2NQ6A

Crystal structure of human methionine aminopeptidase type 1 in complex with 3-tert-butoxycarbonylaminopyridine-2-carboxylic acid thiazole-2-ylamide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
molecule tags Hydrolase
source organism Homo sapiens
publication title Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
pubmed doi rcsb
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2nq6A00
4U69A 5CNXA 3PKDA 1QXZA 4HXXA 1JAWA 1WN1A 2GU5A 2GU4A 2GG2A 4FKCA 1BN5A 1KQ0A 4FUKA 2BWTA 1XGSA 2NQ7A 4U1BA 3IG4A 2Q95A 4OOKA 1XGNA 1B6AA 4FLLA 4R60A 2GGCA 3BIPA 3TAVA 2BN7A 3IU7A 4FLKA 4IKRA 4IPAA 1A16A 2OAZA 3BITA 3MR1A 4IF7A 5JFRA 2NQ6A 3TB5A 1QZYA 5CDEA 2BWSA 4RZZA 4IKSA 3RVAA 1C24A 3MX6A 5CIKA 2BB7A 2GG9A 3CB5A 3FM3A 1QXWA 1XNZA 4RGZ1 4FLIA 2B3LA 4U6CA 2Q94A 5D6FA 1XGMA 2GZ5A 3RORA 1WLRA 2BHBA 3D27A 1M35A 4IKTA 2BWYA 2GG7A 4ZWOA 4EGEA 1YVMA 3MATA 3PKEA 1XGOA 2GU7A 1C23A 1BOAA 2GG0A 2EVMA 4U73A 2EVOA 2GG3A 2ADUA 2B3HA 4U75A 2BHAA 3S6BA 1YW7A 2Q93A 4JUQA 2DFIA 2EA4A 2ZSGA 4S00A 2V3YA 4RZYA 1C22A 4ZNGA 2OKNA 5CLSA 2BH3A 2V3XA 4Z7MA 2P99A 2Q96A 1WL6A 2GG8A 2BWXA 5CDLA 2EVCA 1QXYA 1R58A 5JHUA 2BHDA 4QR8A 5D6EA 3Q6DA 5FCFA 4S01A 4U6JA 4IU6A 3PKAA 1W2MA 4FO7A 4KM3A 3CB6A 4FO8A 4IDYA 4A6VA 1W7VA 5E5BA 3FMRA 4MATA 4PNCA 3PKCA 3BIQA 4PV4A 2V3ZA 5FCHA 2EA2A 2V6CA 4IKUA 1C21A 2GTXA 3PKBA 1CHMA 4U6EA 4ZWPA 5CDVA 4IECA 4U6ZA 1WY2A 3L24A 2GGBA 1WL9A 2B3KA 2GA2A 2G6PA 3IU9A 1WKMA 4S2RP 4A6WA 2BWUA 2MATA 3FMQA 2IW2A 4ZWUA 3IU8A 2GU6A 2GG5A 4FLJA 1PV9A 1WBQA 4S2TP 1B59A 3L7GA 2Q92A 5CE6A 1KQ9A 1YW8A 4U70A 1N51A 2P98A 4U71A 1O0XA 1YJ3A 5JI6A 1Y1NA 4U6WA 2Q8KA 2BWVA 2BWWA 4U76A 2HOWA 1KP0A 1C27A 4B28A 1MATA 2P9AA 1R5HA 1YW9A 1R5GA 2BHCA 3CTZA
chains in the Genus database with same CATH superfamily
4U69A 5CNXA 3PKDA 1QXZA 4HXXA 1JAWA 1WN1A 2GU5A 2GU4A 2GG2A 4FKCA 1BN5A 1KQ0A 4FUKA 2BWTA 1XGSA 2NQ7A 4U1BA 3IG4A 2Q95A 4OOKA 1XGNA 1B6AA 4FLLA 4R60A 2GGCA 3BIPA 3TAVA 2BN7A 3IU7A 4FLKA 4IKRA 4IPAA 1A16A 2OAZA 3BITA 3MR1A 4IF7A 5JFRA 2NQ6A 3TB5A 1QZYA 5CDEA 2BWSA 4RZZA 4IKSA 3RVAA 1C24A 3MX6A 5CIKA 2BB7A 