2NQ6A

Crystal structure of human methionine aminopeptidase type 1 in complex with 3-tert-butoxycarbonylaminopyridine-2-carboxylic acid thiazole-2-ylamide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2nq6A00
1CHMA 2NQ6A 2GG7A 2B3LA 3L7GA 2BWYA 2DFIA 3FMQA 3PKDA 1QXWA 1WKMA 4U73A 4B28A 4U6WA 1YW8A 4IF7A 1B59A 2GG9A 4PV4A 1WLRA 4FLLA 1Y1NA 1C23A 4FO8A 2BWXA 2BHAA 1BOAA 1QXZA 2BWVA 2BHCA 2EVCA 2BHBA 2GU4A 3FM3A 2BH3A 4OOKA 4RZYA 2V3YA 2V6CA 3Q6DA 4IPAA 4ZWOA 2GG5A 5CNXA 1WL6A 3BITA 1W2MA 3BIQA 3IU9A 4HXXA 4IECA 4ZWPA 5D6EA 3MATA 5FCHA 4ZWUA 4FLJA 2G6PA 4KM3A 2BN7A 1O0XA 3TAVA 4U1BA 5FCFA 2OKNA 2MATA 4IKSA 1C27A 4A6VA 5CDVA 1R58A 2GU5A 3FMRA 1QZYA 1R5GA 2GGBA 2Q93A 2Q92A 2Q96A 3D27A 1BN5A 1YVMA 2GZ5A 2P99A 4S2TP 1WN1A 4U71A 2GTXA 4FLIA 1W7VA 2BB7A 1XGOA 1A16A 2EA2A 4JUQA 5JFRA 5E5BA 2BWTA 2GU6A 5D6FA 3PKBA 3BIPA 1QXYA 2V3XA 4A6WA 2OAZA 2EVMA 3CB6A 4U75A 1B6AA 2NQ7A 2Q8KA 2GG2A 4IDYA 2B3KA 2B3HA 1YW7A 3MX6A 4RZZA 1WBQA 4U70A 3L24A 4U6EA 4U76A 3MR1A 4U6CA 4FO7A 4MATA 4IU6A 1JAWA 1XGNA 1YW9A 2Q94A 4S01A 4IKRA 2Q95A 5CDEA 1XNZA 2ZSGA 4EGEA 4Z7MA 2EA4A 4S2RP 4PNCA 1C21A 4U6ZA 5CLSA 2P9AA 3IU8A 1N51A 4IKUA 2GA2A 2V3ZA 1WL9A 5CE6A 2IW2A 2BWWA 3RVAA 4FLKA 1C22A 1XGSA 2GU7A 2BWSA 2ADUA 3IU7A 2GG8A 4FUKA 2GG0A 1M35A 4S00A 1R5HA 4QR8A 1YJ3A 5JI6A 1KQ0A 4RGZ1 1WY2A 5CIKA 4FKCA 3PKAA 2BHDA 3CTZA 3RORA 1MATA 3TB5A 1C24A 2HOWA 3S6BA 4R60A 1XGMA 3PKEA 5CDLA 5JHUA 4ZNGA 4U69A 2P98A 1KP0A 4IKTA 1KQ9A 2GG3A 2GGCA 3PKCA 4U6JA 1PV9A 2EVOA 3CB5A 2BWUA 3IG4A
chains in the Genus database with same CATH superfamily
1CHMA 2NQ6A 2GG7A 2B3LA 3L7GA 2BWYA 2DFIA 3FMQA 3PKDA 1QXWA 1WKMA 4U73A 4B28A 4U6WA 1YW8A 4IF7A 1B59A 2GG9A 4PV4A 1WLRA 4FLLA 1Y1NA 1C23A 4FO8A 2BWXA 2BHAA 1BOAA 1QXZA 2BWVA 2BHCA 2EVCA 2BHBA 2GU4A 3FM3A 2BH3A 4OOKA 4RZYA 2V3YA 2V6CA 3Q6DA 4IPAA 4ZWOA 2GG5A 5CNXA 1WL6A 3BITA 1W2MA 3BIQA 3IU9A 4HXXA 4IECA 4ZWPA 5D6EA 3MATA 5FCHA 4ZWUA 4FLJA 2G6PA 4KM3A 2BN7A 1O0XA 3TAVA 4U1BA 5FCFA 2OKNA 2MATA 4IKSA 1C27A 4A6VA 5CDVA 1R58A 2GU5A 3FMRA 1QZYA 1R5GA 2GGBA 2Q93A 