2NQ6A

Crystal structure of human methionine aminopeptidase type 1 in complex with 3-tert-butoxycarbonylaminopyridine-2-carboxylic acid thiazole-2-ylamide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Elucidation of the function of type 1 human methionine aminopeptidase during cell cycle progression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2nq6A00
1O0XA 4IU6A 4RGZ1 1XNZA 1XGMA 1PV9A 2EVCA 3FMRA 4IKRA 5JI6A 4FLJA 3BIPA 2GG2A 3D27A 2GU4A 3IU9A 1QZYA 2BH3A 1WLRA 1XGSA 3CB5A 4U69A 1QXYA 2GU7A 4HXXA 4FUKA 3L7GA 3PKAA 2BWXA 2V3XA 2BWVA 1YW7A 4U6JA 5CNXA 2Q96A 3RVAA 1BN5A 4A6VA 1C27A 3TB5A 1R58A 1R5GA 1YVMA 2V3ZA 4FLLA 2MATA 4U6CA 2GG7A 4PV4A 5CDEA 2EVMA 1W7VA 2BB7A 4EGEA 2OKNA 4IKSA 4IKUA 4B28A 1WL6A 3CTZA 3MX6A 4S2TP 2B3LA 4JUQA 3TAVA 2V3YA 2BHDA 4FLKA 5D6EA 2IW2A 1KP0A 2GG9A 2GGBA 4S2RP 3PKEA 2P99A 2P9AA 3BIQA 4IKTA 3CB6A 1WKMA 1B6AA 2BN7A 2B3HA 3IG4A 2BHAA 2BWSA 2GG3A 4QR8A 4RZYA 1WBQA 1Y1NA 4IDYA 4U75A 1C24A 2B3KA 4PNCA 4OOKA 3PKDA 3MR1A 4FLIA 4ZNGA 1C23A 2EVOA 4ZWOA 5CE6A 1XGNA 1YJ3A 2HOWA 1CHMA 4U1BA 1C22A 1QXWA 4U6EA 1WL9A 2GU5A 5CIKA 4U71A 3MATA 1WY2A 1MATA 3Q6DA 4S01A 4R60A 1WN1A 2ADUA 4IF7A 5CDVA 2GZ5A 1QXZA 1XGOA 4MATA 5FCFA 2GU6A 1A16A 5FCHA 4ZWPA 4ZWUA 1KQ9A 2G6PA 5JFRA 1N51A 1C21A 2GTXA 2BWTA 2GGCA 4FKCA 2BHCA 1BOAA 2EA4A 2BWUA 2NQ6A 3FMQA 3IU7A 1R5HA 4U76A 2BWYA 2ZSGA 4U6ZA 2OAZA 5D6FA 2DFIA 2GG0A 2Q94A 3RORA 4IPAA 1W2MA 2BHBA 1M35A 1YW8A 2BWWA 2GG5A 2NQ7A 3IU8A 2V6CA 2Q93A 4U73A 1JAWA 3PKBA 5E5BA 5CDLA 2Q95A 4S00A 4Z7MA 3L24A 2GG8A 4RZZA 1B59A 4A6WA 1KQ0A 4U6WA 4U70A 5CLSA 4KM3A 2Q8KA 3FM3A 2EA2A 4FO8A 5JHUA 2P98A 3BITA 4IECA 1YW9A 4FO7A 2Q92A 2GA2A 3PKCA 3S6BA
chains in the Genus database with same CATH superfamily
1O0XA 4IU6A 4RGZ1 1XNZA 1XGMA 1PV9A 2EVCA 3FMRA 4IKRA 5JI6A 4FLJA 3BIPA 2GG2A 3D27A 2GU4A 3IU9A 1QZYA 2BH3A 1WLRA 1XGSA 3CB5A 4U69A 1QXYA 2GU7A 4HXXA 4FUKA 3L7GA 3PKAA 2BWXA 2V3XA 2BWVA 1YW7A 4U6JA 5CNXA 2Q96A 3RVAA 1BN5A 4A6VA 1C27A 3TB5A 1R58A 1R5GA 1YVMA 2V3ZA 4FLLA 2MATA 4U6CA 2GG7A 4PV4A 5CDEA 2EVMA 1W7VA 2BB7A 4EGEA 2OKNA 4IKSA 