXZ A;  2B3L A;  2GZ5 A;  4U76 A;  2B3H A;  2GG9 A;  2BHB A;  4S2R P;  2BWY A;  2GG0 A;  4U75 A;  2Q95 A;  1XNZ A;  1C23 A;  5JFR A;  1Y1N A;  4JUQ A;  4EGE A;  4U73 A;  3D27 A;  1CHM A;  3IG4 A;  1QXY A;  4KM3 A;  3PKA A;  5CDV A;  2BWU A;  3L7G A;  4IKS A;  2Q96 A;  4RZZ A;  4FLI A;  1QZY A;  1KQ9 A;  1YVM A;  4IEC A;  1WL9 A;  4Z7M A;  2ADU A;  2Q8K A;  1YJ3 A;  3FMQ A;  1R5G A;  1A16 A;  2GTX A;  1N51 A;  3MR1 A;  4U6E A;  4U70 A;  2GA2 A;  4IKT A;  4IU6 A;  2B3K A;  4B28 A;  2NQ7 A;  4PNC A;  2P98 A;  1B6A A;  2GG3 A;  2Q94 A;  1O0X A;  2Q92 A;  4U6W A;  3RVA A;  2GG2 A;  5D6E A;  4U6C A;  1C22 A;  2ZSG A;  5JI6 A;  1WN1 A;  4FLL A;  2GG5 A;  4OOK A;  1XGM A;  4U71 A;  4ZWP A;  5CDL A;  4IKR A;  4ZNG A;  2BWW A;  2GU6 A;  4IF7 A;  3PKB A;  1QXW A;  3MX6 A;  1WL6 A;  4FO7 A;  4FKC A;  5CNX A;  3ROR A;  1BOA A;  1C27 A;  4S00 A;  5E5B A;  2MAT A;  4ZWU A;  2HOW A;  1C21 A;  5FCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...