2GG9A 3CB5A 3FM3A 1QXWA 1XNZA 4RGZ1 4FLIA 2B3LA 4U6CA 2Q94A 5D6FA 1XGMA 2GZ5A 3RORA 1WLRA 2BHBA 3D27A 1M35A 4IKTA 2BWYA 2GG7A 4ZWOA 4EGEA 1YVMA 3MATA 3PKEA 1XGOA 2GU7A 1C23A 1BOAA 2GG0A 2EVMA 4U73A 2EVOA 2GG3A 2ADUA 2B3HA 4U75A 2BHAA 3S6BA 1YW7A 2Q93A 4JUQA 2DFIA 2EA4A 2ZSGA 4S00A 2V3YA 4RZYA 1C22A 4ZNGA 2OKNA 5CLSA 2BH3A 2V3XA 4Z7MA 2P99A 2Q96A 1WL6A 2GG8A 2BWXA 5CDLA 2EVCA 1QXYA 1R58A 5JHUA 2BHDA 4QR8A 5D6EA 3Q6DA 5FCFA 4S01A 4U6JA 4IU6A 3PKAA 1W2MA 4FO7A 4KM3A 3CB6A 4FO8A 4IDYA 4A6VA 1W7VA 5E5BA 3FMRA 4MATA 4PNCA 3PKCA 3BIQA 4PV4A 2V3ZA 5FCHA 2EA2A 2V6CA 4IKUA 1C21A 2GTXA 3PKBA 1CHMA 4U6EA 4ZWPA 5CDVA 4IECA 4U6ZA 1WY2A 3L24A 2GGBA 1WL9A 2B3KA 2GA2A 2G6PA 3IU9A 1WKMA 4S2RP 4A6WA 2BWUA 2MATA 3FMQA 2IW2A 4ZWUA 3IU8A 2GU6A 2GG5A 4FLJA 1PV9A 1WBQA 4S2TP 1B59A 3L7GA 2Q92A 5CE6A 1KQ9A 1YW8A 4U70A 1N51A 2P98A 4U71A 1O0XA 1YJ3A 5JI6A 1Y1NA 4U6WA 2Q8KA 2BWVA 2BWWA 4U76A 2HOWA 1KP0A 1C27A 4B28A 1MATA 2P9AA 1R5HA 1YW9A 1R5GA 2BHCA 3CTZA
chains in the Genus database with same CATH topology
4U69A 5CNXA 3PKDA 1QXZA 4HXXA 1JAWA 1WN1A 2GU5A 2GU4A 2GG2A 4FKCA 1BN5A 1KQ0A 4FUKA 2BWTA 1XGSA 2NQ7A 4U1BA 3IG4A 2Q95A 4OOKA 1XGNA 1B6AA 4FLLA 4R60A 2GGCA 3BIPA 3TAVA 2BN7A 3IU7A 4FLKA 4IKRA 4IPAA 1A16A 2OAZA 3BITA 3MR1A 4IF7A 5JFRA 2NQ6A 3TB5A 1QZYA 5CDEA 2BWSA 4RZZA 4IKSA 3RVAA 1C24A 3MX6A 5CIKA 2BB7A 2GG9A 3CB5A 3FM3A 1QXWA 1XNZA 4RGZ1 4FLIA 2B3LA 4U6CA 2Q94A 5D6FA 1XGMA 2GZ5A 3RORA 1WLRA 2BHBA 3D27A 1M35A 4IKTA 2BWYA 2GG7A 4ZWOA 4EGEA 1YVMA 3MATA 3PKEA 1XGOA 2GU7A 1C23A 1BOAA 2GG0A 2EVMA 4U73A 2EVOA 2GG3A 2ADUA 2B3HA 4U75A 2BHAA 3S6BA 1YW7A 2Q93A 4JUQA 2DFIA 2EA4A 2ZSGA 4S00A 2V3YA 4RZYA 1C22A 4ZNGA 2OKNA 5CLSA 2BH3A 2V3XA 4Z7MA 2P99A 2Q96A 1WL6A 2GG8A 2BWXA 5CDLA 2EVCA 1QXYA 1R58A 5JHUA 2BHDA 4QR8A 5D6EA 3Q6DA 5FCFA 4S01A 4U6JA 4IU6A 3PKAA 1W2MA 4FO7A 4KM3A 3CB6A 4FO8A 4IDYA 4A6VA 1W7VA 5E5BA 3FMRA 4MATA 4PNCA 3PKCA 3BIQA 4PV4A 2V3ZA 5FCHA 2EA2A 2V6CA 4IKUA 1C21A 2GTXA 3PKBA 1CHMA 4U6EA 4ZWPA 5CDVA 4IECA 4U6ZA 1WY2A 3L24A 2GGBA 1WL9A 2B3KA 2GA2A 2G6PA 3IU9A 1WKMA 4S2RP 4A6WA 2BWUA 2MATA 3FMQA 2IW2A 