4IKUA 4B28A 1WL6A 3CTZA 3MX6A 4S2TP 2B3LA 4JUQA 3TAVA 2V3YA 2BHDA 4FLKA 5D6EA 2IW2A 1KP0A 2GG9A 2GGBA 4S2RP 3PKEA 2P99A 2P9AA 3BIQA 4IKTA 3CB6A 1WKMA 1B6AA 2BN7A 2B3HA 3IG4A 2BHAA 2BWSA 2GG3A 4QR8A 4RZYA 1WBQA 1Y1NA 4IDYA 4U75A 1C24A 2B3KA 4PNCA 4OOKA 3PKDA 3MR1A 4FLIA 4ZNGA 1C23A 2EVOA 4ZWOA 5CE6A 1XGNA 1YJ3A 2HOWA 1CHMA 4U1BA 1C22A 1QXWA 4U6EA 1WL9A 2GU5A 5CIKA 4U71A 3MATA 1WY2A 1MATA 3Q6DA 4S01A 4R60A 1WN1A 2ADUA 4IF7A 5CDVA 2GZ5A 1QXZA 1XGOA 4MATA 5FCFA 2GU6A 1A16A 5FCHA 4ZWPA 4ZWUA 1KQ9A 2G6PA 5JFRA 1N51A 1C21A 2GTXA 2BWTA 2GGCA 4FKCA 2BHCA 1BOAA 2EA4A 2BWUA 2NQ6A 3FMQA 3IU7A 1R5HA 4U76A 2BWYA 2ZSGA 4U6ZA 2OAZA 5D6FA 2DFIA 2GG0A 2Q94A 3RORA 4IPAA 1W2MA 2BHBA 1M35A 1YW8A 2BWWA 2GG5A 2NQ7A 3IU8A 2V6CA 2Q93A 4U73A 1JAWA 3PKBA 5E5BA 5CDLA 2Q95A 4S00A 4Z7MA 3L24A 2GG8A 4RZZA 1B59A 4A6WA 1KQ0A 4U6WA 4U70A 5CLSA 4KM3A 2Q8KA 3FM3A 2EA2A 4FO8A 5JHUA 2P98A 3BITA 4IECA 1YW9A 4FO7A 2Q92A 2GA2A 3PKCA 3S6BA
chains in the Genus database with same CATH topology
1O0XA 4IU6A 4RGZ1 1XNZA 1XGMA 1PV9A 2EVCA 3FMRA 4IKRA 5JI6A 4FLJA 3BIPA 2GG2A 3D27A 2GU4A 3IU9A 1QZYA 2BH3A 1WLRA 1XGSA 3CB5A 4U69A 1QXYA 2GU7A 4HXXA 4FUKA 3L7GA 3PKAA 2BWXA 2V3XA 2BWVA 1YW7A 4U6JA 5CNXA 2Q96A 3RVAA 1BN5A 4A6VA 1C27A 3TB5A 1R58A 1R5GA 1YVMA 2V3ZA 4FLLA 2MATA 4U6CA 2GG7A 4PV4A 5CDEA 2EVMA 1W7VA 2BB7A 4EGEA 2OKNA 4IKSA 4IKUA 4B28A 1WL6A 3CTZA 3MX6A 4S2TP 2B3LA 4JUQA 3TAVA 2V3YA 2BHDA 4FLKA 5D6EA 2IW2A 1KP0A 2GG9A 2GGBA 4S2RP 3PKEA 2P99A 2P9AA 3BIQA 4IKTA 3CB6A 1WKMA 1B6AA 2BN7A 2B3HA 3IG4A 2BHAA 2BWSA 2GG3A 4QR8A 4RZYA 1WBQA 1Y1NA 4IDYA 4U75A 1C24A 2B3KA 4PNCA 4OOKA 3PKDA 3MR1A 4FLIA 4ZNGA 1C23A 2EVOA 4ZWOA 5CE6A 1XGNA 1YJ3A 2HOWA 1CHMA 4U1BA 1C22A 1QXWA 4U6EA 1WL9A 2GU5A 5CIKA 4U71A 3MATA 1WY2A 1MATA 3Q6DA 4S01A 4R60A 1WN1A 2ADUA 4IF7A 5CDVA 2GZ5A 1QXZA 1XGOA 4MATA 5FCFA 2GU6A 1A16A 5FCHA 4ZWPA 4ZWUA 1KQ9A 2G6PA 5JFRA 1N51A 1C21A 2GTXA 2BWTA 2GGCA 4FKCA 2BHCA 1BOAA 2EA4A 2BWUA 2NQ6A 3FMQA 3IU7A 1R5HA 4U76A 2BWYA 2ZSGA 4U6ZA 2OAZA 5D6FA 2DFIA 2GG0A 2Q94A 3RORA 4IPAA 1W2MA 2BHBA 1M35A 1YW8A 2BWWA 2GG5A 2NQ7A 3IU8A 