4U6ZA

Hsmetap(f309m) in complex with 1-amino-2-propylpentyl)phosphonic acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6zA00
4JUQA 4PV4A 4HXXA 1XGOA 5CIKA 1WN1A 4RZYA 5CE6A 4FO8A 2BWYA 4IECA 2EVMA 5CDVA 4FLJA 4U1BA 2Q96A 2ZSGA 2BWXA 4B28A 2OAZA 1QXWA 2BHAA 1B59A 4IPAA 2GU5A 2GU7A 2GG2A 2P9AA 5CNXA 2EA2A 1O0XA 2GG3A 4U76A 2GGBA 3CTZA 1C23A 2EVCA 4ZWUA 4FO7A 4IU6A 2BWTA 4EGEA 2G6PA 1N51A 4IF7A 4U6WA 2GGCA 4FLLA 4ZWOA 2V6CA 2HOWA 2GG8A 2BWUA 4U73A 2Q94A 1W2MA 2GTXA 2Q8KA 1QZYA 3TB5A 3MATA 1YJ3A 2GG9A 3IU9A 3Q6DA 4RGZ1 1A16A 4S00A 2NQ7A 4U71A 2BHCA 4U6ZA 2V3ZA 2Q93A 4U6JA 1XGNA 2MATA 5D6EA 1YW9A 2BWSA 3PKDA 1WL6A 1XGMA 4IDYA 2GA2A 3TAVA 5D6FA 3PKAA 1C21A 4FUKA 2BH3A 4OOKA 1MATA 1KP0A 4IKSA 4U6EA 4ZWPA 3RVAA 3BIPA 4R60A 4MATA 2ADUA 1CHMA 2DFIA 2GZ5A 4PNCA 4S2TP 3MX6A 1QXZA 4KM3A 3FM3A 4U69A 4RZZA 1C27A 2Q95A 2IW2A 2V3YA 2GU6A 3BITA 3MR1A 1PV9A 1BN5A 4S01A 4FLKA 1YW8A 2GU4A 4QR8A 1M35A 3PKCA 1YW7A 3L7GA 2BWWA 2BHBA 4U6CA 3BIQA 1W7VA 3CB6A 3IG4A 4IKTA 1WKMA 1R5HA 3IU7A 3PKEA 2GG5A 4IKUA 2EA4A 2NQ6A 3D27A 1KQ0A 1C24A 4U75A 2EVOA 4ZNGA 2GG0A 2GG7A 1B6AA 3CB5A 5CLSA 2B3LA 5JI6A 5JFRA 3RORA 1KQ9A 1JAWA 3FMQA 2P99A 4A6VA 5CDLA 1C22A 2BWVA 2BHDA 5FCHA 1WLRA 1QXYA 1XGSA 3L24A 2B3HA 3PKBA 1WBQA 1WL9A 4FLIA 1BOAA 1WY2A 1Y1NA 2BB7A 1XNZA 5E5BA 2Q92A 2P98A 3FMRA 2B3KA 5FCFA 5CDEA 5JHUA 1YVMA 4Z7MA 1R5GA 4A6WA 1R58A 2BN7A 2OKNA 4FKCA 3IU8A 4IKRA 2V3XA 4S2RP 3S6BA 4U70A
chains in the Genus database with same CATH superfamily
4JUQA 4PV4A 4HXXA 1XGOA 5CIKA 1WN1A 4RZYA 5CE6A 4FO8A 2BWYA 4IECA 2EVMA 5CDVA 4FLJA 4U1BA 2Q96A 2ZSGA 2BWXA 4B28A 2OAZA 1QXWA 2BHAA 1B59A 4IPAA 2GU5A 2GU7A 2GG2A 2P9AA 5CNXA 2EA2A 1O0XA 2GG3A 4U76A 2GGBA 3CTZA 1C23A 2EVCA 4ZWUA 4FO7A 4IU6A 2BWTA 4EGEA 2G6PA 1N51A 4IF7A 4U6WA 2GGCA 4FLLA 4ZWOA 2V6CA 2HOWA 2GG8A 2BWUA 4U73A 2Q94A 1W2MA 2GTXA 2Q8KA 1QZYA 3TB5A 3MATA 1YJ3A 2GG9A 3IU9A 3Q6DA 4RGZ1 1A16A 4S00A 2NQ7A 4U71A 2BHCA 4U6ZA 2V3ZA 2Q93A 4U6JA 1XGNA 2MATA 5D6EA 1YW9A 2BWSA 3PKDA 1WL6A 1XGMA 4IDYA 2GA2A 3TAVA 5D6FA 3PKAA 