4IKUA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with 2-((5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)amino)-3-phenylpropanamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
molecule tags Hydrolase
source organism Homo sapiens
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4ikuA00
2EA2A 1W7VA 3PKEA 4S2TP 1WL6A 1YW9A 5CDVA 2V3YA 1C27A 2BHBA 2GU7A 2P9AA 2BN7A 5CDLA 3BIQA 3CB6A 2MATA 4ZWOA 2NQ6A 4FO7A 3RORA 2BWWA 4PV4A 2IW2A 4HXXA 4RZYA 2BWSA 3IU7A 4PNCA 4U1BA 2P99A 3L7GA 2GG2A 4IU6A 4B28A 2HOWA 2BWVA 1YJ3A 2Q94A 3D27A 3MR1A 2GA2A 3L24A 4S01A 2B3KA 5CLSA 1C24A 4U6EA 3FM3A 4IPAA 5JFRA 4U6CA 4FLKA 1C23A 1WN1A 2V6CA 2GG3A 4IKUA 3TAVA 4A6WA 3MX6A 4OOKA 2G6PA 1QXYA 1YW7A 1M35A 3PKBA 4U76A 5D6FA 2ZSGA 3BITA 1YVMA 4FKCA 5CDEA 2BWXA 2BH3A 1R58A 5CIKA 2Q8KA 1PV9A 1BN5A 5D6EA 1C22A 2B3LA 4A6VA 2Q95A 4ZNGA 2EVCA 2V3ZA 2GG8A 2BWYA 3IU8A 4FLIA 2Q93A 4FLJA 5CNXA 3CTZA 1BOAA 1B6AA 1QXWA 2EVMA 2P98A 3PKDA 2BWUA 1XNZA 2OAZA 3PKCA 1KQ0A 5FCFA 5CE6A 1QXZA 1MATA 1O0XA 1WBQA 1XGOA 4JUQA 4S2RP 4U71A 4ZWUA 2Q92A 1CHMA 1WKMA 1C21A 2GU6A 1WY2A 2BHDA 4MATA 3FMQA 3FMRA 2GG9A 4KM3A 1R5HA 1YW8A 2BB7A 2Q96A 4FO8A 1XGNA 4IECA 3IU9A 4U6JA 4U6WA 3PKAA 1XGSA 3RVAA 4EGEA 1R5GA 4FLLA 2OKNA 4R60A 2GG7A 2V3XA 4IKRA 4ZWPA 2B3HA 4QR8A 4RZZA 4IF7A 1QZYA 4S00A 3BIPA 1W2MA 2GGBA 2GU4A 3S6BA 4U70A 3CB5A 5E5BA 2GZ5A 3TB5A 2GG5A 4U6ZA 2GU5A 2BWTA 2GTXA 2NQ7A 1A16A 1WL9A 3Q6DA 1KP0A 1Y1NA 1KQ9A 4U75A 4IKTA 2DFIA 2GGCA 1N51A 2GG0A 4Z7MA 3IG4A 5JI6A 2BHAA 4FUKA 4RGZ1 4IDYA 2EA4A 1XGMA 4U69A 1JAWA 2BHCA 4IKSA 4U73A 2EVOA 1B59A 5JHUA 2ADUA 1WLRA 5FCHA 3MATA
chains in the Genus database with same CATH superfamily
2EA2A 1W7VA 3PKEA 4S2TP 1WL6A 1YW9A 5CDVA 2V3YA 1C27A 2BHBA 2GU7A 2P9AA 2BN7A 5CDLA 3BIQA 3CB6A 2MATA 4ZWOA 2NQ6A 4FO7A 3RORA 2BWWA 4PV4A 2IW2A 4HXXA 4RZYA 2BWSA 3IU7A 4PNCA 4U1BA 2P99A 3L7GA 2GG2A 4IU6A 4B28A 2HOWA 2BWVA 1YJ3A 2Q94A 3D27A 3MR1A 2GA2A 3L24A 4S01A 2B3KA 5CLSA 1C24A 4U6EA 3FM3A 4IPAA 5JFRA 4U6CA 4FLKA 1C23A 1WN1A 2V6CA 2GG3A 4IKUA 3TAVA 4A6WA 3MX6A 4OOKA 2G6PA 