2V6CA 2Q93A 4U73A 1JAWA 3PKBA 5E5BA 5CDLA 2Q95A 4S00A 4Z7MA 3L24A 2GG8A 4RZZA 1B59A 4A6WA 1KQ0A 4U6WA 4U70A 5CLSA 4KM3A 2Q8KA 3FM3A 2EA2A 4FO8A 5JHUA 2P98A 3BITA 4IECA 1YW9A 4FO7A 2Q92A 2GA2A 3PKCA 3S6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0X A;  4IU6 A;  4RGZ 1;  1XNZ A;  1XGM A;  1PV9 A;  2EVC A;  3FMR A;  4IKR A;  5JI6 A;  4FLJ A;  3BIP A;  2GG2 A;  3D27 A;  2GU4 A;  3IU9 A;  1QZY A;  2BH3 A;  1WLR A;  1XGS A;  3CB5 A;  4U69 A;  1QXY A;  2GU7 A;  4HXX A;  4FUK A;  3L7G A;  3PKA A;  2BWX A;  2V3X A;  2BWV A;  1YW7 A;  4U6J A;  5CNX A;  2Q96 A;  3RVA A;  1BN5 A;  4A6V A;  1C27 A;  3TB5 A;  1R58 A;  1R5G A;  1YVM A;  2V3Z A;  4FLL A;  2MAT A;  4U6C A;  2GG7 A;  4PV4 A;  5CDE A;  2EVM A;  1W7V A;  2BB7 A;  4EGE A;  2OKN A;  4IKS A;  4IKU A;  4B28 A;  1WL6 A;  3CTZ A;  3MX6 A;  4S2T P;  2B3L A;  4JUQ A;  3TAV A;  2V3Y A;  2BHD A;  4FLK A;  5D6E A;  2IW2 A;  1KP0 A;  2GG9 A;  2GGB A;  4S2R P;  3PKE A;  2P99 A;  2P9A A;  3BIQ A;  4IKT A;  3CB6 A;  1WKM A;  1B6A A;  2BN7 A;  2B3H A;  3IG4 A;  2BHA A;  2BWS A;  2GG3 A;  4QR8 A;  4RZY A;  1WBQ A;  1Y1N A;  4IDY A;  4U75 A;  1C24 A;  2B3K A;  4PNC A;  4OOK A;  3PKD A;  3MR1 A;  4FLI A;  4ZNG A;  1C23 A;  2EVO A;  4ZWO A;  5CE6 A;  1XGN A;  1YJ3 A;  2HOW A;  1CHM A;  4U1B A;  1C22 A;  1QXW A;  4U6E A;  1WL9 A;  2GU5 A;  5CIK A;  4U71 A;  3MAT A;  1WY2 A;  1MAT A;  3Q6D A;  4S01 A;  4R60 A;  1WN1 A;  2ADU A;  4IF7 A;  5CDV A;  2GZ5 A;  1QXZ A;  1XGO A;  4MAT A;  5FCF A;  2GU6 A;  1A16 A;  5FCH A;  4ZWP A;  4ZWU A;  1KQ9 A;  2G6P A;  5JFR A;  1N51 A;  1C21 A;  2GTX A;  2BWT A;  2GGC A;  4FKC A;  2BHC A;  1BOA A;  2EA4 A;  2BWU A;  2NQ6 A;  3FMQ A;  3IU7 A;  1R5H A;  4U76 A;  2BWY A;  2ZSG A;  4U6Z A;  2OAZ A;  5D6F A;  2DFI A;  2GG0 A;  2Q94 A;  3ROR A;  4IPA A;  1W2M A;  2BHB A;  1M35 A;  1YW8 A;  2BWW A;  2GG5 A;  2NQ7 A;  3IU8 A;  2V6C A;  2Q93 A;  4U73 A;  1JAW A;  3PKB A;  5E5B A;  5CDL A;  2Q95 A;  4S00 A;  4Z7M A;  3L24 A;  2GG8 A;  4RZZ A;  1B59 A;  4A6W A;  1KQ0 A;  4U6W A;  4U70 A;  5CLS A;  4KM3 A;  2Q8K A;  3FM3 A;  2EA2 A;  4FO8 A;  5JHU A;  2P98 A;  3BIT A;  4IEC A;  1YW9 A;  4FO7 A;  2Q92 A;  2GA2 A;  3PKC A;  3S6B A; 
