2NQ6A

Crystal structure of human methionine aminopeptidase type 1 in complex with 3-tert-butoxycarbonylaminopyridine-2-carboxylic acid thiazole-2-ylamide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2nq6A00
4U70A 2OAZA 4RZZA 1M35A 4FO8A 2MATA 3TAVA 2B3HA 5CNXA 2BWSA 2GU6A 2Q94A 4IPAA 4ZWUA 2BWWA 1XGNA 2GU5A 2B3LA 2EVMA 3S6BA 3CTZA 3FMRA 4R60A 2HOWA 2NQ7A 4U71A 4A6WA 2Q93A 3TB5A 3CB5A 4IKSA 5FCHA 1Y1NA 1B6AA 2DFIA 2BHDA 4IKUA 1R5HA 2ZSGA 2EA4A 4U6ZA 3PKEA 1WL9A 4U1BA 1YJ3A 2Q92A 4PNCA 2V6CA 4FO7A 3BIPA 4EGEA 2IW2A 1C21A 2BHAA 1WKMA 2B3KA 2GG0A 2GGCA 3PKCA 1YW7A 3MATA 1N51A 3FMQA 4KM3A 4U6EA 1KQ9A 2BWTA 1XNZA 4IKRA 4FLJA 5E5BA 5CDVA 4FLKA 2GG5A 1R58A 1WL6A 2V3YA 2OKNA 3CB6A 2GU7A 5JI6A 5CIKA 4U76A 2G6PA 1C24A 2GG3A 2Q95A 1MATA 2Q8KA 2BN7A 5CDLA 3PKDA 1XGMA 3PKBA 1C22A 5CE6A 1WLRA 1XGOA 1YW8A 3MX6A 1XGSA 2GGBA 5FCFA 1WBQA 4S00A 4ZWOA 5JFRA 4HXXA 1W7VA 1JAWA 2P99A 3D27A 4U6WA 3BIQA 2EVOA 2BHBA 3IU8A 2GTXA 2ADUA 2BB7A 4MATA 4IU6A 2Q96A 4PV4A 3IU9A 1QZYA 2BWXA 1KP0A 1A16A 3RVAA 1YW9A 1C23A 2GG8A 4S2RP 2NQ6A 4ZNGA 2GA2A 1BOAA 5JHUA 3FM3A 4OOKA 1BN5A 3PKAA 1O0XA 1QXWA 4ZWPA 3RORA 4A6VA 2GU4A 1PV9A 1W2MA 4IDYA 3IU7A 4S2TP 3MR1A 2V3ZA 4U6CA 1WN1A 3IG4A 2P98A 2V3XA 2GG2A 2BWVA 1KQ0A 4FLIA 4QR8A 1CHMA 2BH3A 1R5GA 1QXYA 1WY2A 4Z7MA 2GG9A 5D6EA 2GZ5A 4B28A 2EVCA 5CDEA 2P9AA 2GG7A 4U69A 4RZYA 3L7GA 4IKTA 1C27A 1YVMA 3Q6DA 4JUQA 5CLSA 1B59A 2EA2A 4IECA 1QXZA 4FLLA 2BWYA 4RGZ1 3BITA 5D6FA 3L24A 4FUKA 4U73A 2BWUA 4U75A 4S01A 4IF7A 2BHCA 4U6JA 4FKCA
chains in the Genus database with same CATH superfamily
4U70A 2OAZA 4RZZA 1M35A 4FO8A 2MATA 3TAVA 2B3HA 5CNXA 2BWSA 2GU6A 2Q94A 4IPAA 4ZWUA 2BWWA 1XGNA 2GU5A 2B3LA 2EVMA 3S6BA 3CTZA 3FMRA 4R60A 2HOWA 2NQ7A 4U71A 4A6WA 2Q93A 3TB5A 3CB5A 4IKSA 5FCHA 1Y1NA 1B6AA 2DFIA 2BHDA 4IKUA 1R5HA 2ZSGA 2EA4A 4U6ZA 3PKEA 1WL9A 4U1BA 1YJ3A 2Q92A 4PNCA 2V6CA 4FO7A 3BIPA 4EGEA 2IW2A 1C21A 2BHAA 1WKMA 2B3KA 2GG0A 2GGCA 3PKCA 1YW7A 3MATA 1N51A 3FMQA 4KM3A 4U6EA 1KQ9A 2BWTA 1XNZA 4IKRA 4FLJA 5E5BA 5CDVA 4FLKA 2GG5A 1R58A 1WL6A 2V3YA 