2Q92A 2Q96A 3D27A 1BN5A 1YVMA 2GZ5A 2P99A 4S2TP 1WN1A 4U71A 2GTXA 4FLIA 1W7VA 2BB7A 1XGOA 1A16A 2EA2A 4JUQA 5JFRA 5E5BA 2BWTA 2GU6A 5D6FA 3PKBA 3BIPA 1QXYA 2V3XA 4A6WA 2OAZA 2EVMA 3CB6A 4U75A 1B6AA 2NQ7A 2Q8KA 2GG2A 4IDYA 2B3KA 2B3HA 1YW7A 3MX6A 4RZZA 1WBQA 4U70A 3L24A 4U6EA 4U76A 3MR1A 4U6CA 4FO7A 4MATA 4IU6A 1JAWA 1XGNA 1YW9A 2Q94A 4S01A 4IKRA 2Q95A 5CDEA 1XNZA 2ZSGA 4EGEA 4Z7MA 2EA4A 4S2RP 4PNCA 1C21A 4U6ZA 5CLSA 2P9AA 3IU8A 1N51A 4IKUA 2GA2A 2V3ZA 1WL9A 5CE6A 2IW2A 2BWWA 3RVAA 4FLKA 1C22A 1XGSA 2GU7A 2BWSA 2ADUA 3IU7A 2GG8A 4FUKA 2GG0A 1M35A 4S00A 1R5HA 4QR8A 1YJ3A 5JI6A 1KQ0A 4RGZ1 1WY2A 5CIKA 4FKCA 3PKAA 2BHDA 3CTZA 3RORA 1MATA 3TB5A 1C24A 2HOWA 3S6BA 4R60A 1XGMA 3PKEA 5CDLA 5JHUA 4ZNGA 4U69A 2P98A 1KP0A 4IKTA 1KQ9A 2GG3A 2GGCA 3PKCA 4U6JA 1PV9A 2EVOA 3CB5A 2BWUA 3IG4A
chains in the Genus database with same CATH topology
1CHMA 2NQ6A 2GG7A 2B3LA 3L7GA 2BWYA 2DFIA 3FMQA 3PKDA 1QXWA 1WKMA 4U73A 4B28A 4U6WA 1YW8A 4IF7A 1B59A 2GG9A 4PV4A 1WLRA 4FLLA 1Y1NA 1C23A 4FO8A 2BWXA 2BHAA 1BOAA 1QXZA 2BWVA 2BHCA 2EVCA 2BHBA 2GU4A 3FM3A 2BH3A 4OOKA 4RZYA 2V3YA 2V6CA 3Q6DA 4IPAA 4ZWOA 2GG5A 5CNXA 1WL6A 3BITA 1W2MA 3BIQA 3IU9A 4HXXA 4IECA 4ZWPA 5D6EA 3MATA 5FCHA 4ZWUA 4FLJA 2G6PA 4KM3A 2BN7A 1O0XA 3TAVA 4U1BA 5FCFA 2OKNA 2MATA 4IKSA 1C27A 4A6VA 5CDVA 1R58A 2GU5A 3FMRA 1QZYA 1R5GA 2GGBA 2Q93A 2Q92A 2Q96A 3D27A 1BN5A 1YVMA 2GZ5A 2P99A 4S2TP 1WN1A 4U71A 2GTXA 4FLIA 1W7VA 2BB7A 1XGOA 1A16A 2EA2A 4JUQA 5JFRA 5E5BA 2BWTA 2GU6A 5D6FA 3PKBA 3BIPA 1QXYA 2V3XA 4A6WA 2OAZA 2EVMA 3CB6A 4U75A 1B6AA 2NQ7A 2Q8KA 2GG2A 4IDYA 2B3KA 2B3HA 1YW7A 3MX6A 4RZZA 1WBQA 4U70A 3L24A 4U6EA 4U76A 3MR1A 4U6CA 4FO7A 4MATA 4IU6A 1JAWA 1XGNA 1YW9A 2Q94A 4S01A 4IKRA 2Q95A 5CDEA 1XNZA 2ZSGA 4EGEA 4Z7MA 2EA4A 4S2RP 4PNCA 1C21A 4U6ZA 5CLSA 2P9AA 3IU8A 1N51A 4IKUA 2GA2A 2V3ZA 1WL9A 5CE6A 2IW2A 2BWWA 3RVAA 4FLKA 1C22A 1XGSA 2GU7A 2BWSA 2ADUA 3IU7A 2GG8A 4FUKA 2GG0A 1M35A 4S00A 1R5HA 4QR8A 1YJ3A 5JI6A 1KQ0A 4RGZ1 1WY2A 5CIKA 4FKCA 3PKAA 2BHDA 3CTZA 3RORA 1MATA 3TB5A 1C24A 2HOWA 3S6BA 4R60A 