1QXYA 1YW7A 1M35A 3PKBA 4U76A 5D6FA 2ZSGA 3BITA 1YVMA 4FKCA 5CDEA 2BWXA 2BH3A 1R58A 5CIKA 2Q8KA 1PV9A 1BN5A 5D6EA 1C22A 2B3LA 4A6VA 2Q95A 4ZNGA 2EVCA 2V3ZA 2GG8A 2BWYA 3IU8A 4FLIA 2Q93A 4FLJA 5CNXA 3CTZA 1BOAA 1B6AA 1QXWA 2EVMA 2P98A 3PKDA 2BWUA 1XNZA 2OAZA 3PKCA 1KQ0A 5FCFA 5CE6A 1QXZA 1MATA 1O0XA 1WBQA 1XGOA 4JUQA 4S2RP 4U71A 4ZWUA 2Q92A 1CHMA 1WKMA 1C21A 2GU6A 1WY2A 2BHDA 4MATA 3FMQA 3FMRA 2GG9A 4KM3A 1R5HA 1YW8A 2BB7A 2Q96A 4FO8A 1XGNA 4IECA 3IU9A 4U6JA 4U6WA 3PKAA 1XGSA 3RVAA 4EGEA 1R5GA 4FLLA 2OKNA 4R60A 2GG7A 2V3XA 4IKRA 4ZWPA 2B3HA 4QR8A 4RZZA 4IF7A 1QZYA 4S00A 3BIPA 1W2MA 2GGBA 2GU4A 3S6BA 4U70A 3CB5A 5E5BA 2GZ5A 3TB5A 2GG5A 4U6ZA 2GU5A 2BWTA 2GTXA 2NQ7A 1A16A 1WL9A 3Q6DA 1KP0A 1Y1NA 1KQ9A 4U75A 4IKTA 2DFIA 2GGCA 1N51A 2GG0A 4Z7MA 3IG4A 5JI6A 2BHAA 4FUKA 4RGZ1 4IDYA 2EA4A 1XGMA 4U69A 1JAWA 2BHCA 4IKSA 4U73A 2EVOA 1B59A 5JHUA 2ADUA 1WLRA 5FCHA 3MATA
chains in the Genus database with same CATH topology
2EA2A 1W7VA 3PKEA 4S2TP 1WL6A 1YW9A 5CDVA 2V3YA 1C27A 2BHBA 2GU7A 2P9AA 2BN7A 5CDLA 3BIQA 3CB6A 2MATA 4ZWOA 2NQ6A 4FO7A 3RORA 2BWWA 4PV4A 2IW2A 4HXXA 4RZYA 2BWSA 3IU7A 4PNCA 4U1BA 2P99A 3L7GA 2GG2A 4IU6A 4B28A 2HOWA 2BWVA 1YJ3A 2Q94A 3D27A 3MR1A 2GA2A 3L24A 4S01A 2B3KA 5CLSA 1C24A 4U6EA 3FM3A 4IPAA 5JFRA 4U6CA 4FLKA 1C23A 1WN1A 2V6CA 2GG3A 4IKUA 3TAVA 4A6WA 3MX6A 4OOKA 2G6PA 1QXYA 1YW7A 1M35A 3PKBA 4U76A 5D6FA 2ZSGA 3BITA 1YVMA 4FKCA 5CDEA 2BWXA 2BH3A 1R58A 5CIKA 2Q8KA 1PV9A 1BN5A 5D6EA 1C22A 2B3LA 4A6VA 2Q95A 4ZNGA 2EVCA 2V3ZA 2GG8A 2BWYA 3IU8A 4FLIA 2Q93A 4FLJA 5CNXA 3CTZA 1BOAA 1B6AA 1QXWA 2EVMA 2P98A 3PKDA 2BWUA 1XNZA 2OAZA 3PKCA 1KQ0A 5FCFA 5CE6A 1QXZA 1MATA 1O0XA 1WBQA 1XGOA 4JUQA 4S2RP 4U71A 4ZWUA 2Q92A 1CHMA 1WKMA 1C21A 2GU6A 1WY2A 2BHDA 4MATA 3FMQA 3FMRA 2GG9A 4KM3A 1R5HA 1YW8A 2BB7A 2Q96A 4FO8A 1XGNA 4IECA 3IU9A 4U6JA 4U6WA 3PKAA 1XGSA 3RVAA 4EGEA 1R5GA 4FLLA 2OKNA 4R60A 2GG7A 2V3XA 4IKRA 4ZWPA 2B3HA 4QR8A 4RZZA 4IF7A 1QZYA 4S00A 3BIPA 1W2MA 2GGBA 2GU4A 3S6BA 4U70A 3CB5A 5E5BA 2GZ5A 3TB5A 2GG5A 4U6ZA 2GU5A 2BWTA 2GTXA 2NQ7A 1A16A 1WL9A 3Q6DA 1KP0A 1Y1NA 