4U6ZA

Hsmetap(f309m) in complex with 1-amino-2-propylpentyl)phosphonic acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6zA00
4A6VA 1Y1NA 2Q92A 3TAVA 4RZYA 3L24A 5D6EA 2V6CA 4OOKA 2V3YA 4U73A 2B3KA 2Q96A 2BH3A 3Q6DA 4IDYA 1WKMA 1XNZA 4KM3A 1C21A 1YVMA 4MATA 4U69A 2EVMA 5CDEA 4EGEA 1M35A 2MATA 1KQ9A 2GU6A 4ZWUA 1BN5A 2ZSGA 2G6PA 2Q94A 2OKNA 2GG7A 1R58A 4IKUA 1C24A 5FCFA 2BHAA 4B28A 1QXWA 4JUQA 3MX6A 2EA2A 4R60A 2GG9A 3PKDA 1B59A 1R5GA 4S01A 5CNXA 5JHUA 3PKAA 4FLKA 4PV4A 2IW2A 1JAWA 3IU8A 4IF7A 3BIQA 2GU7A 2Q8KA 2GU4A 1W2MA 2B3LA 3MATA 2V3ZA 2GA2A 2GG5A 5E5BA 2BWUA 4ZWOA 4FLLA 2ADUA 2NQ6A 2Q93A 1QZYA 2BWTA 1WBQA 2B3HA 2BWVA 3S6BA 4Z7MA 3RVAA 1WY2A 1QXZA 2GG8A 2BWWA 2GGBA 4U1BA 3D27A 3IU9A 2V3XA 1CHMA 1BOAA 4IKTA 4S00A 5CIKA 4U6ZA 3IU7A 4U6JA 4A6WA 3PKBA 1W7VA 2HOWA 2BWSA 1B6AA 3FM3A 4FLJA 2GU5A 4U71A 2BHBA 4HXXA 5CLSA 3FMRA 2GGCA 1KQ0A 2GZ5A 3BITA 4IU6A 2GG0A 1WN1A 2NQ7A 3FMQA 3PKCA 3TB5A 5CE6A 4S2RP 1WL9A 4IECA 2P98A 2DFIA 4U70A 1YW7A 4PNCA 5D6FA 1WLRA 4U76A 1A16A 2BB7A 3RORA 5CDLA 5JI6A 2BHCA 3MR1A 4IKRA 1XGNA 3IG4A 4RZZA 2BWYA 4U6WA 4FLIA 1QXYA 1XGSA 1N51A 2EVOA 3CB5A 4QR8A 2GTXA 3PKEA 2BN7A 4ZWPA 1WL6A 4IKSA 2P99A 4FO8A 4RGZ1 4FUKA 1C22A 4IPAA 1YW8A 3CTZA 1R5HA 4U75A 1PV9A 2GG3A 1YJ3A 3L7GA 5FCHA 1XGOA 1XGMA 4U6EA 5JFRA 3BIPA 1O0XA 4U6CA 4FKCA 2P9AA 2OAZA 4FO7A 2BHDA 2Q95A 2BWXA 4S2TP 3CB6A 4ZNGA 5CDVA 1YW9A 1KP0A 1C23A 1C27A 2GG2A 2EVCA 2EA4A 1MATA
chains in the Genus database with same CATH superfamily
4A6VA 1Y1NA 2Q92A 3TAVA 4RZYA 3L24A 5D6EA 2V6CA 4OOKA 2V3YA 4U73A 2B3KA 2Q96A 2BH3A 3Q6DA 4IDYA 1WKMA 1XNZA 4KM3A 1C21A 1YVMA 4MATA 4U69A 2EVMA 5CDEA 4EGEA 1M35A 2MATA 1KQ9A 2GU6A 4ZWUA 1BN5A 2ZSGA 2G6PA 2Q94A 2OKNA 2GG7A 1R58A 4IKUA 1C24A 5FCFA 2BHAA 4B28A 1QXWA 4JUQA 3MX6A 2EA2A 4R60A 2GG9A 3PKDA 1B59A 1R5GA 4S01A 5CNXA 5JHUA 3PKAA 4FLKA 4PV4A 2IW2A 1JAWA 3IU8A 4IF7A 3BIQA 2GU7A 2Q8KA 2GU4A 1W2MA 2B3LA 3MATA 2V3ZA 2GA2A 2GG5A 5E5BA 2BWUA 4ZWOA 4FLLA 2ADUA 2NQ6A 2Q93A 1QZYA 2BWTA 1WBQA 2B3HA 2BWVA 3S6BA 4Z7MA 3RVAA 