1XGMA 3PKEA 5CDLA 5JHUA 4ZNGA 4U69A 2P98A 1KP0A 4IKTA 1KQ9A 2GG3A 2GGCA 3PKCA 4U6JA 1PV9A 2EVOA 3CB5A 2BWUA 3IG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHM A;  2NQ6 A;  2GG7 A;  2B3L A;  3L7G A;  2BWY A;  2DFI A;  3FMQ A;  3PKD A;  1QXW A;  1WKM A;  4U73 A;  4B28 A;  4U6W A;  1YW8 A;  4IF7 A;  1B59 A;  2GG9 A;  4PV4 A;  1WLR A;  4FLL A;  1Y1N A;  1C23 A;  4FO8 A;  2BWX A;  2BHA A;  1BOA A;  1QXZ A;  2BWV A;  2BHC A;  2EVC A;  2BHB A;  2GU4 A;  3FM3 A;  2BH3 A;  4OOK A;  4RZY A;  2V3Y A;  2V6C A;  3Q6D A;  4IPA A;  4ZWO A;  2GG5 A;  5CNX A;  1WL6 A;  3BIT A;  1W2M A;  3BIQ A;  3IU9 A;  4HXX A;  4IEC A;  4ZWP A;  5D6E A;  3MAT A;  5FCH A;  4ZWU A;  4FLJ A;  2G6P A;  4KM3 A;  2BN7 A;  1O0X A;  3TAV A;  4U1B A;  5FCF A;  2OKN A;  2MAT A;  4IKS A;  1C27 A;  4A6V A;  5CDV A;  1R58 A;  2GU5 A;  3FMR A;  1QZY A;  1R5G A;  2GGB A;  2Q93 A;  2Q92 A;  2Q96 A;  3D27 A;  1BN5 A;  1YVM A;  2GZ5 A;  2P99 A;  4S2T P;  1WN1 A;  4U71 A;  2GTX A;  4FLI A;  1W7V A;  2BB7 A;  1XGO A;  1A16 A;  2EA2 A;  4JUQ A;  5JFR A;  5E5B A;  2BWT A;  2GU6 A;  5D6F A;  3PKB A;  3BIP A;  1QXY A;  2V3X A;  4A6W A;  2OAZ A;  2EVM A;  3CB6 A;  4U75 A;  1B6A A;  2NQ7 A;  2Q8K A;  2GG2 A;  4IDY A;  2B3K A;  2B3H A;  1YW7 A;  3MX6 A;  4RZZ A;  1WBQ A;  4U70 A;  3L24 A;  4U6E A;  4U76 A;  3MR1 A;  4U6C A;  4FO7 A;  4MAT A;  4IU6 A;  1JAW A;  1XGN A;  1YW9 A;  2Q94 A;  4S01 A;  4IKR A;  2Q95 A;  5CDE A;  1XNZ A;  2ZSG A;  4EGE A;  4Z7M A;  2EA4 A;  4S2R P;  4PNC A;  1C21 A;  4U6Z A;  5CLS A;  2P9A A;  3IU8 A;  1N51 A;  4IKU A;  2GA2 A;  2V3Z A;  1WL9 A;  5CE6 A;  2IW2 A;  2BWW A;  3RVA A;  4FLK A;  1C22 A;  1XGS A;  2GU7 A;  2BWS A;  2ADU A;  3IU7 A;  2GG8 A;  4FUK A;  2GG0 A;  1M35 A;  4S00 A;  1R5H A;  4QR8 A;  1YJ3 A;  5JI6 A;  1KQ0 A;  4RGZ 1;  1WY2 A;  5CIK A;  4FKC A;  3PKA A;  2BHD A;  3CTZ A;  3ROR A;  1MAT A;  3TB5 A;  1C24 A;  2HOW A;  3S6B A;  4R60 A;  1XGM A;  3PKE A;  5CDL A;  5JHU A;  4ZNG A;  4U69 A;  2P98 A;  1KP0 A;  4IKT A;  1KQ9 A;  2GG3 A;  2GGC A;  3PKC A;  4U6J A;  1PV9 A;  2EVO A;  3CB5 A;  2BWU A;  3IG4 A; 