4ZWUA 3IU8A 2GU6A 2GG5A 4FLJA 1PV9A 1WBQA 4S2TP 1B59A 3L7GA 2Q92A 5CE6A 1KQ9A 1YW8A 4U70A 1N51A 2P98A 4U71A 1O0XA 1YJ3A 5JI6A 1Y1NA 4U6WA 2Q8KA 2BWVA 2BWWA 4U76A 2HOWA 1KP0A 1C27A 4B28A 1MATA 2P9AA 1R5HA 1YW9A 1R5GA 2BHCA 3CTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U69 A;  5CNX A;  3PKD A;  1QXZ A;  4HXX A;  1JAW A;  1WN1 A;  2GU5 A;  2GU4 A;  2GG2 A;  4FKC A;  1BN5 A;  1KQ0 A;  4FUK A;  2BWT A;  1XGS A;  2NQ7 A;  4U1B A;  3IG4 A;  2Q95 A;  4OOK A;  1XGN A;  1B6A A;  4FLL A;  4R60 A;  2GGC A;  3BIP A;  3TAV A;  2BN7 A;  3IU7 A;  4FLK A;  4IKR A;  4IPA A;  1A16 A;  2OAZ A;  3BIT A;  3MR1 A;  4IF7 A;  5JFR A;  2NQ6 A;  3TB5 A;  1QZY A;  5CDE A;  2BWS A;  4RZZ A;  4IKS A;  3RVA A;  1C24 A;  3MX6 A;  5CIK A;  2BB7 A;  2GG9 A;  3CB5 A;  3FM3 A;  1QXW A;  1XNZ A;  4RGZ 1;  4FLI A;  2B3L A;  4U6C A;  2Q94 A;  5D6F A;  1XGM A;  2GZ5 A;  3ROR A;  1WLR A;  2BHB A;  3D27 A;  1M35 A;  4IKT A;  2BWY A;  2GG7 A;  4ZWO A;  4EGE A;  1YVM A;  3MAT A;  3PKE A;  1XGO A;  2GU7 A;  1C23 A;  1BOA A;  2GG0 A;  2EVM A;  4U73 A;  2EVO A;  2GG3 A;  2ADU A;  2B3H A;  4U75 A;  2BHA A;  3S6B A;  1YW7 A;  2Q93 A;  4JUQ A;  2DFI A;  2EA4 A;  2ZSG A;  4S00 A;  2V3Y A;  4RZY A;  1C22 A;  4ZNG A;  2OKN A;  5CLS A;  2BH3 A;  2V3X A;  4Z7M A;  2P99 A;  2Q96 A;  1WL6 A;  2GG8 A;  2BWX A;  5CDL A;  2EVC A;  1QXY A;  1R58 A;  5JHU A;  2BHD A;  4QR8 A;  5D6E A;  3Q6D A;  5FCF A;  4S01 A;  4U6J A;  4IU6 A;  3PKA A;  1W2M A;  4FO7 A;  4KM3 A;  3CB6 A;  4FO8 A;  4IDY A;  4A6V A;  1W7V A;  5E5B A;  3FMR A;  4MAT A;  4PNC A;  3PKC A;  3BIQ A;  4PV4 A;  2V3Z A;  5FCH A;  2EA2 A;  2V6C A;  4IKU A;  1C21 A;  2GTX A;  3PKB A;  1CHM A;  4U6E A;  4ZWP A;  5CDV A;  4IEC A;  4U6Z A;  1WY2 A;  3L24 A;  2GGB A;  1WL9 A;  2B3K A;  2GA2 A;  2G6P A;  3IU9 A;  1WKM A;  4S2R P;  4A6W A;  2BWU A;  2MAT A;  3FMQ A;  2IW2 A;  4ZWU A;  3IU8 A;  2GU6 A;  2GG5 A;  4FLJ A;  1PV9 A;  1WBQ A;  4S2T P;  1B59 A;  3L7G A;  2Q92 A;  5CE6 A;  1KQ9 A;  1YW8 A;  4U70 A;  1N51 A;  2P98 A;  4U71 A;  1O0X A;  1YJ3 A;  5JI6 A;  1Y1N A;  4U6W A;  2Q8K A;  2BWV A;  2BWW A;  4U76 A;  2HOW A;  1KP0 A;  1C27 A;  4B28 A;  1MAT A;  2P9A A;  1R5H A;  1YW9 A;  1R5G A;  2BHC A;  3CTZ A; 
