4IKUA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with 2-((5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)amino)-3-phenylpropanamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4ikuA00
2EVCA 1XGOA 2BHDA 4FKCA 3Q6DA 4RZZA 3CB5A 4IKUA 4ZWOA 1BN5A 5FCHA 4A6VA 1QXWA 3IU9A 1XNZA 2GG2A 1CHMA 1O0XA 2B3KA 1MATA 4U76A 1KQ9A 2EVMA 3CB6A 2GG5A 2GU5A 3IU8A 4U6WA 2GG9A 2BWWA 2GGCA 2V3ZA 4MATA 2Q8KA 2GG3A 2GG7A 4HXXA 4IPAA 2GA2A 2GU6A 2EVOA 1YVMA 2V3XA 1WY2A 1WL6A 4IKTA 4U6EA 4R60A 4FLKA 4U69A 2Q96A 3PKBA 1QXYA 2GG8A 2NQ6A 4FUKA 1C22A 3FMQA 4U75A 3TB5A 1C23A 4IKRA 4A6WA 5CIKA 2GZ5A 4RGZ1 2EA2A 1C21A 1XGNA 3MATA 4IKSA 1WN1A 5E5BA 1B6AA 2Q93A 3BITA 3CTZA 3D27A 4KM3A 4ZNGA 2EA4A 5JHUA 4OOKA 1XGSA 3L7GA 4IECA 2BWTA 3L24A 2GTXA 4S01A 4S2TP 1PV9A 2IW2A 3IU7A 4IU6A 2BWYA 4U6JA 1YW7A 3TAVA 3MR1A 1R5GA 2P9AA 2B3HA 2G6PA 2Q95A 3MX6A 5D6FA 2NQ7A 5FCFA 5CDEA 3PKEA 1QZYA 4FLJA 1YJ3A 2ZSGA 4QR8A 3FMRA 2P98A 3IG4A 4FLIA 5CDVA 2B3LA 1WKMA 4S2RP 2BWUA 4FO8A 3FM3A 2BWXA 2GG0A 2BWSA 1JAWA 2P99A 2GU7A 3RORA 4IDYA 1Y1NA 1KP0A 1YW8A 4FO7A 4U70A 2DFIA 2BH3A 1N51A 4PV4A 4U73A 3RVAA 4RZYA 2OAZA 2Q92A 5CE6A 4U6ZA 1A16A 1C24A 4FLLA 2Q94A 5JFRA 1QXZA 2V6CA 4U71A 2ADUA 1WBQA 3BIPA 1B59A 2HOWA 1WL9A 4U1BA 1R5HA 4Z7MA 2GGBA 5JI6A 4PNCA 1XGMA 2BHAA 2BB7A 4B28A 1YW9A 1R58A 2MATA 1W7VA 3PKAA 5CDLA 4S00A 2GU4A 4EGEA 1WLRA 2BN7A 3PKCA 2V3YA 3BIQA 1C27A 1KQ0A 1M35A 2OKNA 3PKDA 5CNXA 3S6BA 2BWVA 4JUQA 5CLSA 4U6CA 1BOAA 4IF7A 4ZWPA 1W2MA 5D6EA 2BHCA 4ZWUA 2BHBA
chains in the Genus database with same CATH superfamily
2EVCA 1XGOA 2BHDA 4FKCA 3Q6DA 4RZZA 3CB5A 4IKUA 4ZWOA 1BN5A 5FCHA 4A6VA 1QXWA 3IU9A 1XNZA 2GG2A 1CHMA 1O0XA 2B3KA 1MATA 4U76A 1KQ9A 2EVMA 3CB6A 2GG5A 2GU5A 3IU8A 4U6WA 2GG9A 2BWWA 2GGCA 2V3ZA 4MATA 2Q8KA 2GG3A 2GG7A 4HXXA 4IPAA 2GA2A 2GU6A 2EVOA 1YVMA 2V3XA 1WY2A 1WL6A 4IKTA 4U6EA 4R60A 4FLKA 4U69A 2Q96A 3PKBA 1QXYA 2GG8A 2NQ6A 4FUKA 1C22A 3FMQA 4U75A 3TB5A 1C23A 4IKRA 4A6WA 5CIKA 2GZ5A 4RGZ1 2EA2A 1C21A 1XGNA 3MATA 4IKSA 1WN1A 5E5BA 1B6AA 2Q93A 3BITA 3CTZA 3D27A 