1WY2A 1QXZA 2GG8A 2BWWA 2GGBA 4U1BA 3D27A 3IU9A 2V3XA 1CHMA 1BOAA 4IKTA 4S00A 5CIKA 4U6ZA 3IU7A 4U6JA 4A6WA 3PKBA 1W7VA 2HOWA 2BWSA 1B6AA 3FM3A 4FLJA 2GU5A 4U71A 2BHBA 4HXXA 5CLSA 3FMRA 2GGCA 1KQ0A 2GZ5A 3BITA 4IU6A 2GG0A 1WN1A 2NQ7A 3FMQA 3PKCA 3TB5A 5CE6A 4S2RP 1WL9A 4IECA 2P98A 2DFIA 4U70A 1YW7A 4PNCA 5D6FA 1WLRA 4U76A 1A16A 2BB7A 3RORA 5CDLA 5JI6A 2BHCA 3MR1A 4IKRA 1XGNA 3IG4A 4RZZA 2BWYA 4U6WA 4FLIA 1QXYA 1XGSA 1N51A 2EVOA 3CB5A 4QR8A 2GTXA 3PKEA 2BN7A 4ZWPA 1WL6A 4IKSA 2P99A 4FO8A 4RGZ1 4FUKA 1C22A 4IPAA 1YW8A 3CTZA 1R5HA 4U75A 1PV9A 2GG3A 1YJ3A 3L7GA 5FCHA 1XGOA 1XGMA 4U6EA 5JFRA 3BIPA 1O0XA 4U6CA 4FKCA 2P9AA 2OAZA 4FO7A 2BHDA 2Q95A 2BWXA 4S2TP 3CB6A 4ZNGA 5CDVA 1YW9A 1KP0A 1C23A 1C27A 2GG2A 2EVCA 2EA4A 1MATA
chains in the Genus database with same CATH topology
4A6VA 1Y1NA 2Q92A 3TAVA 4RZYA 3L24A 5D6EA 2V6CA 4OOKA 2V3YA 4U73A 2B3KA 2Q96A 2BH3A 3Q6DA 4IDYA 1WKMA 1XNZA 4KM3A 1C21A 1YVMA 4MATA 4U69A 2EVMA 5CDEA 4EGEA 1M35A 2MATA 1KQ9A 2GU6A 4ZWUA 1BN5A 2ZSGA 2G6PA 2Q94A 2OKNA 2GG7A 1R58A 4IKUA 1C24A 5FCFA 2BHAA 4B28A 1QXWA 4JUQA 3MX6A 2EA2A 4R60A 2GG9A 3PKDA 1B59A 1R5GA 4S01A 5CNXA 5JHUA 3PKAA 4FLKA 4PV4A 2IW2A 1JAWA 3IU8A 4IF7A 3BIQA 2GU7A 2Q8KA 2GU4A 1W2MA 2B3LA 3MATA 2V3ZA 2GA2A 2GG5A 5E5BA 2BWUA 4ZWOA 4FLLA 2ADUA 2NQ6A 2Q93A 1QZYA 2BWTA 1WBQA 2B3HA 2BWVA 3S6BA 4Z7MA 3RVAA 1WY2A 1QXZA 2GG8A 2BWWA 2GGBA 4U1BA 3D27A 3IU9A 2V3XA 1CHMA 1BOAA 4IKTA 4S00A 5CIKA 4U6ZA 3IU7A 4U6JA 4A6WA 3PKBA 1W7VA 2HOWA 2BWSA 1B6AA 3FM3A 4FLJA 2GU5A 4U71A 2BHBA 4HXXA 5CLSA 3FMRA 2GGCA 1KQ0A 2GZ5A 3BITA 4IU6A 2GG0A 1WN1A 2NQ7A 3FMQA 3PKCA 3TB5A 5CE6A 4S2RP 1WL9A 4IECA 2P98A 2DFIA 4U70A 1YW7A 4PNCA 5D6FA 1WLRA 4U76A 1A16A 2BB7A 3RORA 5CDLA 5JI6A 2BHCA 3MR1A 4IKRA 1XGNA 3IG4A 4RZZA 2BWYA 4U6WA 4FLIA 1QXYA 1XGSA 1N51A 2EVOA 3CB5A 4QR8A 2GTXA 3PKEA 2BN7A 4ZWPA 1WL6A 4IKSA 2P99A 4FO8A 4RGZ1 4FUKA 1C22A 4IPAA 1YW8A 3CTZA 1R5HA 4U75A 1PV9A 2GG3A 1YJ3A 3L7GA 5FCHA 1XGOA 1XGMA 4U6EA 5JFRA 3BIPA 1O0XA 4U6CA 4FKCA 2P9AA 2OAZA 4FO7A 2BHDA 2Q95A 2BWXA 4S2TP 3CB6A 