#chains in the Genus database with same CATH topology
 1O0X A;  4IU6 A;  4RGZ 1;  1XNZ A;  1XGM A;  1PV9 A;  2EVC A;  3FMR A;  4IKR A;  5JI6 A;  4FLJ A;  3BIP A;  2GG2 A;  3D27 A;  2GU4 A;  3IU9 A;  1QZY A;  2BH3 A;  1WLR A;  1XGS A;  3CB5 A;  4U69 A;  1QXY A;  2GU7 A;  4HXX A;  4FUK A;  3L7G A;  3PKA A;  2BWX A;  2V3X A;  2BWV A;  1YW7 A;  4U6J A;  5CNX A;  2Q96 A;  3RVA A;  1BN5 A;  4A6V A;  1C27 A;  3TB5 A;  1R58 A;  1R5G A;  1YVM A;  2V3Z A;  4FLL A;  2MAT A;  4U6C A;  2GG7 A;  4PV4 A;  5CDE A;  2EVM A;  1W7V A;  2BB7 A;  4EGE A;  2OKN A;  4IKS A;  4IKU A;  4B28 A;  1WL6 A;  3CTZ A;  3MX6 A;  4S2T P;  2B3L A;  4JUQ A;  3TAV A;  2V3Y A;  2BHD A;  4FLK A;  5D6E A;  2IW2 A;  1KP0 A;  2GG9 A;  2GGB A;  4S2R P;  3PKE A;  2P99 A;  2P9A A;  3BIQ A;  4IKT A;  3CB6 A;  1WKM A;  1B6A A;  2BN7 A;  2B3H A;  3IG4 A;  2BHA A;  2BWS A;  2GG3 A;  4QR8 A;  4RZY A;  1WBQ A;  1Y1N A;  4IDY A;  4U75 A;  1C24 A;  2B3K A;  4PNC A;  4OOK A;  3PKD A;  3MR1 A;  4FLI A;  4ZNG A;  1C23 A;  2EVO A;  4ZWO A;  5CE6 A;  1XGN A;  1YJ3 A;  2HOW A;  1CHM A;  4U1B A;  1C22 A;  1QXW A;  4U6E A;  1WL9 A;  2GU5 A;  5CIK A;  4U71 A;  3MAT A;  1WY2 A;  1MAT A;  3Q6D A;  4S01 A;  4R60 A;  1WN1 A;  2ADU A;  4IF7 A;  5CDV A;  2GZ5 A;  1QXZ A;  1XGO A;  4MAT A;  5FCF A;  2GU6 A;  1A16 A;  5FCH A;  4ZWP A;  4ZWU A;  1KQ9 A;  2G6P A;  5JFR A;  1N51 A;  1C21 A;  2GTX A;  2BWT A;  2GGC A;  4FKC A;  2BHC A;  1BOA A;  2EA4 A;  2BWU A;  2NQ6 A;  3FMQ A;  3IU7 A;  1R5H A;  4U76 A;  2BWY A;  2ZSG A;  4U6Z A;  2OAZ A;  5D6F A;  2DFI A;  2GG0 A;  2Q94 A;  3ROR A;  4IPA A;  1W2M A;  2BHB A;  1M35 A;  1YW8 A;  2BWW A;  2GG5 A;  2NQ7 A;  3IU8 A;  2V6C A;  2Q93 A;  4U73 A;  1JAW A;  3PKB A;  5E5B A;  5CDL A;  2Q95 A;  4S00 A;  4Z7M A;  3L24 A;  2GG8 A;  4RZZ A;  1B59 A;  4A6W A;  1KQ0 A;  4U6W A;  4U70 A;  5CLS A;  4KM3 A;  2Q8K A;  3FM3 A;  2EA2 A;  4FO8 A;  5JHU A;  2P98 A;  3BIT A;  4IEC A;  1YW9 A;  4FO7 A;  2Q92 A;  2GA2 A;  3PKC A;  3S6B A; 
