4IKUA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with 2-((5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)amino)-3-phenylpropanamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4ikuA00
1QXWA 3RVAA 4JUQA 3IG4A 3CTZA 1WBQA 4U75A 4QR8A 3FMRA 1M35A 4ZWOA 2BWVA 2EA2A 3D27A 5CDEA 4FLJA 4IF7A 2IW2A 5JFRA 4IKTA 4U1BA 4ZNGA 5D6EA 5E5BA 5CDVA 1QXYA 1B59A 2GG7A 4IPAA 2BB7A 4IKSA 1W2MA 2V3YA 1B6AA 2ADUA 4U70A 1R5GA 2Q8KA 4FUKA 1KQ9A 3RORA 4S2TP 4U6JA 4FLIA 4S2RP 5CDLA 3MR1A 3PKAA 2BWSA 1Y1NA 2EA4A 2GU4A 3FM3A 4PV4A 2B3KA 1YW8A 3L7GA 1PV9A 4HXXA 4EGEA 2P99A 2BHAA 3S6BA 5CIKA 3CB6A 1XGOA 4RZZA 2Q96A 3PKBA 4IDYA 3MATA 1QXZA 1YW7A 2NQ7A 2P9AA 2V6CA 3L24A 4S01A 2OAZA 4S00A 1WL6A 4U76A 2P98A 2BWXA 2BWTA 2V3XA 1XGMA 1C22A 3PKDA 4FLKA 2GTXA 1KQ0A 2BHBA 2GU7A 3Q6DA 4IKRA 1N51A 5CNXA 2MATA 4U71A 2B3HA 1QZYA 5JI6A 1C24A 2GGCA 4FKCA 3CB5A 4FO8A 1C21A 2BHCA 3PKEA 5FCFA 4U69A 1YVMA 2GG8A 2EVMA 3FMQA 4A6VA 2EVCA 2EVOA 2NQ6A 4MATA 2Q94A 1W7VA 2Q95A 3BIQA 1XGSA 2GG5A 3TB5A 4IU6A 2GZ5A 2ZSGA 5FCHA 2BWUA 3BITA 4FO7A 1R58A 2BHDA 4ZWUA 2GU5A 4R60A 4A6WA 3MX6A 3BIPA 1BOAA 2V3ZA 4U6EA 1WLRA 1XNZA 4FLLA 4RZYA 3IU7A 2G6PA 2GG2A 5JHUA 1CHMA 1YW9A 2BN7A 2GGBA 3IU9A 5D6FA 2Q93A 4U6WA 1YJ3A 2GG0A 2OKNA 3PKCA 1MATA 1WL9A 1O0XA 1WN1A 4PNCA 4B28A 2BWWA 4U6CA 4OOKA 1R5HA 2B3LA 2GU6A 3IU8A 2BH3A 2GG9A 1WY2A 1C27A 4IECA 1JAWA 1BN5A 3TAVA 1XGNA 2Q92A 2HOWA 4U6ZA 1C23A 4KM3A 2GA2A 1A16A 4U73A 2BWYA 4IKUA 4Z7MA 1WKMA 2GG3A 4RGZ1 5CLSA 5CE6A 1KP0A 4ZWPA 2DFIA
chains in the Genus database with same CATH superfamily
1QXWA 3RVAA 4JUQA 3IG4A 3CTZA 1WBQA 4U75A 4QR8A 3FMRA 1M35A 4ZWOA 2BWVA 2EA2A 3D27A 5CDEA 4FLJA 4IF7A 2IW2A 5JFRA 4IKTA 4U1BA 4ZNGA 5D6EA 5E5BA 5CDVA 1QXYA 1B59A 2GG7A 4IPAA 2BB7A 4IKSA 1W2MA 2V3YA 1B6AA 2ADUA 4U70A 1R5GA 2Q8KA 4FUKA 1KQ9A 3RORA 4S2TP 4U6JA 4FLIA 4S2RP 5CDLA 3MR1A 3PKAA 2BWSA 1Y1NA 2EA4A 2GU4A 3FM3A 4PV4A 2B3KA 1YW8A 3L7GA 1PV9A 4HXXA 4EGEA 2P99A 2BHAA 3S6BA 5CIKA 3CB6A 1XGOA 4RZZA 2Q96A 3PKBA 4IDYA 3MATA 1QXZA 1YW7A 2NQ7A 2P9AA 2V6CA 3L24A 4S01A 