2OKNA 3CB6A 2GU7A 5JI6A 5CIKA 4U76A 2G6PA 1C24A 2GG3A 2Q95A 1MATA 2Q8KA 2BN7A 5CDLA 3PKDA 1XGMA 3PKBA 1C22A 5CE6A 1WLRA 1XGOA 1YW8A 3MX6A 1XGSA 2GGBA 5FCFA 1WBQA 4S00A 4ZWOA 5JFRA 4HXXA 1W7VA 1JAWA 2P99A 3D27A 4U6WA 3BIQA 2EVOA 2BHBA 3IU8A 2GTXA 2ADUA 2BB7A 4MATA 4IU6A 2Q96A 4PV4A 3IU9A 1QZYA 2BWXA 1KP0A 1A16A 3RVAA 1YW9A 1C23A 2GG8A 4S2RP 2NQ6A 4ZNGA 2GA2A 1BOAA 5JHUA 3FM3A 4OOKA 1BN5A 3PKAA 1O0XA 1QXWA 4ZWPA 3RORA 4A6VA 2GU4A 1PV9A 1W2MA 4IDYA 3IU7A 4S2TP 3MR1A 2V3ZA 4U6CA 1WN1A 3IG4A 2P98A 2V3XA 2GG2A 2BWVA 1KQ0A 4FLIA 4QR8A 1CHMA 2BH3A 1R5GA 1QXYA 1WY2A 4Z7MA 2GG9A 5D6EA 2GZ5A 4B28A 2EVCA 5CDEA 2P9AA 2GG7A 4U69A 4RZYA 3L7GA 4IKTA 1C27A 1YVMA 3Q6DA 4JUQA 5CLSA 1B59A 2EA2A 4IECA 1QXZA 4FLLA 2BWYA 4RGZ1 3BITA 5D6FA 3L24A 4FUKA 4U73A 2BWUA 4U75A 4S01A 4IF7A 2BHCA 4U6JA 4FKCA
chains in the Genus database with same CATH topology
4U70A 2OAZA 4RZZA 1M35A 4FO8A 2MATA 3TAVA 2B3HA 5CNXA 2BWSA 2GU6A 2Q94A 4IPAA 4ZWUA 2BWWA 1XGNA 2GU5A 2B3LA 2EVMA 3S6BA 3CTZA 3FMRA 4R60A 2HOWA 2NQ7A 4U71A 4A6WA 2Q93A 3TB5A 3CB5A 4IKSA 5FCHA 1Y1NA 1B6AA 2DFIA 2BHDA 4IKUA 1R5HA 2ZSGA 2EA4A 4U6ZA 3PKEA 1WL9A 4U1BA 1YJ3A 2Q92A 4PNCA 2V6CA 4FO7A 3BIPA 4EGEA 2IW2A 1C21A 2BHAA 1WKMA 2B3KA 2GG0A 2GGCA 3PKCA 1YW7A 3MATA 1N51A 3FMQA 4KM3A 4U6EA 1KQ9A 2BWTA 1XNZA 4IKRA 4FLJA 5E5BA 5CDVA 4FLKA 2GG5A 1R58A 1WL6A 2V3YA 2OKNA 3CB6A 2GU7A 5JI6A 5CIKA 4U76A 2G6PA 1C24A 2GG3A 2Q95A 1MATA 2Q8KA 2BN7A 5CDLA 3PKDA 1XGMA 3PKBA 1C22A 5CE6A 1WLRA 1XGOA 1YW8A 3MX6A 1XGSA 2GGBA 5FCFA 1WBQA 4S00A 4ZWOA 5JFRA 4HXXA 1W7VA 1JAWA 2P99A 3D27A 4U6WA 3BIQA 2EVOA 2BHBA 3IU8A 2GTXA 2ADUA 2BB7A 4MATA 4IU6A 2Q96A 4PV4A 3IU9A 1QZYA 2BWXA 1KP0A 1A16A 3RVAA 1YW9A 1C23A 2GG8A 4S2RP 2NQ6A 4ZNGA 2GA2A 1BOAA 5JHUA 3FM3A 4OOKA 1BN5A 3PKAA 1O0XA 1QXWA 4ZWPA 3RORA 4A6VA 2GU4A 1PV9A 1W2MA 4IDYA 3IU7A 4S2TP 3MR1A 2V3ZA 4U6CA 1WN1A 3IG4A 2P98A 2V3XA 2GG2A 2BWVA 1KQ0A 4FLIA 4QR8A 1CHMA 2BH3A 1R5GA 1QXYA 1WY2A 4Z7MA 2GG9A 5D6EA 2GZ5A 4B28A 2EVCA 5CDEA 2P9AA 2GG7A 4U69A 4RZYA 3L7GA 4IKTA 1C27A 1YVMA 3Q6DA 4JUQA 5CLSA 1B59A 