1KQ9A 4U75A 4IKTA 2DFIA 2GGCA 1N51A 2GG0A 4Z7MA 3IG4A 5JI6A 2BHAA 4FUKA 4RGZ1 4IDYA 2EA4A 1XGMA 4U69A 1JAWA 2BHCA 4IKSA 4U73A 2EVOA 1B59A 5JHUA 2ADUA 1WLRA 5FCHA 3MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA2 A;  1W7V A;  3PKE A;  4S2T P;  1WL6 A;  1YW9 A;  5CDV A;  2V3Y A;  1C27 A;  2BHB A;  2GU7 A;  2P9A A;  2BN7 A;  5CDL A;  3BIQ A;  3CB6 A;  2MAT A;  4ZWO A;  2NQ6 A;  4FO7 A;  3ROR A;  2BWW A;  4PV4 A;  2IW2 A;  4HXX A;  4RZY A;  2BWS A;  3IU7 A;  4PNC A;  4U1B A;  2P99 A;  3L7G A;  2GG2 A;  4IU6 A;  4B28 A;  2HOW A;  2BWV A;  1YJ3 A;  2Q94 A;  3D27 A;  3MR1 A;  2GA2 A;  3L24 A;  4S01 A;  2B3K A;  5CLS A;  1C24 A;  4U6E A;  3FM3 A;  4IPA A;  5JFR A;  4U6C A;  4FLK A;  1C23 A;  1WN1 A;  2V6C A;  2GG3 A;  4IKU A;  3TAV A;  4A6W A;  3MX6 A;  4OOK A;  2G6P A;  1QXY A;  1YW7 A;  1M35 A;  3PKB A;  4U76 A;  5D6F A;  2ZSG A;  3BIT A;  1YVM A;  4FKC A;  5CDE A;  2BWX A;  2BH3 A;  1R58 A;  5CIK A;  2Q8K A;  1PV9 A;  1BN5 A;  5D6E A;  1C22 A;  2B3L A;  4A6V A;  2Q95 A;  4ZNG A;  2EVC A;  2V3Z A;  2GG8 A;  2BWY A;  3IU8 A;  4FLI A;  2Q93 A;  4FLJ A;  5CNX A;  3CTZ A;  1BOA A;  1B6A A;  1QXW A;  2EVM A;  2P98 A;  3PKD A;  2BWU A;  1XNZ A;  2OAZ A;  3PKC A;  1KQ0 A;  5FCF A;  5CE6 A;  1QXZ A;  1MAT A;  1O0X A;  1WBQ A;  1XGO A;  4JUQ A;  4S2R P;  4U71 A;  4ZWU A;  2Q92 A;  1CHM A;  1WKM A;  1C21 A;  2GU6 A;  1WY2 A;  2BHD A;  4MAT A;  3FMQ A;  3FMR A;  2GG9 A;  4KM3 A;  1R5H A;  1YW8 A;  2BB7 A;  2Q96 A;  4FO8 A;  1XGN A;  4IEC A;  3IU9 A;  4U6J A;  4U6W A;  3PKA A;  1XGS A;  3RVA A;  4EGE A;  1R5G A;  4FLL A;  2OKN A;  4R60 A;  2GG7 A;  2V3X A;  4IKR A;  4ZWP A;  2B3H A;  4QR8 A;  4RZZ A;  4IF7 A;  1QZY A;  4S00 A;  3BIP A;  1W2M A;  2GGB A;  2GU4 A;  3S6B A;  4U70 A;  3CB5 A;  5E5B A;  2GZ5 A;  3TB5 A;  2GG5 A;  4U6Z A;  2GU5 A;  2BWT A;  2GTX A;  2NQ7 A;  1A16 A;  1WL9 A;  3Q6D A;  1KP0 A;  1Y1N A;  1KQ9 A;  4U75 A;  4IKT A;  2DFI A;  2GGC A;  1N51 A;  2GG0 A;  4Z7M A;  3IG4 A;  5JI6 A;  2BHA A;  4FUK A;  4RGZ 1;  4IDY A;  2EA4 A;  1XGM A;  4U69 A;  1JAW A;  2BHC A;  4IKS A;  4U73 A;  2EVO A;  1B59 A;  5JHU A;  2ADU A;  1WLR A;  5FCH A;  3MAT A; 