4KM3A 4ZNGA 2EA4A 5JHUA 4OOKA 1XGSA 3L7GA 4IECA 2BWTA 3L24A 2GTXA 4S01A 4S2TP 1PV9A 2IW2A 3IU7A 4IU6A 2BWYA 4U6JA 1YW7A 3TAVA 3MR1A 1R5GA 2P9AA 2B3HA 2G6PA 2Q95A 3MX6A 5D6FA 2NQ7A 5FCFA 5CDEA 3PKEA 1QZYA 4FLJA 1YJ3A 2ZSGA 4QR8A 3FMRA 2P98A 3IG4A 4FLIA 5CDVA 2B3LA 1WKMA 4S2RP 2BWUA 4FO8A 3FM3A 2BWXA 2GG0A 2BWSA 1JAWA 2P99A 2GU7A 3RORA 4IDYA 1Y1NA 1KP0A 1YW8A 4FO7A 4U70A 2DFIA 2BH3A 1N51A 4PV4A 4U73A 3RVAA 4RZYA 2OAZA 2Q92A 5CE6A 4U6ZA 1A16A 1C24A 4FLLA 2Q94A 5JFRA 1QXZA 2V6CA 4U71A 2ADUA 1WBQA 3BIPA 1B59A 2HOWA 1WL9A 4U1BA 1R5HA 4Z7MA 2GGBA 5JI6A 4PNCA 1XGMA 2BHAA 2BB7A 4B28A 1YW9A 1R58A 2MATA 1W7VA 3PKAA 5CDLA 4S00A 2GU4A 4EGEA 1WLRA 2BN7A 3PKCA 2V3YA 3BIQA 1C27A 1KQ0A 1M35A 2OKNA 3PKDA 5CNXA 3S6BA 2BWVA 4JUQA 5CLSA 4U6CA 1BOAA 4IF7A 4ZWPA 1W2MA 5D6EA 2BHCA 4ZWUA 2BHBA
chains in the Genus database with same CATH topology
2EVCA 1XGOA 2BHDA 4FKCA 3Q6DA 4RZZA 3CB5A 4IKUA 4ZWOA 1BN5A 5FCHA 4A6VA 1QXWA 3IU9A 1XNZA 2GG2A 1CHMA 1O0XA 2B3KA 1MATA 4U76A 1KQ9A 2EVMA 3CB6A 2GG5A 2GU5A 3IU8A 4U6WA 2GG9A 2BWWA 2GGCA 2V3ZA 4MATA 2Q8KA 2GG3A 2GG7A 4HXXA 4IPAA 2GA2A 2GU6A 2EVOA 1YVMA 2V3XA 1WY2A 1WL6A 4IKTA 4U6EA 4R60A 4FLKA 4U69A 2Q96A 3PKBA 1QXYA 2GG8A 2NQ6A 4FUKA 1C22A 3FMQA 4U75A 3TB5A 1C23A 4IKRA 4A6WA 5CIKA 2GZ5A 4RGZ1 2EA2A 1C21A 1XGNA 3MATA 4IKSA 1WN1A 5E5BA 1B6AA 2Q93A 3BITA 3CTZA 3D27A 4KM3A 4ZNGA 2EA4A 5JHUA 4OOKA 1XGSA 3L7GA 4IECA 2BWTA 3L24A 2GTXA 4S01A 4S2TP 1PV9A 2IW2A 3IU7A 4IU6A 2BWYA 4U6JA 1YW7A 3TAVA 3MR1A 1R5GA 2P9AA 2B3HA 2G6PA 2Q95A 3MX6A 5D6FA 2NQ7A 5FCFA 5CDEA 3PKEA 1QZYA 4FLJA 1YJ3A 2ZSGA 4QR8A 3FMRA 2P98A 3IG4A 4FLIA 5CDVA 2B3LA 1WKMA 4S2RP 2BWUA 4FO8A 3FM3A 2BWXA 2GG0A 2BWSA 1JAWA 2P99A 2GU7A 3RORA 4IDYA 1Y1NA 1KP0A 1YW8A 4FO7A 4U70A 2DFIA 2BH3A 1N51A 4PV4A 4U73A 3RVAA 4RZYA 2OAZA 2Q92A 5CE6A 4U6ZA 1A16A 1C24A 4FLLA 2Q94A 5JFRA 1QXZA 2V6CA 4U71A 2ADUA 1WBQA 3BIPA 1B59A 2HOWA 1WL9A 4U1BA 1R5HA 4Z7MA 2GGBA 5JI6A 4PNCA 1XGMA 2BHAA 2BB7A 4B28A 1YW9A 1R58A 2MATA 1W7VA 3PKAA 5CDLA 4S00A 2GU4A 4EGEA 1WLRA 2BN7A 3PKCA 2V3YA 3BIQA 1C27A 