2EA2A 4IECA 1QXZA 4FLLA 2BWYA 4RGZ1 3BITA 5D6FA 3L24A 4FUKA 4U73A 2BWUA 4U75A 4S01A 4IF7A 2BHCA 4U6JA 4FKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U70 A;  2OAZ A;  4RZZ A;  1M35 A;  4FO8 A;  2MAT A;  3TAV A;  2B3H A;  5CNX A;  2BWS A;  2GU6 A;  2Q94 A;  4IPA A;  4ZWU A;  2BWW A;  1XGN A;  2GU5 A;  2B3L A;  2EVM A;  3S6B A;  3CTZ A;  3FMR A;  4R60 A;  2HOW A;  2NQ7 A;  4U71 A;  4A6W A;  2Q93 A;  3TB5 A;  3CB5 A;  4IKS A;  5FCH A;  1Y1N A;  1B6A A;  2DFI A;  2BHD A;  4IKU A;  1R5H A;  2ZSG A;  2EA4 A;  4U6Z A;  3PKE A;  1WL9 A;  4U1B A;  1YJ3 A;  2Q92 A;  4PNC A;  2V6C A;  4FO7 A;  3BIP A;  4EGE A;  2IW2 A;  1C21 A;  2BHA A;  1WKM A;  2B3K A;  2GG0 A;  2GGC A;  3PKC A;  1YW7 A;  3MAT A;  1N51 A;  3FMQ A;  4KM3 A;  4U6E A;  1KQ9 A;  2BWT A;  1XNZ A;  4IKR A;  4FLJ A;  5E5B A;  5CDV A;  4FLK A;  2GG5 A;  1R58 A;  1WL6 A;  2V3Y A;  2OKN A;  3CB6 A;  2GU7 A;  5JI6 A;  5CIK A;  4U76 A;  2G6P A;  1C24 A;  2GG3 A;  2Q95 A;  1MAT A;  2Q8K A;  2BN7 A;  5CDL A;  3PKD A;  1XGM A;  3PKB A;  1C22 A;  5CE6 A;  1WLR A;  1XGO A;  1YW8 A;  3MX6 A;  1XGS A;  2GGB A;  5FCF A;  1WBQ A;  4S00 A;  4ZWO A;  5JFR A;  4HXX A;  1W7V A;  1JAW A;  2P99 A;  3D27 A;  4U6W A;  3BIQ A;  2EVO A;  2BHB A;  3IU8 A;  2GTX A;  2ADU A;  2BB7 A;  4MAT A;  4IU6 A;  2Q96 A;  4PV4 A;  3IU9 A;  1QZY A;  2BWX A;  1KP0 A;  1A16 A;  3RVA A;  1YW9 A;  1C23 A;  2GG8 A;  4S2R P;  2NQ6 A;  4ZNG A;  2GA2 A;  1BOA A;  5JHU A;  3FM3 A;  4OOK A;  1BN5 A;  3PKA A;  1O0X A;  1QXW A;  4ZWP A;  3ROR A;  4A6V A;  2GU4 A;  1PV9 A;  1W2M A;  4IDY A;  3IU7 A;  4S2T P;  3MR1 A;  2V3Z A;  4U6C A;  1WN1 A;  3IG4 A;  2P98 A;  2V3X A;  2GG2 A;  2BWV A;  1KQ0 A;  4FLI A;  4QR8 A;  1CHM A;  2BH3 A;  1R5G A;  1QXY A;  1WY2 A;  4Z7M A;  2GG9 A;  5D6E A;  2GZ5 A;  4B28 A;  2EVC A;  5CDE A;  2P9A A;  2GG7 A;  4U69 A;  4RZY A;  3L7G A;  4IKT A;  1C27 A;  1YVM A;  3Q6D A;  4JUQ A;  5CLS A;  1B59 A;  2EA2 A;  4IEC A;  1QXZ A;  4FLL A;  2BWY A;  4RGZ 1;  3BIT A;  5D6F A;  3L24 A;  4FUK A;  4U73 A;  2BWU A;  4U75 A;  4S01 A;  4IF7 A;  2BHC A;  4U6J A;  4FKC A; 