#chains in the Genus database with same CATH topology
 4U69 A;  5CNX A;  3PKD A;  1QXZ A;  4HXX A;  1JAW A;  1WN1 A;  2GU5 A;  2GU4 A;  2GG2 A;  4FKC A;  1BN5 A;  1KQ0 A;  4FUK A;  2BWT A;  1XGS A;  2NQ7 A;  4U1B A;  3IG4 A;  2Q95 A;  4OOK A;  1XGN A;  1B6A A;  4FLL A;  4R60 A;  2GGC A;  3BIP A;  3TAV A;  2BN7 A;  3IU7 A;  4FLK A;  4IKR A;  4IPA A;  1A16 A;  2OAZ A;  3BIT A;  3MR1 A;  4IF7 A;  5JFR A;  2NQ6 A;  3TB5 A;  1QZY A;  5CDE A;  2BWS A;  4RZZ A;  4IKS A;  3RVA A;  1C24 A;  3MX6 A;  5CIK A;  2BB7 A;  2GG9 A;  3CB5 A;  3FM3 A;  1QXW A;  1XNZ A;  4RGZ 1;  4FLI A;  2B3L A;  4U6C A;  2Q94 A;  5D6F A;  1XGM A;  2GZ5 A;  3ROR A;  1WLR A;  2BHB A;  3D27 A;  1M35 A;  4IKT A;  2BWY A;  2GG7 A;  4ZWO A;  4EGE A;  1YVM A;  3MAT A;  3PKE A;  1XGO A;  2GU7 A;  1C23 A;  1BOA A;  2GG0 A;  2EVM A;  4U73 A;  2EVO A;  2GG3 A;  2ADU A;  2B3H A;  4U75 A;  2BHA A;  3S6B A;  1YW7 A;  2Q93 A;  4JUQ A;  2DFI A;  2EA4 A;  2ZSG A;  4S00 A;  2V3Y A;  4RZY A;  1C22 A;  4ZNG A;  2OKN A;  5CLS A;  2BH3 A;  2V3X A;  4Z7M A;  2P99 A;  2Q96 A;  1WL6 A;  2GG8 A;  2BWX A;  5CDL A;  2EVC A;  1QXY A;  1R58 A;  5JHU A;  2BHD A;  4QR8 A;  5D6E A;  3Q6D A;  5FCF A;  4S01 A;  4U6J A;  4IU6 A;  3PKA A;  1W2M A;  4FO7 A;  4KM3 A;  3CB6 A;  4FO8 A;  4IDY A;  4A6V A;  1W7V A;  5E5B A;  3FMR A;  4MAT A;  4PNC A;  3PKC A;  3BIQ A;  4PV4 A;  2V3Z A;  5FCH A;  2EA2 A;  2V6C A;  4IKU A;  1C21 A;  2GTX A;  3PKB A;  1CHM A;  4U6E A;  4ZWP A;  5CDV A;  4IEC A;  4U6Z A;  1WY2 A;  3L24 A;  2GGB A;  1WL9 A;  2B3K A;  2GA2 A;  2G6P A;  3IU9 A;  1WKM A;  4S2R P;  4A6W A;  2BWU A;  2MAT A;  3FMQ A;  2IW2 A;  4ZWU A;  3IU8 A;  2GU6 A;  2GG5 A;  4FLJ A;  1PV9 A;  1WBQ A;  4S2T P;  1B59 A;  3L7G A;  2Q92 A;  5CE6 A;  1KQ9 A;  1YW8 A;  4U70 A;  1N51 A;  2P98 A;  4U71 A;  1O0X A;  1YJ3 A;  5JI6 A;  1Y1N A;  4U6W A;  2Q8K A;  2BWV A;  2BWW A;  4U76 A;  2HOW A;  1KP0 A;  1C27 A;  4B28 A;  1MAT A;  2P9A A;  1R5H A;  1YW9 A;  1R5G A;  2BHC A;  3CTZ A; 