#chains in the Genus database with same CATH homology
 1O0X A;  4IU6 A;  4RGZ 1;  1XNZ A;  1XGM A;  1PV9 A;  2EVC A;  3FMR A;  4IKR A;  5JI6 A;  4FLJ A;  3BIP A;  2GG2 A;  3D27 A;  2GU4 A;  3IU9 A;  1QZY A;  2BH3 A;  1WLR A;  1XGS A;  3CB5 A;  4U69 A;  1QXY A;  2GU7 A;  4HXX A;  4FUK A;  3L7G A;  3PKA A;  2BWX A;  2V3X A;  2BWV A;  1YW7 A;  4U6J A;  5CNX A;  2Q96 A;  3RVA A;  1BN5 A;  4A6V A;  1C27 A;  3TB5 A;  1R58 A;  1R5G A;  1YVM A;  2V3Z A;  4FLL A;  2MAT A;  4U6C A;  2GG7 A;  4PV4 A;  5CDE A;  2EVM A;  1W7V A;  2BB7 A;  4EGE A;  2OKN A;  4IKS A;  4IKU A;  4B28 A;  1WL6 A;  3CTZ A;  3MX6 A;  4S2T P;  2B3L A;  4JUQ A;  3TAV A;  2V3Y A;  2BHD A;  4FLK A;  5D6E A;  2IW2 A;  1KP0 A;  2GG9 A;  2GGB A;  4S2R P;  3PKE A;  2P99 A;  2P9A A;  3BIQ A;  4IKT A;  3CB6 A;  1WKM A;  1B6A A;  2BN7 A;  2B3H A;  3IG4 A;  2BHA A;  2BWS A;  2GG3 A;  4QR8 A;  4RZY A;  1WBQ A;  1Y1N A;  4IDY A;  4U75 A;  1C24 A;  2B3K A;  4PNC A;  4OOK A;  3PKD A;  3MR1 A;  4FLI A;  4ZNG A;  1C23 A;  2EVO A;  4ZWO A;  5CE6 A;  1XGN A;  1YJ3 A;  2HOW A;  1CHM A;  4U1B A;  1C22 A;  1QXW A;  4U6E A;  1WL9 A;  2GU5 A;  5CIK A;  4U71 A;  3MAT A;  1WY2 A;  1MAT A;  3Q6D A;  4S01 A;  4R60 A;  1WN1 A;  2ADU A;  4IF7 A;  5CDV A;  2GZ5 A;  1QXZ A;  1XGO A;  4MAT A;  5FCF A;  2GU6 A;  1A16 A;  5FCH A;  4ZWP A;  4ZWU A;  1KQ9 A;  2G6P A;  5JFR A;  1N51 A;  1C21 A;  2GTX A;  2BWT A;  2GGC A;  4FKC A;  2BHC A;  1BOA A;  2EA4 A;  2BWU A;  2NQ6 A;  3FMQ A;  3IU7 A;  1R5H A;  4U76 A;  2BWY A;  2ZSG A;  4U6Z A;  2OAZ A;  5D6F A;  2DFI A;  2GG0 A;  2Q94 A;  3ROR A;  4IPA A;  1W2M A;  2BHB A;  1M35 A;  1YW8 A;  2BWW A;  2GG5 A;  2NQ7 A;  3IU8 A;  2V6C A;  2Q93 A;  4U73 A;  1JAW A;  3PKB A;  5E5B A;  5CDL A;  2Q95 A;  4S00 A;  4Z7M A;  3L24 A;  2GG8 A;  4RZZ A;  1B59 A;  4A6W A;  1KQ0 A;  4U6W A;  4U70 A;  5CLS A;  4KM3 A;  2Q8K A;  3FM3 A;  2EA2 A;  4FO8 A;  5JHU A;  2P98 A;  3BIT A;  4IEC A;  1YW9 A;  4FO7 A;  2Q92 A;  2GA2 A;  3PKC A;  3S6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...