4ZNGA 5CDVA 1YW9A 1KP0A 1C23A 1C27A 2GG2A 2EVCA 2EA4A 1MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6V A;  1Y1N A;  2Q92 A;  3TAV A;  4RZY A;  3L24 A;  5D6E A;  2V6C A;  4OOK A;  2V3Y A;  4U73 A;  2B3K A;  2Q96 A;  2BH3 A;  3Q6D A;  4IDY A;  1WKM A;  1XNZ A;  4KM3 A;  1C21 A;  1YVM A;  4MAT A;  4U69 A;  2EVM A;  5CDE A;  4EGE A;  1M35 A;  2MAT A;  1KQ9 A;  2GU6 A;  4ZWU A;  1BN5 A;  2ZSG A;  2G6P A;  2Q94 A;  2OKN A;  2GG7 A;  1R58 A;  4IKU A;  1C24 A;  5FCF A;  2BHA A;  4B28 A;  1QXW A;  4JUQ A;  3MX6 A;  2EA2 A;  4R60 A;  2GG9 A;  3PKD A;  1B59 A;  1R5G A;  4S01 A;  5CNX A;  5JHU A;  3PKA A;  4FLK A;  4PV4 A;  2IW2 A;  1JAW A;  3IU8 A;  4IF7 A;  3BIQ A;  2GU7 A;  2Q8K A;  2GU4 A;  1W2M A;  2B3L A;  3MAT A;  2V3Z A;  2GA2 A;  2GG5 A;  5E5B A;  2BWU A;  4ZWO A;  4FLL A;  2ADU A;  2NQ6 A;  2Q93 A;  1QZY A;  2BWT A;  1WBQ A;  2B3H A;  2BWV A;  3S6B A;  4Z7M A;  3RVA A;  1WY2 A;  1QXZ A;  2GG8 A;  2BWW A;  2GGB A;  4U1B A;  3D27 A;  3IU9 A;  2V3X A;  1CHM A;  1BOA A;  4IKT A;  4S00 A;  5CIK A;  4U6Z A;  3IU7 A;  4U6J A;  4A6W A;  3PKB A;  1W7V A;  2HOW A;  2BWS A;  1B6A A;  3FM3 A;  4FLJ A;  2GU5 A;  4U71 A;  2BHB A;  4HXX A;  5CLS A;  3FMR A;  2GGC A;  1KQ0 A;  2GZ5 A;  3BIT A;  4IU6 A;  2GG0 A;  1WN1 A;  2NQ7 A;  3FMQ A;  3PKC A;  3TB5 A;  5CE6 A;  4S2R P;  1WL9 A;  4IEC A;  2P98 A;  2DFI A;  4U70 A;  1YW7 A;  4PNC A;  5D6F A;  1WLR A;  4U76 A;  1A16 A;  2BB7 A;  3ROR A;  5CDL A;  5JI6 A;  2BHC A;  3MR1 A;  4IKR A;  1XGN A;  3IG4 A;  4RZZ A;  2BWY A;  4U6W A;  4FLI A;  1QXY A;  1XGS A;  1N51 A;  2EVO A;  3CB5 A;  4QR8 A;  2GTX A;  3PKE A;  2BN7 A;  4ZWP A;  1WL6 A;  4IKS A;  2P99 A;  4FO8 A;  4RGZ 1;  4FUK A;  1C22 A;  4IPA A;  1YW8 A;  3CTZ A;  1R5H A;  4U75 A;  1PV9 A;  2GG3 A;  1YJ3 A;  3L7G A;  5FCH A;  1XGO A;  1XGM A;  4U6E A;  5JFR A;  3BIP A;  1O0X A;  4U6C A;  4FKC A;  2P9A A;  2OAZ A;  4FO7 A;  2BHD A;  2Q95 A;  2BWX A;  4S2T P;  3CB6 A;  4ZNG A;  5CDV A;  1YW9 A;  1KP0 A;  1C23 A;  1C27 A;  2GG2 A;  2EVC A;  2EA4 A;  1MAT A; 