#chains in the Genus database with same CATH topology
 1CHM A;  2NQ6 A;  2GG7 A;  2B3L A;  3L7G A;  2BWY A;  2DFI A;  3FMQ A;  3PKD A;  1QXW A;  1WKM A;  4U73 A;  4B28 A;  4U6W A;  1YW8 A;  4IF7 A;  1B59 A;  2GG9 A;  4PV4 A;  1WLR A;  4FLL A;  1Y1N A;  1C23 A;  4FO8 A;  2BWX A;  2BHA A;  1BOA A;  1QXZ A;  2BWV A;  2BHC A;  2EVC A;  2BHB A;  2GU4 A;  3FM3 A;  2BH3 A;  4OOK A;  4RZY A;  2V3Y A;  2V6C A;  3Q6D A;  4IPA A;  4ZWO A;  2GG5 A;  5CNX A;  1WL6 A;  3BIT A;  1W2M A;  3BIQ A;  3IU9 A;  4HXX A;  4IEC A;  4ZWP A;  5D6E A;  3MAT A;  5FCH A;  4ZWU A;  4FLJ A;  2G6P A;  4KM3 A;  2BN7 A;  1O0X A;  3TAV A;  4U1B A;  5FCF A;  2OKN A;  2MAT A;  4IKS A;  1C27 A;  4A6V A;  5CDV A;  1R58 A;  2GU5 A;  3FMR A;  1QZY A;  1R5G A;  2GGB A;  2Q93 A;  2Q92 A;  2Q96 A;  3D27 A;  1BN5 A;  1YVM A;  2GZ5 A;  2P99 A;  4S2T P;  1WN1 A;  4U71 A;  2GTX A;  4FLI A;  1W7V A;  2BB7 A;  1XGO A;  1A16 A;  2EA2 A;  4JUQ A;  5JFR A;  5E5B A;  2BWT A;  2GU6 A;  5D6F A;  3PKB A;  3BIP A;  1QXY A;  2V3X A;  4A6W A;  2OAZ A;  2EVM A;  3CB6 A;  4U75 A;  1B6A A;  2NQ7 A;  2Q8K A;  2GG2 A;  4IDY A;  2B3K A;  2B3H A;  1YW7 A;  3MX6 A;  4RZZ A;  1WBQ A;  4U70 A;  3L24 A;  4U6E A;  4U76 A;  3MR1 A;  4U6C A;  4FO7 A;  4MAT A;  4IU6 A;  1JAW A;  1XGN A;  1YW9 A;  2Q94 A;  4S01 A;  4IKR A;  2Q95 A;  5CDE A;  1XNZ A;  2ZSG A;  4EGE A;  4Z7M A;  2EA4 A;  4S2R P;  4PNC A;  1C21 A;  4U6Z A;  5CLS A;  2P9A A;  3IU8 A;  1N51 A;  4IKU A;  2GA2 A;  2V3Z A;  1WL9 A;  5CE6 A;  2IW2 A;  2BWW A;  3RVA A;  4FLK A;  1C22 A;  1XGS A;  2GU7 A;  2BWS A;  2ADU A;  3IU7 A;  2GG8 A;  4FUK A;  2GG0 A;  1M35 A;  4S00 A;  1R5H A;  4QR8 A;  1YJ3 A;  5JI6 A;  1KQ0 A;  4RGZ 1;  1WY2 A;  5CIK A;  4FKC A;  3PKA A;  2BHD A;  3CTZ A;  3ROR A;  1MAT A;  3TB5 A;  1C24 A;  2HOW A;  3S6B A;  4R60 A;  1XGM A;  3PKE A;  5CDL A;  5JHU A;  4ZNG A;  4U69 A;  2P98 A;  1KP0 A;  4IKT A;  1KQ9 A;  2GG3 A;  2GGC A;  3PKC A;  4U6J A;  1PV9 A;  2EVO A;  3CB5 A;  2BWU A;  3IG4 A; 