2OAZA 4S00A 1WL6A 4U76A 2P98A 2BWXA 2BWTA 2V3XA 1XGMA 1C22A 3PKDA 4FLKA 2GTXA 1KQ0A 2BHBA 2GU7A 3Q6DA 4IKRA 1N51A 5CNXA 2MATA 4U71A 2B3HA 1QZYA 5JI6A 1C24A 2GGCA 4FKCA 3CB5A 4FO8A 1C21A 2BHCA 3PKEA 5FCFA 4U69A 1YVMA 2GG8A 2EVMA 3FMQA 4A6VA 2EVCA 2EVOA 2NQ6A 4MATA 2Q94A 1W7VA 2Q95A 3BIQA 1XGSA 2GG5A 3TB5A 4IU6A 2GZ5A 2ZSGA 5FCHA 2BWUA 3BITA 4FO7A 1R58A 2BHDA 4ZWUA 2GU5A 4R60A 4A6WA 3MX6A 3BIPA 1BOAA 2V3ZA 4U6EA 1WLRA 1XNZA 4FLLA 4RZYA 3IU7A 2G6PA 2GG2A 5JHUA 1CHMA 1YW9A 2BN7A 2GGBA 3IU9A 5D6FA 2Q93A 4U6WA 1YJ3A 2GG0A 2OKNA 3PKCA 1MATA 1WL9A 1O0XA 1WN1A 4PNCA 4B28A 2BWWA 4U6CA 4OOKA 1R5HA 2B3LA 2GU6A 3IU8A 2BH3A 2GG9A 1WY2A 1C27A 4IECA 1JAWA 1BN5A 3TAVA 1XGNA 2Q92A 2HOWA 4U6ZA 1C23A 4KM3A 2GA2A 1A16A 4U73A 2BWYA 4IKUA 4Z7MA 1WKMA 2GG3A 4RGZ1 5CLSA 5CE6A 1KP0A 4ZWPA 2DFIA
chains in the Genus database with same CATH topology
1QXWA 3RVAA 4JUQA 3IG4A 3CTZA 1WBQA 4U75A 4QR8A 3FMRA 1M35A 4ZWOA 2BWVA 2EA2A 3D27A 5CDEA 4FLJA 4IF7A 2IW2A 5JFRA 4IKTA 4U1BA 4ZNGA 5D6EA 5E5BA 5CDVA 1QXYA 1B59A 2GG7A 4IPAA 2BB7A 4IKSA 1W2MA 2V3YA 1B6AA 2ADUA 4U70A 1R5GA 2Q8KA 4FUKA 1KQ9A 3RORA 4S2TP 4U6JA 4FLIA 4S2RP 5CDLA 3MR1A 3PKAA 2BWSA 1Y1NA 2EA4A 2GU4A 3FM3A 4PV4A 2B3KA 1YW8A 3L7GA 1PV9A 4HXXA 4EGEA 2P99A 2BHAA 3S6BA 5CIKA 3CB6A 1XGOA 4RZZA 2Q96A 3PKBA 4IDYA 3MATA 1QXZA 1YW7A 2NQ7A 2P9AA 2V6CA 3L24A 4S01A 2OAZA 4S00A 1WL6A 4U76A 2P98A 2BWXA 2BWTA 2V3XA 1XGMA 1C22A 3PKDA 4FLKA 2GTXA 1KQ0A 2BHBA 2GU7A 3Q6DA 4IKRA 1N51A 5CNXA 2MATA 4U71A 2B3HA 1QZYA 5JI6A 1C24A 2GGCA 4FKCA 3CB5A 4FO8A 1C21A 2BHCA 3PKEA 5FCFA 4U69A 1YVMA 2GG8A 2EVMA 3FMQA 4A6VA 2EVCA 2EVOA 2NQ6A 4MATA 2Q94A 1W7VA 2Q95A 3BIQA 1XGSA 2GG5A 3TB5A 4IU6A 2GZ5A 2ZSGA 5FCHA 2BWUA 3BITA 4FO7A 1R58A 2BHDA 4ZWUA 2GU5A 4R60A 4A6WA 3MX6A 3BIPA 1BOAA 2V3ZA 4U6EA 1WLRA 1XNZA 4FLLA 4RZYA 3IU7A 2G6PA 2GG2A 5JHUA 1CHMA 1YW9A 2BN7A 2GGBA 3IU9A 5D6FA 2Q93A 4U6WA 1YJ3A 2GG0A 2OKNA 3PKCA 1MATA 1WL9A 1O0XA 1WN1A 4PNCA 4B28A 2BWWA 4U6CA 4OOKA 1R5HA 2B3LA 2GU6A 3IU8A 2BH3A 2GG9A 1WY2A 1C27A 4IECA 1JAWA 1BN5A 3TAVA 1XGNA 2Q92A 