1C21A 4FUKA 2BH3A 4OOKA 1MATA 1KP0A 4IKSA 4U6EA 4ZWPA 3RVAA 3BIPA 4R60A 4MATA 2ADUA 1CHMA 2DFIA 2GZ5A 4PNCA 4S2TP 3MX6A 1QXZA 4KM3A 3FM3A 4U69A 4RZZA 1C27A 2Q95A 2IW2A 2V3YA 2GU6A 3BITA 3MR1A 1PV9A 1BN5A 4S01A 4FLKA 1YW8A 2GU4A 4QR8A 1M35A 3PKCA 1YW7A 3L7GA 2BWWA 2BHBA 4U6CA 3BIQA 1W7VA 3CB6A 3IG4A 4IKTA 1WKMA 1R5HA 3IU7A 3PKEA 2GG5A 4IKUA 2EA4A 2NQ6A 3D27A 1KQ0A 1C24A 4U75A 2EVOA 4ZNGA 2GG0A 2GG7A 1B6AA 3CB5A 5CLSA 2B3LA 5JI6A 5JFRA 3RORA 1KQ9A 1JAWA 3FMQA 2P99A 4A6VA 5CDLA 1C22A 2BWVA 2BHDA 5FCHA 1WLRA 1QXYA 1XGSA 3L24A 2B3HA 3PKBA 1WBQA 1WL9A 4FLIA 1BOAA 1WY2A 1Y1NA 2BB7A 1XNZA 5E5BA 2Q92A 2P98A 3FMRA 2B3KA 5FCFA 5CDEA 5JHUA 1YVMA 4Z7MA 1R5GA 4A6WA 1R58A 2BN7A 2OKNA 4FKCA 3IU8A 4IKRA 2V3XA 4S2RP 3S6BA 4U70A
chains in the Genus database with same CATH topology
4JUQA 4PV4A 4HXXA 1XGOA 5CIKA 1WN1A 4RZYA 5CE6A 4FO8A 2BWYA 4IECA 2EVMA 5CDVA 4FLJA 4U1BA 2Q96A 2ZSGA 2BWXA 4B28A 2OAZA 1QXWA 2BHAA 1B59A 4IPAA 2GU5A 2GU7A 2GG2A 2P9AA 5CNXA 2EA2A 1O0XA 2GG3A 4U76A 2GGBA 3CTZA 1C23A 2EVCA 4ZWUA 4FO7A 4IU6A 2BWTA 4EGEA 2G6PA 1N51A 4IF7A 4U6WA 2GGCA 4FLLA 4ZWOA 2V6CA 2HOWA 2GG8A 2BWUA 4U73A 2Q94A 1W2MA 2GTXA 2Q8KA 1QZYA 3TB5A 3MATA 1YJ3A 2GG9A 3IU9A 3Q6DA 4RGZ1 1A16A 4S00A 2NQ7A 4U71A 2BHCA 4U6ZA 2V3ZA 2Q93A 4U6JA 1XGNA 2MATA 5D6EA 1YW9A 2BWSA 3PKDA 1WL6A 1XGMA 4IDYA 2GA2A 3TAVA 5D6FA 3PKAA 1C21A 4FUKA 2BH3A 4OOKA 1MATA 1KP0A 4IKSA 4U6EA 4ZWPA 3RVAA 3BIPA 4R60A 4MATA 2ADUA 1CHMA 2DFIA 2GZ5A 4PNCA 4S2TP 3MX6A 1QXZA 4KM3A 3FM3A 4U69A 4RZZA 1C27A 2Q95A 2IW2A 2V3YA 2GU6A 3BITA 3MR1A 1PV9A 1BN5A 4S01A 4FLKA 1YW8A 2GU4A 4QR8A 1M35A 3PKCA 1YW7A 3L7GA 2BWWA 2BHBA 4U6CA 3BIQA 1W7VA 3CB6A 3IG4A 4IKTA 1WKMA 1R5HA 3IU7A 3PKEA 2GG5A 4IKUA 2EA4A 2NQ6A 3D27A 1KQ0A 1C24A 4U75A 2EVOA 4ZNGA 2GG0A 2GG7A 1B6AA 3CB5A 5CLSA 2B3LA 5JI6A 5JFRA 3RORA 1KQ9A 1JAWA 3FMQA 2P99A 4A6VA 5CDLA 1C22A 2BWVA 2BHDA 5FCHA 1WLRA 1QXYA 1XGSA 3L24A 2B3HA 3PKBA 1WBQA 1WL9A 4FLIA 1BOAA 1WY2A 1Y1NA 2BB7A 1XNZA 5E5BA 2Q92A 2P98A 3FMRA 2B3KA 5FCFA 5CDEA 5JHUA 1YVMA 4Z7MA 1R5GA 4A6WA 