#chains in the Genus database with same CATH homology
 1CHM A;  2NQ6 A;  2GG7 A;  2B3L A;  3L7G A;  2BWY A;  2DFI A;  3FMQ A;  3PKD A;  1QXW A;  1WKM A;  4U73 A;  4B28 A;  4U6W A;  1YW8 A;  4IF7 A;  1B59 A;  2GG9 A;  4PV4 A;  1WLR A;  4FLL A;  1Y1N A;  1C23 A;  4FO8 A;  2BWX A;  2BHA A;  1BOA A;  1QXZ A;  2BWV A;  2BHC A;  2EVC A;  2BHB A;  2GU4 A;  3FM3 A;  2BH3 A;  4OOK A;  4RZY A;  2V3Y A;  2V6C A;  3Q6D A;  4IPA A;  4ZWO A;  2GG5 A;  5CNX A;  1WL6 A;  3BIT A;  1W2M A;  3BIQ A;  3IU9 A;  4HXX A;  4IEC A;  4ZWP A;  5D6E A;  3MAT A;  5FCH A;  4ZWU A;  4FLJ A;  2G6P A;  4KM3 A;  2BN7 A;  1O0X A;  3TAV A;  4U1B A;  5FCF A;  2OKN A;  2MAT A;  4IKS A;  1C27 A;  4A6V A;  5CDV A;  1R58 A;  2GU5 A;  3FMR A;  1QZY A;  1R5G A;  2GGB A;  2Q93 A;  2Q92 A;  2Q96 A;  3D27 A;  1BN5 A;  1YVM A;  2GZ5 A;  2P99 A;  4S2T P;  1WN1 A;  4U71 A;  2GTX A;  4FLI A;  1W7V A;  2BB7 A;  1XGO A;  1A16 A;  2EA2 A;  4JUQ A;  5JFR A;  5E5B A;  2BWT A;  2GU6 A;  5D6F A;  3PKB A;  3BIP A;  1QXY A;  2V3X A;  4A6W A;  2OAZ A;  2EVM A;  3CB6 A;  4U75 A;  1B6A A;  2NQ7 A;  2Q8K A;  2GG2 A;  4IDY A;  2B3K A;  2B3H A;  1YW7 A;  3MX6 A;  4RZZ A;  1WBQ A;  4U70 A;  3L24 A;  4U6E A;  4U76 A;  3MR1 A;  4U6C A;  4FO7 A;  4MAT A;  4IU6 A;  1JAW A;  1XGN A;  1YW9 A;  2Q94 A;  4S01 A;  4IKR A;  2Q95 A;  5CDE A;  1XNZ A;  2ZSG A;  4EGE A;  4Z7M A;  2EA4 A;  4S2R P;  4PNC A;  1C21 A;  4U6Z A;  5CLS A;  2P9A A;  3IU8 A;  1N51 A;  4IKU A;  2GA2 A;  2V3Z A;  1WL9 A;  5CE6 A;  2IW2 A;  2BWW A;  3RVA A;  4FLK A;  1C22 A;  1XGS A;  2GU7 A;  2BWS A;  2ADU A;  3IU7 A;  2GG8 A;  4FUK A;  2GG0 A;  1M35 A;  4S00 A;  1R5H A;  4QR8 A;  1YJ3 A;  5JI6 A;  1KQ0 A;  4RGZ 1;  1WY2 A;  5CIK A;  4FKC A;  3PKA A;  2BHD A;  3CTZ A;  3ROR A;  1MAT A;  3TB5 A;  1C24 A;  2HOW A;  3S6B A;  4R60 A;  1XGM A;  3PKE A;  5CDL A;  5JHU A;  4ZNG A;  4U69 A;  2P98 A;  1KP0 A;  4IKT A;  1KQ9 A;  2GG3 A;  2GGC A;  3PKC A;  4U6J A;  1PV9 A;  2EVO A;  3CB5 A;  2BWU A;  3IG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...