2HOWA 4U6ZA 1C23A 4KM3A 2GA2A 1A16A 4U73A 2BWYA 4IKUA 4Z7MA 1WKMA 2GG3A 4RGZ1 5CLSA 5CE6A 1KP0A 4ZWPA 2DFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXW A;  3RVA A;  4JUQ A;  3IG4 A;  3CTZ A;  1WBQ A;  4U75 A;  4QR8 A;  3FMR A;  1M35 A;  4ZWO A;  2BWV A;  2EA2 A;  3D27 A;  5CDE A;  4FLJ A;  4IF7 A;  2IW2 A;  5JFR A;  4IKT A;  4U1B A;  4ZNG A;  5D6E A;  5E5B A;  5CDV A;  1QXY A;  1B59 A;  2GG7 A;  4IPA A;  2BB7 A;  4IKS A;  1W2M A;  2V3Y A;  1B6A A;  2ADU A;  4U70 A;  1R5G A;  2Q8K A;  4FUK A;  1KQ9 A;  3ROR A;  4S2T P;  4U6J A;  4FLI A;  4S2R P;  5CDL A;  3MR1 A;  3PKA A;  2BWS A;  1Y1N A;  2EA4 A;  2GU4 A;  3FM3 A;  4PV4 A;  2B3K A;  1YW8 A;  3L7G A;  1PV9 A;  4HXX A;  4EGE A;  2P99 A;  2BHA A;  3S6B A;  5CIK A;  3CB6 A;  1XGO A;  4RZZ A;  2Q96 A;  3PKB A;  4IDY A;  3MAT A;  1QXZ A;  1YW7 A;  2NQ7 A;  2P9A A;  2V6C A;  3L24 A;  4S01 A;  2OAZ A;  4S00 A;  1WL6 A;  4U76 A;  2P98 A;  2BWX A;  2BWT A;  2V3X A;  1XGM A;  1C22 A;  3PKD A;  4FLK A;  2GTX A;  1KQ0 A;  2BHB A;  2GU7 A;  3Q6D A;  4IKR A;  1N51 A;  5CNX A;  2MAT A;  4U71 A;  2B3H A;  1QZY A;  5JI6 A;  1C24 A;  2GGC A;  4FKC A;  3CB5 A;  4FO8 A;  1C21 A;  2BHC A;  3PKE A;  5FCF A;  4U69 A;  1YVM A;  2GG8 A;  2EVM A;  3FMQ A;  4A6V A;  2EVC A;  2EVO A;  2NQ6 A;  4MAT A;  2Q94 A;  1W7V A;  2Q95 A;  3BIQ A;  1XGS A;  2GG5 A;  3TB5 A;  4IU6 A;  2GZ5 A;  2ZSG A;  5FCH A;  2BWU A;  3BIT A;  4FO7 A;  1R58 A;  2BHD A;  4ZWU A;  2GU5 A;  4R60 A;  4A6W A;  3MX6 A;  3BIP A;  1BOA A;  2V3Z A;  4U6E A;  1WLR A;  1XNZ A;  4FLL A;  4RZY A;  3IU7 A;  2G6P A;  2GG2 A;  5JHU A;  1CHM A;  1YW9 A;  2BN7 A;  2GGB A;  3IU9 A;  5D6F A;  2Q93 A;  4U6W A;  1YJ3 A;  2GG0 A;  2OKN A;  3PKC A;  1MAT A;  1WL9 A;  1O0X A;  1WN1 A;  4PNC A;  4B28 A;  2BWW A;  4U6C A;  4OOK A;  1R5H A;  2B3L A;  2GU6 A;  3IU8 A;  2BH3 A;  2GG9 A;  1WY2 A;  1C27 A;  4IEC A;  1JAW A;  1BN5 A;  3TAV A;  1XGN A;  2Q92 A;  2HOW A;  4U6Z A;  1C23 A;  4KM3 A;  2GA2 A;  1A16 A;  4U73 A;  2BWY A;  4IKU A;  4Z7M A;  1WKM A;  2GG3 A;  4RGZ 1;  5CLS A;  5CE6 A;  1KP0 A;  4ZWP A;  2DFI A; 