1KQ0A 1M35A 2OKNA 3PKDA 5CNXA 3S6BA 2BWVA 4JUQA 5CLSA 4U6CA 1BOAA 4IF7A 4ZWPA 1W2MA 5D6EA 2BHCA 4ZWUA 2BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVC A;  1XGO A;  2BHD A;  4FKC A;  3Q6D A;  4RZZ A;  3CB5 A;  4IKU A;  4ZWO A;  1BN5 A;  5FCH A;  4A6V A;  1QXW A;  3IU9 A;  1XNZ A;  2GG2 A;  1CHM A;  1O0X A;  2B3K A;  1MAT A;  4U76 A;  1KQ9 A;  2EVM A;  3CB6 A;  2GG5 A;  2GU5 A;  3IU8 A;  4U6W A;  2GG9 A;  2BWW A;  2GGC A;  2V3Z A;  4MAT A;  2Q8K A;  2GG3 A;  2GG7 A;  4HXX A;  4IPA A;  2GA2 A;  2GU6 A;  2EVO A;  1YVM A;  2V3X A;  1WY2 A;  1WL6 A;  4IKT A;  4U6E A;  4R60 A;  4FLK A;  4U69 A;  2Q96 A;  3PKB A;  1QXY A;  2GG8 A;  2NQ6 A;  4FUK A;  1C22 A;  3FMQ A;  4U75 A;  3TB5 A;  1C23 A;  4IKR A;  4A6W A;  5CIK A;  2GZ5 A;  4RGZ 1;  2EA2 A;  1C21 A;  1XGN A;  3MAT A;  4IKS A;  1WN1 A;  5E5B A;  1B6A A;  2Q93 A;  3BIT A;  3CTZ A;  3D27 A;  4KM3 A;  4ZNG A;  2EA4 A;  5JHU A;  4OOK A;  1XGS A;  3L7G A;  4IEC A;  2BWT A;  3L24 A;  2GTX A;  4S01 A;  4S2T P;  1PV9 A;  2IW2 A;  3IU7 A;  4IU6 A;  2BWY A;  4U6J A;  1YW7 A;  3TAV A;  3MR1 A;  1R5G A;  2P9A A;  2B3H A;  2G6P A;  2Q95 A;  3MX6 A;  5D6F A;  2NQ7 A;  5FCF A;  5CDE A;  3PKE A;  1QZY A;  4FLJ A;  1YJ3 A;  2ZSG A;  4QR8 A;  3FMR A;  2P98 A;  3IG4 A;  4FLI A;  5CDV A;  2B3L A;  1WKM A;  4S2R P;  2BWU A;  4FO8 A;  3FM3 A;  2BWX A;  2GG0 A;  2BWS A;  1JAW A;  2P99 A;  2GU7 A;  3ROR A;  4IDY A;  1Y1N A;  1KP0 A;  1YW8 A;  4FO7 A;  4U70 A;  2DFI A;  2BH3 A;  1N51 A;  4PV4 A;  4U73 A;  3RVA A;  4RZY A;  2OAZ A;  2Q92 A;  5CE6 A;  4U6Z A;  1A16 A;  1C24 A;  4FLL A;  2Q94 A;  5JFR A;  1QXZ A;  2V6C A;  4U71 A;  2ADU A;  1WBQ A;  3BIP A;  1B59 A;  2HOW A;  1WL9 A;  4U1B A;  1R5H A;  4Z7M A;  2GGB A;  5JI6 A;  4PNC A;  1XGM A;  2BHA A;  2BB7 A;  4B28 A;  1YW9 A;  1R58 A;  2MAT A;  1W7V A;  3PKA A;  5CDL A;  4S00 A;  2GU4 A;  4EGE A;  1WLR A;  2BN7 A;  3PKC A;  2V3Y A;  3BIQ A;  1C27 A;  1KQ0 A;  1M35 A;  2OKN A;  3PKD A;  5CNX A;  3S6B A;  2BWV A;  4JUQ A;  5CLS A;  4U6C A;  1BOA A;  4IF7 A;  4ZWP A;  1W2M A;  5D6E A;  2BHC A;  4ZWU A;  2BHB A; 