#chains in the Genus database with same CATH topology
 4A6V A;  1Y1N A;  2Q92 A;  3TAV A;  4RZY A;  3L24 A;  5D6E A;  2V6C A;  4OOK A;  2V3Y A;  4U73 A;  2B3K A;  2Q96 A;  2BH3 A;  3Q6D A;  4IDY A;  1WKM A;  1XNZ A;  4KM3 A;  1C21 A;  1YVM A;  4MAT A;  4U69 A;  2EVM A;  5CDE A;  4EGE A;  1M35 A;  2MAT A;  1KQ9 A;  2GU6 A;  4ZWU A;  1BN5 A;  2ZSG A;  2G6P A;  2Q94 A;  2OKN A;  2GG7 A;  1R58 A;  4IKU A;  1C24 A;  5FCF A;  2BHA A;  4B28 A;  1QXW A;  4JUQ A;  3MX6 A;  2EA2 A;  4R60 A;  2GG9 A;  3PKD A;  1B59 A;  1R5G A;  4S01 A;  5CNX A;  5JHU A;  3PKA A;  4FLK A;  4PV4 A;  2IW2 A;  1JAW A;  3IU8 A;  4IF7 A;  3BIQ A;  2GU7 A;  2Q8K A;  2GU4 A;  1W2M A;  2B3L A;  3MAT A;  2V3Z A;  2GA2 A;  2GG5 A;  5E5B A;  2BWU A;  4ZWO A;  4FLL A;  2ADU A;  2NQ6 A;  2Q93 A;  1QZY A;  2BWT A;  1WBQ A;  2B3H A;  2BWV A;  3S6B A;  4Z7M A;  3RVA A;  1WY2 A;  1QXZ A;  2GG8 A;  2BWW A;  2GGB A;  4U1B A;  3D27 A;  3IU9 A;  2V3X A;  1CHM A;  1BOA A;  4IKT A;  4S00 A;  5CIK A;  4U6Z A;  3IU7 A;  4U6J A;  4A6W A;  3PKB A;  1W7V A;  2HOW A;  2BWS A;  1B6A A;  3FM3 A;  4FLJ A;  2GU5 A;  4U71 A;  2BHB A;  4HXX A;  5CLS A;  3FMR A;  2GGC A;  1KQ0 A;  2GZ5 A;  3BIT A;  4IU6 A;  2GG0 A;  1WN1 A;  2NQ7 A;  3FMQ A;  3PKC A;  3TB5 A;  5CE6 A;  4S2R P;  1WL9 A;  4IEC A;  2P98 A;  2DFI A;  4U70 A;  1YW7 A;  4PNC A;  5D6F A;  1WLR A;  4U76 A;  1A16 A;  2BB7 A;  3ROR A;  5CDL A;  5JI6 A;  2BHC A;  3MR1 A;  4IKR A;  1XGN A;  3IG4 A;  4RZZ A;  2BWY A;  4U6W A;  4FLI A;  1QXY A;  1XGS A;  1N51 A;  2EVO A;  3CB5 A;  4QR8 A;  2GTX A;  3PKE A;  2BN7 A;  4ZWP A;  1WL6 A;  4IKS A;  2P99 A;  4FO8 A;  4RGZ 1;  4FUK A;  1C22 A;  4IPA A;  1YW8 A;  3CTZ A;  1R5H A;  4U75 A;  1PV9 A;  2GG3 A;  1YJ3 A;  3L7G A;  5FCH A;  1XGO A;  1XGM A;  4U6E A;  5JFR A;  3BIP A;  1O0X A;  4U6C A;  4FKC A;  2P9A A;  2OAZ A;  4FO7 A;  2BHD A;  2Q95 A;  2BWX A;  4S2T P;  3CB6 A;  4ZNG A;  5CDV A;  1YW9 A;  1KP0 A;  1C23 A;  1C27 A;  2GG2 A;  2EVC A;  2EA4 A;  1MAT A; 