1R58A 2BN7A 2OKNA 4FKCA 3IU8A 4IKRA 2V3XA 4S2RP 3S6BA 4U70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JUQ A;  4PV4 A;  4HXX A;  1XGO A;  5CIK A;  1WN1 A;  4RZY A;  5CE6 A;  4FO8 A;  2BWY A;  4IEC A;  2EVM A;  5CDV A;  4FLJ A;  4U1B A;  2Q96 A;  2ZSG A;  2BWX A;  4B28 A;  2OAZ A;  1QXW A;  2BHA A;  1B59 A;  4IPA A;  2GU5 A;  2GU7 A;  2GG2 A;  2P9A A;  5CNX A;  2EA2 A;  1O0X A;  2GG3 A;  4U76 A;  2GGB A;  3CTZ A;  1C23 A;  2EVC A;  4ZWU A;  4FO7 A;  4IU6 A;  2BWT A;  4EGE A;  2G6P A;  1N51 A;  4IF7 A;  4U6W A;  2GGC A;  4FLL A;  4ZWO A;  2V6C A;  2HOW A;  2GG8 A;  2BWU A;  4U73 A;  2Q94 A;  1W2M A;  2GTX A;  2Q8K A;  1QZY A;  3TB5 A;  3MAT A;  1YJ3 A;  2GG9 A;  3IU9 A;  3Q6D A;  4RGZ 1;  1A16 A;  4S00 A;  2NQ7 A;  4U71 A;  2BHC A;  4U6Z A;  2V3Z A;  2Q93 A;  4U6J A;  1XGN A;  2MAT A;  5D6E A;  1YW9 A;  2BWS A;  3PKD A;  1WL6 A;  1XGM A;  4IDY A;  2GA2 A;  3TAV A;  5D6F A;  3PKA A;  1C21 A;  4FUK A;  2BH3 A;  4OOK A;  1MAT A;  1KP0 A;  4IKS A;  4U6E A;  4ZWP A;  3RVA A;  3BIP A;  4R60 A;  4MAT A;  2ADU A;  1CHM A;  2DFI A;  2GZ5 A;  4PNC A;  4S2T P;  3MX6 A;  1QXZ A;  4KM3 A;  3FM3 A;  4U69 A;  4RZZ A;  1C27 A;  2Q95 A;  2IW2 A;  2V3Y A;  2GU6 A;  3BIT A;  3MR1 A;  1PV9 A;  1BN5 A;  4S01 A;  4FLK A;  1YW8 A;  2GU4 A;  4QR8 A;  1M35 A;  3PKC A;  1YW7 A;  3L7G A;  2BWW A;  2BHB A;  4U6C A;  3BIQ A;  1W7V A;  3CB6 A;  3IG4 A;  4IKT A;  1WKM A;  1R5H A;  3IU7 A;  3PKE A;  2GG5 A;  4IKU A;  2EA4 A;  2NQ6 A;  3D27 A;  1KQ0 A;  1C24 A;  4U75 A;  2EVO A;  4ZNG A;  2GG0 A;  2GG7 A;  1B6A A;  3CB5 A;  5CLS A;  2B3L A;  5JI6 A;  5JFR A;  3ROR A;  1KQ9 A;  1JAW A;  3FMQ A;  2P99 A;  4A6V A;  5CDL A;  1C22 A;  2BWV A;  2BHD A;  5FCH A;  1WLR A;  1QXY A;  1XGS A;  3L24 A;  2B3H A;  3PKB A;  1WBQ A;  1WL9 A;  4FLI A;  1BOA A;  1WY2 A;  1Y1N A;  2BB7 A;  1XNZ A;  5E5B A;  2Q92 A;  2P98 A;  3FMR A;  2B3K A;  5FCF A;  5CDE A;  5JHU A;  1YVM A;  4Z7M A;  1R5G A;  4A6W A;  1R58 A;  2BN7 A;  2OKN A;  4FKC A;  3IU8 A;  4IKR A;  2V3X A;  4S2R P;  3S6B A;  4U70 A; 