#chains in the Genus database with same CATH topology
 2EA2 A;  1W7V A;  3PKE A;  4S2T P;  1WL6 A;  1YW9 A;  5CDV A;  2V3Y A;  1C27 A;  2BHB A;  2GU7 A;  2P9A A;  2BN7 A;  5CDL A;  3BIQ A;  3CB6 A;  2MAT A;  4ZWO A;  2NQ6 A;  4FO7 A;  3ROR A;  2BWW A;  4PV4 A;  2IW2 A;  4HXX A;  4RZY A;  2BWS A;  3IU7 A;  4PNC A;  4U1B A;  2P99 A;  3L7G A;  2GG2 A;  4IU6 A;  4B28 A;  2HOW A;  2BWV A;  1YJ3 A;  2Q94 A;  3D27 A;  3MR1 A;  2GA2 A;  3L24 A;  4S01 A;  2B3K A;  5CLS A;  1C24 A;  4U6E A;  3FM3 A;  4IPA A;  5JFR A;  4U6C A;  4FLK A;  1C23 A;  1WN1 A;  2V6C A;  2GG3 A;  4IKU A;  3TAV A;  4A6W A;  3MX6 A;  4OOK A;  2G6P A;  1QXY A;  1YW7 A;  1M35 A;  3PKB A;  4U76 A;  5D6F A;  2ZSG A;  3BIT A;  1YVM A;  4FKC A;  5CDE A;  2BWX A;  2BH3 A;  1R58 A;  5CIK A;  2Q8K A;  1PV9 A;  1BN5 A;  5D6E A;  1C22 A;  2B3L A;  4A6V A;  2Q95 A;  4ZNG A;  2EVC A;  2V3Z A;  2GG8 A;  2BWY A;  3IU8 A;  4FLI A;  2Q93 A;  4FLJ A;  5CNX A;  3CTZ A;  1BOA A;  1B6A A;  1QXW A;  2EVM A;  2P98 A;  3PKD A;  2BWU A;  1XNZ A;  2OAZ A;  3PKC A;  1KQ0 A;  5FCF A;  5CE6 A;  1QXZ A;  1MAT A;  1O0X A;  1WBQ A;  1XGO A;  4JUQ A;  4S2R P;  4U71 A;  4ZWU A;  2Q92 A;  1CHM A;  1WKM A;  1C21 A;  2GU6 A;  1WY2 A;  2BHD A;  4MAT A;  3FMQ A;  3FMR A;  2GG9 A;  4KM3 A;  1R5H A;  1YW8 A;  2BB7 A;  2Q96 A;  4FO8 A;  1XGN A;  4IEC A;  3IU9 A;  4U6J A;  4U6W A;  3PKA A;  1XGS A;  3RVA A;  4EGE A;  1R5G A;  4FLL A;  2OKN A;  4R60 A;  2GG7 A;  2V3X A;  4IKR A;  4ZWP A;  2B3H A;  4QR8 A;  4RZZ A;  4IF7 A;  1QZY A;  4S00 A;  3BIP A;  1W2M A;  2GGB A;  2GU4 A;  3S6B A;  4U70 A;  3CB5 A;  5E5B A;  2GZ5 A;  3TB5 A;  2GG5 A;  4U6Z A;  2GU5 A;  2BWT A;  2GTX A;  2NQ7 A;  1A16 A;  1WL9 A;  3Q6D A;  1KP0 A;  1Y1N A;  1KQ9 A;  4U75 A;  4IKT A;  2DFI A;  2GGC A;  1N51 A;  2GG0 A;  4Z7M A;  3IG4 A;  5JI6 A;  2BHA A;  4FUK A;  4RGZ 1;  4IDY A;  2EA4 A;  1XGM A;  4U69 A;  1JAW A;  2BHC A;  4IKS A;  4U73 A;  2EVO A;  1B59 A;  5JHU A;  2ADU A;  1WLR A;  5FCH A;  3MAT A; 