#chains in the Genus database with same CATH topology
 4U70 A;  2OAZ A;  4RZZ A;  1M35 A;  4FO8 A;  2MAT A;  3TAV A;  2B3H A;  5CNX A;  2BWS A;  2GU6 A;  2Q94 A;  4IPA A;  4ZWU A;  2BWW A;  1XGN A;  2GU5 A;  2B3L A;  2EVM A;  3S6B A;  3CTZ A;  3FMR A;  4R60 A;  2HOW A;  2NQ7 A;  4U71 A;  4A6W A;  2Q93 A;  3TB5 A;  3CB5 A;  4IKS A;  5FCH A;  1Y1N A;  1B6A A;  2DFI A;  2BHD A;  4IKU A;  1R5H A;  2ZSG A;  2EA4 A;  4U6Z A;  3PKE A;  1WL9 A;  4U1B A;  1YJ3 A;  2Q92 A;  4PNC A;  2V6C A;  4FO7 A;  3BIP A;  4EGE A;  2IW2 A;  1C21 A;  2BHA A;  1WKM A;  2B3K A;  2GG0 A;  2GGC A;  3PKC A;  1YW7 A;  3MAT A;  1N51 A;  3FMQ A;  4KM3 A;  4U6E A;  1KQ9 A;  2BWT A;  1XNZ A;  4IKR A;  4FLJ A;  5E5B A;  5CDV A;  4FLK A;  2GG5 A;  1R58 A;  1WL6 A;  2V3Y A;  2OKN A;  3CB6 A;  2GU7 A;  5JI6 A;  5CIK A;  4U76 A;  2G6P A;  1C24 A;  2GG3 A;  2Q95 A;  1MAT A;  2Q8K A;  2BN7 A;  5CDL A;  3PKD A;  1XGM A;  3PKB A;  1C22 A;  5CE6 A;  1WLR A;  1XGO A;  1YW8 A;  3MX6 A;  1XGS A;  2GGB A;  5FCF A;  1WBQ A;  4S00 A;  4ZWO A;  5JFR A;  4HXX A;  1W7V A;  1JAW A;  2P99 A;  3D27 A;  4U6W A;  3BIQ A;  2EVO A;  2BHB A;  3IU8 A;  2GTX A;  2ADU A;  2BB7 A;  4MAT A;  4IU6 A;  2Q96 A;  4PV4 A;  3IU9 A;  1QZY A;  2BWX A;  1KP0 A;  1A16 A;  3RVA A;  1YW9 A;  1C23 A;  2GG8 A;  4S2R P;  2NQ6 A;  4ZNG A;  2GA2 A;  1BOA A;  5JHU A;  3FM3 A;  4OOK A;  1BN5 A;  3PKA A;  1O0X A;  1QXW A;  4ZWP A;  3ROR A;  4A6V A;  2GU4 A;  1PV9 A;  1W2M A;  4IDY A;  3IU7 A;  4S2T P;  3MR1 A;  2V3Z A;  4U6C A;  1WN1 A;  3IG4 A;  2P98 A;  2V3X A;  2GG2 A;  2BWV A;  1KQ0 A;  4FLI A;  4QR8 A;  1CHM A;  2BH3 A;  1R5G A;  1QXY A;  1WY2 A;  4Z7M A;  2GG9 A;  5D6E A;  2GZ5 A;  4B28 A;  2EVC A;  5CDE A;  2P9A A;  2GG7 A;  4U69 A;  4RZY A;  3L7G A;  4IKT A;  1C27 A;  1YVM A;  3Q6D A;  4JUQ A;  5CLS A;  1B59 A;  2EA2 A;  4IEC A;  1QXZ A;  4FLL A;  2BWY A;  4RGZ 1;  3BIT A;  5D6F A;  3L24 A;  4FUK A;  4U73 A;  2BWU A;  4U75 A;  4S01 A;  4IF7 A;  2BHC A;  4U6J A;  4FKC A; 