#chains in the Genus database with same CATH topology
 4JUQ A;  4PV4 A;  4HXX A;  1XGO A;  5CIK A;  1WN1 A;  4RZY A;  5CE6 A;  4FO8 A;  2BWY A;  4IEC A;  2EVM A;  5CDV A;  4FLJ A;  4U1B A;  2Q96 A;  2ZSG A;  2BWX A;  4B28 A;  2OAZ A;  1QXW A;  2BHA A;  1B59 A;  4IPA A;  2GU5 A;  2GU7 A;  2GG2 A;  2P9A A;  5CNX A;  2EA2 A;  1O0X A;  2GG3 A;  4U76 A;  2GGB A;  3CTZ A;  1C23 A;  2EVC A;  4ZWU A;  4FO7 A;  4IU6 A;  2BWT A;  4EGE A;  2G6P A;  1N51 A;  4IF7 A;  4U6W A;  2GGC A;  4FLL A;  4ZWO A;  2V6C A;  2HOW A;  2GG8 A;  2BWU A;  4U73 A;  2Q94 A;  1W2M A;  2GTX A;  2Q8K A;  1QZY A;  3TB5 A;  3MAT A;  1YJ3 A;  2GG9 A;  3IU9 A;  3Q6D A;  4RGZ 1;  1A16 A;  4S00 A;  2NQ7 A;  4U71 A;  2BHC A;  4U6Z A;  2V3Z A;  2Q93 A;  4U6J A;  1XGN A;  2MAT A;  5D6E A;  1YW9 A;  2BWS A;  3PKD A;  1WL6 A;  1XGM A;  4IDY A;  2GA2 A;  3TAV A;  5D6F A;  3PKA A;  1C21 A;  4FUK A;  2BH3 A;  4OOK A;  1MAT A;  1KP0 A;  4IKS A;  4U6E A;  4ZWP A;  3RVA A;  3BIP A;  4R60 A;  4MAT A;  2ADU A;  1CHM A;  2DFI A;  2GZ5 A;  4PNC A;  4S2T P;  3MX6 A;  1QXZ A;  4KM3 A;  3FM3 A;  4U69 A;  4RZZ A;  1C27 A;  2Q95 A;  2IW2 A;  2V3Y A;  2GU6 A;  3BIT A;  3MR1 A;  1PV9 A;  1BN5 A;  4S01 A;  4FLK A;  1YW8 A;  2GU4 A;  4QR8 A;  1M35 A;  3PKC A;  1YW7 A;  3L7G A;  2BWW A;  2BHB A;  4U6C A;  3BIQ A;  1W7V A;  3CB6 A;  3IG4 A;  4IKT A;  1WKM A;  1R5H A;  3IU7 A;  3PKE A;  2GG5 A;  4IKU A;  2EA4 A;  2NQ6 A;  3D27 A;  1KQ0 A;  1C24 A;  4U75 A;  2EVO A;  4ZNG A;  2GG0 A;  2GG7 A;  1B6A A;  3CB5 A;  5CLS A;  2B3L A;  5JI6 A;  5JFR A;  3ROR A;  1KQ9 A;  1JAW A;  3FMQ A;  2P99 A;  4A6V A;  5CDL A;  1C22 A;  2BWV A;  2BHD A;  5FCH A;  1WLR A;  1QXY A;  1XGS A;  3L24 A;  2B3H A;  3PKB A;  1WBQ A;  1WL9 A;  4FLI A;  1BOA A;  1WY2 A;  1Y1N A;  2BB7 A;  1XNZ A;  5E5B A;  2Q92 A;  2P98 A;  3FMR A;  2B3K A;  5FCF A;  5CDE A;  5JHU A;  1YVM A;  4Z7M A;  1R5G A;  4A6W A;  1R58 A;  2BN7 A;  2OKN A;  4FKC A;  3IU8 A;  4IKR A;  2V3X A;  4S2R P;  3S6B A;  4U70 A; 