#chains in the Genus database with same CATH topology
 1QXW A;  3RVA A;  4JUQ A;  3IG4 A;  3CTZ A;  1WBQ A;  4U75 A;  4QR8 A;  3FMR A;  1M35 A;  4ZWO A;  2BWV A;  2EA2 A;  3D27 A;  5CDE A;  4FLJ A;  4IF7 A;  2IW2 A;  5JFR A;  4IKT A;  4U1B A;  4ZNG A;  5D6E A;  5E5B A;  5CDV A;  1QXY A;  1B59 A;  2GG7 A;  4IPA A;  2BB7 A;  4IKS A;  1W2M A;  2V3Y A;  1B6A A;  2ADU A;  4U70 A;  1R5G A;  2Q8K A;  4FUK A;  1KQ9 A;  3ROR A;  4S2T P;  4U6J A;  4FLI A;  4S2R P;  5CDL A;  3MR1 A;  3PKA A;  2BWS A;  1Y1N A;  2EA4 A;  2GU4 A;  3FM3 A;  4PV4 A;  2B3K A;  1YW8 A;  3L7G A;  1PV9 A;  4HXX A;  4EGE A;  2P99 A;  2BHA A;  3S6B A;  5CIK A;  3CB6 A;  1XGO A;  4RZZ A;  2Q96 A;  3PKB A;  4IDY A;  3MAT A;  1QXZ A;  1YW7 A;  2NQ7 A;  2P9A A;  2V6C A;  3L24 A;  4S01 A;  2OAZ A;  4S00 A;  1WL6 A;  4U76 A;  2P98 A;  2BWX A;  2BWT A;  2V3X A;  1XGM A;  1C22 A;  3PKD A;  4FLK A;  2GTX A;  1KQ0 A;  2BHB A;  2GU7 A;  3Q6D A;  4IKR A;  1N51 A;  5CNX A;  2MAT A;  4U71 A;  2B3H A;  1QZY A;  5JI6 A;  1C24 A;  2GGC A;  4FKC A;  3CB5 A;  4FO8 A;  1C21 A;  2BHC A;  3PKE A;  5FCF A;  4U69 A;  1YVM A;  2GG8 A;  2EVM A;  3FMQ A;  4A6V A;  2EVC A;  2EVO A;  2NQ6 A;  4MAT A;  2Q94 A;  1W7V A;  2Q95 A;  3BIQ A;  1XGS A;  2GG5 A;  3TB5 A;  4IU6 A;  2GZ5 A;  2ZSG A;  5FCH A;  2BWU A;  3BIT A;  4FO7 A;  1R58 A;  2BHD A;  4ZWU A;  2GU5 A;  4R60 A;  4A6W A;  3MX6 A;  3BIP A;  1BOA A;  2V3Z A;  4U6E A;  1WLR A;  1XNZ A;  4FLL A;  4RZY A;  3IU7 A;  2G6P A;  2GG2 A;  5JHU A;  1CHM A;  1YW9 A;  2BN7 A;  2GGB A;  3IU9 A;  5D6F A;  2Q93 A;  4U6W A;  1YJ3 A;  2GG0 A;  2OKN A;  3PKC A;  1MAT A;  1WL9 A;  1O0X A;  1WN1 A;  4PNC A;  4B28 A;  2BWW A;  4U6C A;  4OOK A;  1R5H A;  2B3L A;  2GU6 A;  3IU8 A;  2BH3 A;  2GG9 A;  1WY2 A;  1C27 A;  4IEC A;  1JAW A;  1BN5 A;  3TAV A;  1XGN A;  2Q92 A;  2HOW A;  4U6Z A;  1C23 A;  4KM3 A;  2GA2 A;  1A16 A;  4U73 A;  2BWY A;  4IKU A;  4Z7M A;  1WKM A;  2GG3 A;  4RGZ 1;  5CLS A;  5CE6 A;  1KP0 A;  4ZWP A;  2DFI A; 