#chains in the Genus database with same CATH homology
 4U70 A;  2OAZ A;  4RZZ A;  1M35 A;  4FO8 A;  2MAT A;  3TAV A;  2B3H A;  5CNX A;  2BWS A;  2GU6 A;  2Q94 A;  4IPA A;  4ZWU A;  2BWW A;  1XGN A;  2GU5 A;  2B3L A;  2EVM A;  3S6B A;  3CTZ A;  3FMR A;  4R60 A;  2HOW A;  2NQ7 A;  4U71 A;  4A6W A;  2Q93 A;  3TB5 A;  3CB5 A;  4IKS A;  5FCH A;  1Y1N A;  1B6A A;  2DFI A;  2BHD A;  4IKU A;  1R5H A;  2ZSG A;  2EA4 A;  4U6Z A;  3PKE A;  1WL9 A;  4U1B A;  1YJ3 A;  2Q92 A;  4PNC A;  2V6C A;  4FO7 A;  3BIP A;  4EGE A;  2IW2 A;  1C21 A;  2BHA A;  1WKM A;  2B3K A;  2GG0 A;  2GGC A;  3PKC A;  1YW7 A;  3MAT A;  1N51 A;  3FMQ A;  4KM3 A;  4U6E A;  1KQ9 A;  2BWT A;  1XNZ A;  4IKR A;  4FLJ A;  5E5B A;  5CDV A;  4FLK A;  2GG5 A;  1R58 A;  1WL6 A;  2V3Y A;  2OKN A;  3CB6 A;  2GU7 A;  5JI6 A;  5CIK A;  4U76 A;  2G6P A;  1C24 A;  2GG3 A;  2Q95 A;  1MAT A;  2Q8K A;  2BN7 A;  5CDL A;  3PKD A;  1XGM A;  3PKB A;  1C22 A;  5CE6 A;  1WLR A;  1XGO A;  1YW8 A;  3MX6 A;  1XGS A;  2GGB A;  5FCF A;  1WBQ A;  4S00 A;  4ZWO A;  5JFR A;  4HXX A;  1W7V A;  1JAW A;  2P99 A;  3D27 A;  4U6W A;  3BIQ A;  2EVO A;  2BHB A;  3IU8 A;  2GTX A;  2ADU A;  2BB7 A;  4MAT A;  4IU6 A;  2Q96 A;  4PV4 A;  3IU9 A;  1QZY A;  2BWX A;  1KP0 A;  1A16 A;  3RVA A;  1YW9 A;  1C23 A;  2GG8 A;  4S2R P;  2NQ6 A;  4ZNG A;  2GA2 A;  1BOA A;  5JHU A;  3FM3 A;  4OOK A;  1BN5 A;  3PKA A;  1O0X A;  1QXW A;  4ZWP A;  3ROR A;  4A6V A;  2GU4 A;  1PV9 A;  1W2M A;  4IDY A;  3IU7 A;  4S2T P;  3MR1 A;  2V3Z A;  4U6C A;  1WN1 A;  3IG4 A;  2P98 A;  2V3X A;  2GG2 A;  2BWV A;  1KQ0 A;  4FLI A;  4QR8 A;  1CHM A;  2BH3 A;  1R5G A;  1QXY A;  1WY2 A;  4Z7M A;  2GG9 A;  5D6E A;  2GZ5 A;  4B28 A;  2EVC A;  5CDE A;  2P9A A;  2GG7 A;  4U69 A;  4RZY A;  3L7G A;  4IKT A;  1C27 A;  1YVM A;  3Q6D A;  4JUQ A;  5CLS A;  1B59 A;  2EA2 A;  4IEC A;  1QXZ A;  4FLL A;  2BWY A;  4RGZ 1;  3BIT A;  5D6F A;  3L24 A;  4FUK A;  4U73 A;  2BWU A;  4U75 A;  4S01 A;  4IF7 A;  2BHC A;  4U6J A;  4FKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...