#chains in the Genus database with same CATH homology
 4JUQ A;  4PV4 A;  4HXX A;  1XGO A;  5CIK A;  1WN1 A;  4RZY A;  5CE6 A;  4FO8 A;  2BWY A;  4IEC A;  2EVM A;  5CDV A;  4FLJ A;  4U1B A;  2Q96 A;  2ZSG A;  2BWX A;  4B28 A;  2OAZ A;  1QXW A;  2BHA A;  1B59 A;  4IPA A;  2GU5 A;  2GU7 A;  2GG2 A;  2P9A A;  5CNX A;  2EA2 A;  1O0X A;  2GG3 A;  4U76 A;  2GGB A;  3CTZ A;  1C23 A;  2EVC A;  4ZWU A;  4FO7 A;  4IU6 A;  2BWT A;  4EGE A;  2G6P A;  1N51 A;  4IF7 A;  4U6W A;  2GGC A;  4FLL A;  4ZWO A;  2V6C A;  2HOW A;  2GG8 A;  2BWU A;  4U73 A;  2Q94 A;  1W2M A;  2GTX A;  2Q8K A;  1QZY A;  3TB5 A;  3MAT A;  1YJ3 A;  2GG9 A;  3IU9 A;  3Q6D A;  4RGZ 1;  1A16 A;  4S00 A;  2NQ7 A;  4U71 A;  2BHC A;  4U6Z A;  2V3Z A;  2Q93 A;  4U6J A;  1XGN A;  2MAT A;  5D6E A;  1YW9 A;  2BWS A;  3PKD A;  1WL6 A;  1XGM A;  4IDY A;  2GA2 A;  3TAV A;  5D6F A;  3PKA A;  1C21 A;  4FUK A;  2BH3 A;  4OOK A;  1MAT A;  1KP0 A;  4IKS A;  4U6E A;  4ZWP A;  3RVA A;  3BIP A;  4R60 A;  4MAT A;  2ADU A;  1CHM A;  2DFI A;  2GZ5 A;  4PNC A;  4S2T P;  3MX6 A;  1QXZ A;  4KM3 A;  3FM3 A;  4U69 A;  4RZZ A;  1C27 A;  2Q95 A;  2IW2 A;  2V3Y A;  2GU6 A;  3BIT A;  3MR1 A;  1PV9 A;  1BN5 A;  4S01 A;  4FLK A;  1YW8 A;  2GU4 A;  4QR8 A;  1M35 A;  3PKC A;  1YW7 A;  3L7G A;  2BWW A;  2BHB A;  4U6C A;  3BIQ A;  1W7V A;  3CB6 A;  3IG4 A;  4IKT A;  1WKM A;  1R5H A;  3IU7 A;  3PKE A;  2GG5 A;  4IKU A;  2EA4 A;  2NQ6 A;  3D27 A;  1KQ0 A;  1C24 A;  4U75 A;  2EVO A;  4ZNG A;  2GG0 A;  2GG7 A;  1B6A A;  3CB5 A;  5CLS A;  2B3L A;  5JI6 A;  5JFR A;  3ROR A;  1KQ9 A;  1JAW A;  3FMQ A;  2P99 A;  4A6V A;  5CDL A;  1C22 A;  2BWV A;  2BHD A;  5FCH A;  1WLR A;  1QXY A;  1XGS A;  3L24 A;  2B3H A;  3PKB A;  1WBQ A;  1WL9 A;  4FLI A;  1BOA A;  1WY2 A;  1Y1N A;  2BB7 A;  1XNZ A;  5E5B A;  2Q92 A;  2P98 A;  3FMR A;  2B3K A;  5FCF A;  5CDE A;  5JHU A;  1YVM A;  4Z7M A;  1R5G A;  4A6W A;  1R58 A;  2BN7 A;  2OKN A;  4FKC A;  3IU8 A;  4IKR A;  2V3X A;  4S2R P;  3S6B A;  4U70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...