#chains in the Genus database with same CATH homology
 4A6V A;  1Y1N A;  2Q92 A;  3TAV A;  4RZY A;  3L24 A;  5D6E A;  2V6C A;  4OOK A;  2V3Y A;  4U73 A;  2B3K A;  2Q96 A;  2BH3 A;  3Q6D A;  4IDY A;  1WKM A;  1XNZ A;  4KM3 A;  1C21 A;  1YVM A;  4MAT A;  4U69 A;  2EVM A;  5CDE A;  4EGE A;  1M35 A;  2MAT A;  1KQ9 A;  2GU6 A;  4ZWU A;  1BN5 A;  2ZSG A;  2G6P A;  2Q94 A;  2OKN A;  2GG7 A;  1R58 A;  4IKU A;  1C24 A;  5FCF A;  2BHA A;  4B28 A;  1QXW A;  4JUQ A;  3MX6 A;  2EA2 A;  4R60 A;  2GG9 A;  3PKD A;  1B59 A;  1R5G A;  4S01 A;  5CNX A;  5JHU A;  3PKA A;  4FLK A;  4PV4 A;  2IW2 A;  1JAW A;  3IU8 A;  4IF7 A;  3BIQ A;  2GU7 A;  2Q8K A;  2GU4 A;  1W2M A;  2B3L A;  3MAT A;  2V3Z A;  2GA2 A;  2GG5 A;  5E5B A;  2BWU A;  4ZWO A;  4FLL A;  2ADU A;  2NQ6 A;  2Q93 A;  1QZY A;  2BWT A;  1WBQ A;  2B3H A;  2BWV A;  3S6B A;  4Z7M A;  3RVA A;  1WY2 A;  1QXZ A;  2GG8 A;  2BWW A;  2GGB A;  4U1B A;  3D27 A;  3IU9 A;  2V3X A;  1CHM A;  1BOA A;  4IKT A;  4S00 A;  5CIK A;  4U6Z A;  3IU7 A;  4U6J A;  4A6W A;  3PKB A;  1W7V A;  2HOW A;  2BWS A;  1B6A A;  3FM3 A;  4FLJ A;  2GU5 A;  4U71 A;  2BHB A;  4HXX A;  5CLS A;  3FMR A;  2GGC A;  1KQ0 A;  2GZ5 A;  3BIT A;  4IU6 A;  2GG0 A;  1WN1 A;  2NQ7 A;  3FMQ A;  3PKC A;  3TB5 A;  5CE6 A;  4S2R P;  1WL9 A;  4IEC A;  2P98 A;  2DFI A;  4U70 A;  1YW7 A;  4PNC A;  5D6F A;  1WLR A;  4U76 A;  1A16 A;  2BB7 A;  3ROR A;  5CDL A;  5JI6 A;  2BHC A;  3MR1 A;  4IKR A;  1XGN A;  3IG4 A;  4RZZ A;  2BWY A;  4U6W A;  4FLI A;  1QXY A;  1XGS A;  1N51 A;  2EVO A;  3CB5 A;  4QR8 A;  2GTX A;  3PKE A;  2BN7 A;  4ZWP A;  1WL6 A;  4IKS A;  2P99 A;  4FO8 A;  4RGZ 1;  4FUK A;  1C22 A;  4IPA A;  1YW8 A;  3CTZ A;  1R5H A;  4U75 A;  1PV9 A;  2GG3 A;  1YJ3 A;  3L7G A;  5FCH A;  1XGO A;  1XGM A;  4U6E A;  5JFR A;  3BIP A;  1O0X A;  4U6C A;  4FKC A;  2P9A A;  2OAZ A;  4FO7 A;  2BHD A;  2Q95 A;  2BWX A;  4S2T P;  3CB6 A;  4ZNG A;  5CDV A;  1YW9 A;  1KP0 A;  1C23 A;  1C27 A;  2GG2 A;  2EVC A;  2EA4 A;  1MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...