#chains in the Genus database with same CATH homology
 4U69 A;  5CNX A;  3PKD A;  1QXZ A;  4HXX A;  1JAW A;  1WN1 A;  2GU5 A;  2GU4 A;  2GG2 A;  4FKC A;  1BN5 A;  1KQ0 A;  4FUK A;  2BWT A;  1XGS A;  2NQ7 A;  4U1B A;  3IG4 A;  2Q95 A;  4OOK A;  1XGN A;  1B6A A;  4FLL A;  4R60 A;  2GGC A;  3BIP A;  3TAV A;  2BN7 A;  3IU7 A;  4FLK A;  4IKR A;  4IPA A;  1A16 A;  2OAZ A;  3BIT A;  3MR1 A;  4IF7 A;  5JFR A;  2NQ6 A;  3TB5 A;  1QZY A;  5CDE A;  2BWS A;  4RZZ A;  4IKS A;  3RVA A;  1C24 A;  3MX6 A;  5CIK A;  2BB7 A;  2GG9 A;  3CB5 A;  3FM3 A;  1QXW A;  1XNZ A;  4RGZ 1;  4FLI A;  2B3L A;  4U6C A;  2Q94 A;  5D6F A;  1XGM A;  2GZ5 A;  3ROR A;  1WLR A;  2BHB A;  3D27 A;  1M35 A;  4IKT A;  2BWY A;  2GG7 A;  4ZWO A;  4EGE A;  1YVM A;  3MAT A;  3PKE A;  1XGO A;  2GU7 A;  1C23 A;  1BOA A;  2GG0 A;  2EVM A;  4U73 A;  2EVO A;  2GG3 A;  2ADU A;  2B3H A;  4U75 A;  2BHA A;  3S6B A;  1YW7 A;  2Q93 A;  4JUQ A;  2DFI A;  2EA4 A;  2ZSG A;  4S00 A;  2V3Y A;  4RZY A;  1C22 A;  4ZNG A;  2OKN A;  5CLS A;  2BH3 A;  2V3X A;  4Z7M A;  2P99 A;  2Q96 A;  1WL6 A;  2GG8 A;  2BWX A;  5CDL A;  2EVC A;  1QXY A;  1R58 A;  5JHU A;  2BHD A;  4QR8 A;  5D6E A;  3Q6D A;  5FCF A;  4S01 A;  4U6J A;  4IU6 A;  3PKA A;  1W2M A;  4FO7 A;  4KM3 A;  3CB6 A;  4FO8 A;  4IDY A;  4A6V A;  1W7V A;  5E5B A;  3FMR A;  4MAT A;  4PNC A;  3PKC A;  3BIQ A;  4PV4 A;  2V3Z A;  5FCH A;  2EA2 A;  2V6C A;  4IKU A;  1C21 A;  2GTX A;  3PKB A;  1CHM A;  4U6E A;  4ZWP A;  5CDV A;  4IEC A;  4U6Z A;  1WY2 A;  3L24 A;  2GGB A;  1WL9 A;  2B3K A;  2GA2 A;  2G6P A;  3IU9 A;  1WKM A;  4S2R P;  4A6W A;  2BWU A;  2MAT A;  3FMQ A;  2IW2 A;  4ZWU A;  3IU8 A;  2GU6 A;  2GG5 A;  4FLJ A;  1PV9 A;  1WBQ A;  4S2T P;  1B59 A;  3L7G A;  2Q92 A;  5CE6 A;  1KQ9 A;  1YW8 A;  4U70 A;  1N51 A;  2P98 A;  4U71 A;  1O0X A;  1YJ3 A;  5JI6 A;  1Y1N A;  4U6W A;  2Q8K A;  2BWV A;  2BWW A;  4U76 A;  2HOW A;  1KP0 A;  1C27 A;  4B28 A;  1MAT A;  2P9A A;  1R5H A;  1YW9 A;  1R5G A;  2BHC A;  3CTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...