#chains in the Genus database with same CATH topology
 2EVC A;  1XGO A;  2BHD A;  4FKC A;  3Q6D A;  4RZZ A;  3CB5 A;  4IKU A;  4ZWO A;  1BN5 A;  5FCH A;  4A6V A;  1QXW A;  3IU9 A;  1XNZ A;  2GG2 A;  1CHM A;  1O0X A;  2B3K A;  1MAT A;  4U76 A;  1KQ9 A;  2EVM A;  3CB6 A;  2GG5 A;  2GU5 A;  3IU8 A;  4U6W A;  2GG9 A;  2BWW A;  2GGC A;  2V3Z A;  4MAT A;  2Q8K A;  2GG3 A;  2GG7 A;  4HXX A;  4IPA A;  2GA2 A;  2GU6 A;  2EVO A;  1YVM A;  2V3X A;  1WY2 A;  1WL6 A;  4IKT A;  4U6E A;  4R60 A;  4FLK A;  4U69 A;  2Q96 A;  3PKB A;  1QXY A;  2GG8 A;  2NQ6 A;  4FUK A;  1C22 A;  3FMQ A;  4U75 A;  3TB5 A;  1C23 A;  4IKR A;  4A6W A;  5CIK A;  2GZ5 A;  4RGZ 1;  2EA2 A;  1C21 A;  1XGN A;  3MAT A;  4IKS A;  1WN1 A;  5E5B A;  1B6A A;  2Q93 A;  3BIT A;  3CTZ A;  3D27 A;  4KM3 A;  4ZNG A;  2EA4 A;  5JHU A;  4OOK A;  1XGS A;  3L7G A;  4IEC A;  2BWT A;  3L24 A;  2GTX A;  4S01 A;  4S2T P;  1PV9 A;  2IW2 A;  3IU7 A;  4IU6 A;  2BWY A;  4U6J A;  1YW7 A;  3TAV A;  3MR1 A;  1R5G A;  2P9A A;  2B3H A;  2G6P A;  2Q95 A;  3MX6 A;  5D6F A;  2NQ7 A;  5FCF A;  5CDE A;  3PKE A;  1QZY A;  4FLJ A;  1YJ3 A;  2ZSG A;  4QR8 A;  3FMR A;  2P98 A;  3IG4 A;  4FLI A;  5CDV A;  2B3L A;  1WKM A;  4S2R P;  2BWU A;  4FO8 A;  3FM3 A;  2BWX A;  2GG0 A;  2BWS A;  1JAW A;  2P99 A;  2GU7 A;  3ROR A;  4IDY A;  1Y1N A;  1KP0 A;  1YW8 A;  4FO7 A;  4U70 A;  2DFI A;  2BH3 A;  1N51 A;  4PV4 A;  4U73 A;  3RVA A;  4RZY A;  2OAZ A;  2Q92 A;  5CE6 A;  4U6Z A;  1A16 A;  1C24 A;  4FLL A;  2Q94 A;  5JFR A;  1QXZ A;  2V6C A;  4U71 A;  2ADU A;  1WBQ A;  3BIP A;  1B59 A;  2HOW A;  1WL9 A;  4U1B A;  1R5H A;  4Z7M A;  2GGB A;  5JI6 A;  4PNC A;  1XGM A;  2BHA A;  2BB7 A;  4B28 A;  1YW9 A;  1R58 A;  2MAT A;  1W7V A;  3PKA A;  5CDL A;  4S00 A;  2GU4 A;  4EGE A;  1WLR A;  2BN7 A;  3PKC A;  2V3Y A;  3BIQ A;  1C27 A;  1KQ0 A;  1M35 A;  2OKN A;  3PKD A;  5CNX A;  3S6B A;  2BWV A;  4JUQ A;  5CLS A;  4U6C A;  1BOA A;  4IF7 A;  4ZWP A;  1W2M A;  5D6E A;  2BHC A;  4ZWU A;  2BHB A; 