#chains in the Genus database with same CATH homology
 1QXW A;  3RVA A;  4JUQ A;  3IG4 A;  3CTZ A;  1WBQ A;  4U75 A;  4QR8 A;  3FMR A;  1M35 A;  4ZWO A;  2BWV A;  2EA2 A;  3D27 A;  5CDE A;  4FLJ A;  4IF7 A;  2IW2 A;  5JFR A;  4IKT A;  4U1B A;  4ZNG A;  5D6E A;  5E5B A;  5CDV A;  1QXY A;  1B59 A;  2GG7 A;  4IPA A;  2BB7 A;  4IKS A;  1W2M A;  2V3Y A;  1B6A A;  2ADU A;  4U70 A;  1R5G A;  2Q8K A;  4FUK A;  1KQ9 A;  3ROR A;  4S2T P;  4U6J A;  4FLI A;  4S2R P;  5CDL A;  3MR1 A;  3PKA A;  2BWS A;  1Y1N A;  2EA4 A;  2GU4 A;  3FM3 A;  4PV4 A;  2B3K A;  1YW8 A;  3L7G A;  1PV9 A;  4HXX A;  4EGE A;  2P99 A;  2BHA A;  3S6B A;  5CIK A;  3CB6 A;  1XGO A;  4RZZ A;  2Q96 A;  3PKB A;  4IDY A;  3MAT A;  1QXZ A;  1YW7 A;  2NQ7 A;  2P9A A;  2V6C A;  3L24 A;  4S01 A;  2OAZ A;  4S00 A;  1WL6 A;  4U76 A;  2P98 A;  2BWX A;  2BWT A;  2V3X A;  1XGM A;  1C22 A;  3PKD A;  4FLK A;  2GTX A;  1KQ0 A;  2BHB A;  2GU7 A;  3Q6D A;  4IKR A;  1N51 A;  5CNX A;  2MAT A;  4U71 A;  2B3H A;  1QZY A;  5JI6 A;  1C24 A;  2GGC A;  4FKC A;  3CB5 A;  4FO8 A;  1C21 A;  2BHC A;  3PKE A;  5FCF A;  4U69 A;  1YVM A;  2GG8 A;  2EVM A;  3FMQ A;  4A6V A;  2EVC A;  2EVO A;  2NQ6 A;  4MAT A;  2Q94 A;  1W7V A;  2Q95 A;  3BIQ A;  1XGS A;  2GG5 A;  3TB5 A;  4IU6 A;  2GZ5 A;  2ZSG A;  5FCH A;  2BWU A;  3BIT A;  4FO7 A;  1R58 A;  2BHD A;  4ZWU A;  2GU5 A;  4R60 A;  4A6W A;  3MX6 A;  3BIP A;  1BOA A;  2V3Z A;  4U6E A;  1WLR A;  1XNZ A;  4FLL A;  4RZY A;  3IU7 A;  2G6P A;  2GG2 A;  5JHU A;  1CHM A;  1YW9 A;  2BN7 A;  2GGB A;  3IU9 A;  5D6F A;  2Q93 A;  4U6W A;  1YJ3 A;  2GG0 A;  2OKN A;  3PKC A;  1MAT A;  1WL9 A;  1O0X A;  1WN1 A;  4PNC A;  4B28 A;  2BWW A;  4U6C A;  4OOK A;  1R5H A;  2B3L A;  2GU6 A;  3IU8 A;  2BH3 A;  2GG9 A;  1WY2 A;  1C27 A;  4IEC A;  1JAW A;  1BN5 A;  3TAV A;  1XGN A;  2Q92 A;  2HOW A;  4U6Z A;  1C23 A;  4KM3 A;  2GA2 A;  1A16 A;  4U73 A;  2BWY A;  4IKU A;  4Z7M A;  1WKM A;  2GG3 A;  4RGZ 1;  5CLS A;  5CE6 A;  1KP0 A;  4ZWP A;  2DFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...