#chains in the Genus database with same CATH homology
 2EA2 A;  1W7V A;  3PKE A;  4S2T P;  1WL6 A;  1YW9 A;  5CDV A;  2V3Y A;  1C27 A;  2BHB A;  2GU7 A;  2P9A A;  2BN7 A;  5CDL A;  3BIQ A;  3CB6 A;  2MAT A;  4ZWO A;  2NQ6 A;  4FO7 A;  3ROR A;  2BWW A;  4PV4 A;  2IW2 A;  4HXX A;  4RZY A;  2BWS A;  3IU7 A;  4PNC A;  4U1B A;  2P99 A;  3L7G A;  2GG2 A;  4IU6 A;  4B28 A;  2HOW A;  2BWV A;  1YJ3 A;  2Q94 A;  3D27 A;  3MR1 A;  2GA2 A;  3L24 A;  4S01 A;  2B3K A;  5CLS A;  1C24 A;  4U6E A;  3FM3 A;  4IPA A;  5JFR A;  4U6C A;  4FLK A;  1C23 A;  1WN1 A;  2V6C A;  2GG3 A;  4IKU A;  3TAV A;  4A6W A;  3MX6 A;  4OOK A;  2G6P A;  1QXY A;  1YW7 A;  1M35 A;  3PKB A;  4U76 A;  5D6F A;  2ZSG A;  3BIT A;  1YVM A;  4FKC A;  5CDE A;  2BWX A;  2BH3 A;  1R58 A;  5CIK A;  2Q8K A;  1PV9 A;  1BN5 A;  5D6E A;  1C22 A;  2B3L A;  4A6V A;  2Q95 A;  4ZNG A;  2EVC A;  2V3Z A;  2GG8 A;  2BWY A;  3IU8 A;  4FLI A;  2Q93 A;  4FLJ A;  5CNX A;  3CTZ A;  1BOA A;  1B6A A;  1QXW A;  2EVM A;  2P98 A;  3PKD A;  2BWU A;  1XNZ A;  2OAZ A;  3PKC A;  1KQ0 A;  5FCF A;  5CE6 A;  1QXZ A;  1MAT A;  1O0X A;  1WBQ A;  1XGO A;  4JUQ A;  4S2R P;  4U71 A;  4ZWU A;  2Q92 A;  1CHM A;  1WKM A;  1C21 A;  2GU6 A;  1WY2 A;  2BHD A;  4MAT A;  3FMQ A;  3FMR A;  2GG9 A;  4KM3 A;  1R5H A;  1YW8 A;  2BB7 A;  2Q96 A;  4FO8 A;  1XGN A;  4IEC A;  3IU9 A;  4U6J A;  4U6W A;  3PKA A;  1XGS A;  3RVA A;  4EGE A;  1R5G A;  4FLL A;  2OKN A;  4R60 A;  2GG7 A;  2V3X A;  4IKR A;  4ZWP A;  2B3H A;  4QR8 A;  4RZZ A;  4IF7 A;  1QZY A;  4S00 A;  3BIP A;  1W2M A;  2GGB A;  2GU4 A;  3S6B A;  4U70 A;  3CB5 A;  5E5B A;  2GZ5 A;  3TB5 A;  2GG5 A;  4U6Z A;  2GU5 A;  2BWT A;  2GTX A;  2NQ7 A;  1A16 A;  1WL9 A;  3Q6D A;  1KP0 A;  1Y1N A;  1KQ9 A;  4U75 A;  4IKT A;  2DFI A;  2GGC A;  1N51 A;  2GG0 A;  4Z7M A;  3IG4 A;  5JI6 A;  2BHA A;  4FUK A;  4RGZ 1;  4IDY A;  2EA4 A;  1XGM A;  4U69 A;  1JAW A;  2BHC A;  4IKS A;  4U73 A;  2EVO A;  1B59 A;  5JHU A;  2ADU A;  1WLR A;  5FCH A;  3MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...