#chains in the Genus database with same CATH homology
 2EVC A;  1XGO A;  2BHD A;  4FKC A;  3Q6D A;  4RZZ A;  3CB5 A;  4IKU A;  4ZWO A;  1BN5 A;  5FCH A;  4A6V A;  1QXW A;  3IU9 A;  1XNZ A;  2GG2 A;  1CHM A;  1O0X A;  2B3K A;  1MAT A;  4U76 A;  1KQ9 A;  2EVM A;  3CB6 A;  2GG5 A;  2GU5 A;  3IU8 A;  4U6W A;  2GG9 A;  2BWW A;  2GGC A;  2V3Z A;  4MAT A;  2Q8K A;  2GG3 A;  2GG7 A;  4HXX A;  4IPA A;  2GA2 A;  2GU6 A;  2EVO A;  1YVM A;  2V3X A;  1WY2 A;  1WL6 A;  4IKT A;  4U6E A;  4R60 A;  4FLK A;  4U69 A;  2Q96 A;  3PKB A;  1QXY A;  2GG8 A;  2NQ6 A;  4FUK A;  1C22 A;  3FMQ A;  4U75 A;  3TB5 A;  1C23 A;  4IKR A;  4A6W A;  5CIK A;  2GZ5 A;  4RGZ 1;  2EA2 A;  1C21 A;  1XGN A;  3MAT A;  4IKS A;  1WN1 A;  5E5B A;  1B6A A;  2Q93 A;  3BIT A;  3CTZ A;  3D27 A;  4KM3 A;  4ZNG A;  2EA4 A;  5JHU A;  4OOK A;  1XGS A;  3L7G A;  4IEC A;  2BWT A;  3L24 A;  2GTX A;  4S01 A;  4S2T P;  1PV9 A;  2IW2 A;  3IU7 A;  4IU6 A;  2BWY A;  4U6J A;  1YW7 A;  3TAV A;  3MR1 A;  1R5G A;  2P9A A;  2B3H A;  2G6P A;  2Q95 A;  3MX6 A;  5D6F A;  2NQ7 A;  5FCF A;  5CDE A;  3PKE A;  1QZY A;  4FLJ A;  1YJ3 A;  2ZSG A;  4QR8 A;  3FMR A;  2P98 A;  3IG4 A;  4FLI A;  5CDV A;  2B3L A;  1WKM A;  4S2R P;  2BWU A;  4FO8 A;  3FM3 A;  2BWX A;  2GG0 A;  2BWS A;  1JAW A;  2P99 A;  2GU7 A;  3ROR A;  4IDY A;  1Y1N A;  1KP0 A;  1YW8 A;  4FO7 A;  4U70 A;  2DFI A;  2BH3 A;  1N51 A;  4PV4 A;  4U73 A;  3RVA A;  4RZY A;  2OAZ A;  2Q92 A;  5CE6 A;  4U6Z A;  1A16 A;  1C24 A;  4FLL A;  2Q94 A;  5JFR A;  1QXZ A;  2V6C A;  4U71 A;  2ADU A;  1WBQ A;  3BIP A;  1B59 A;  2HOW A;  1WL9 A;  4U1B A;  1R5H A;  4Z7M A;  2GGB A;  5JI6 A;  4PNC A;  1XGM A;  2BHA A;  2BB7 A;  4B28 A;  1YW9 A;  1R58 A;  2MAT A;  1W7V A;  3PKA A;  5CDL A;  4S00 A;  2GU4 A;  4EGE A;  1WLR A;  2BN7 A;  3PKC A;  2V3Y A;  3BIQ A;  1C27 A;  1KQ0 A;  1M35 A;  2OKN A;  3PKD A;  5CNX A;  3S6B A;  2BWV A;  4JUQ A;  5CLS A;  4U6C A;  1BOA A;  4IF7 A;  4ZWP A;  1W2M A;  5D6E A;  2BHC A;  4ZWU A;  2BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...