4U6ZA

Hsmetap(f309m) in complex with 1-amino-2-propylpentyl)phosphonic acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6zA00
2Q95A 5CDVA 2B3LA 4S01A 1BOAA 3CB6A 4ZNGA 4U6EA 2EA4A 5FCHA 3BIPA 1R5GA 4U1BA 4U6ZA 4FKCA 1B6AA 5FCFA 4IDYA 2V3ZA 4JUQA 1W7VA 2BWYA 1XGNA 5CLSA 2GG5A 1QXYA 2Q96A 1XGMA 2GG2A 3MX6A 3TB5A 4U6CA 3IG4A 1WBQA 3PKAA 2B3KA 2EVMA 2GGCA 3PKDA 4IKSA 2GGBA 2GU5A 4RZYA 3MR1A 4FO8A 2BWTA 1QZYA 3IU7A 2BN7A 2GG3A 1YW8A 1C21A 4IU6A 1YJ3A 3L7GA 2P9AA 4U76A 4U70A 1BN5A 3RORA 4MATA 5CE6A 1R5HA 3PKEA 2Q8KA 4FUKA 4ZWUA 5CDLA 1MATA 1QXZA 1CHMA 4IKUA 4QR8A 5JI6A 1YW9A 2BWUA 1M35A 1YVMA 3MATA 3CB5A 4FLJA 4S2TP 2MATA 1KQ0A 1R58A 2EA2A 4RGZ1 4IECA 1WL9A 2GZ5A 4FLLA 1WLRA 2GU7A 4HXXA 3L24A 4RZZA 1PV9A 2BHCA 3IU9A 3BITA 2BWWA 2GG9A 2GG7A 4B28A 1Y1NA 3IU8A 4Z7MA 2GG0A 2V3XA 1A16A 5CNXA 5JHUA 3S6BA 2G6PA 2Q93A 2ZSGA 3FM3A 4PNCA 1WY2A 5D6EA 4FO7A 5CIKA 2BWXA 1YW7A 4KM3A 1C23A 2ADUA 4U6WA 1WN1A 2P98A 2V3YA 5JFRA 4EGEA 1C24A 3TAVA 4A6VA 2BHDA 2OKNA 1KQ9A 3PKBA 2BWVA 4U73A 1XGSA 1O0XA 2GU4A 4U75A 1C22A 2NQ6A 1XGOA 2BH3A 1W2MA 5D6FA 1KP0A 4FLIA 4ZWPA 2OAZA 4IF7A 1N51A 2GG8A 3D27A 2BB7A 2EVOA 4OOKA 4R60A 4A6WA 2BHBA 2BWSA 2P99A 4IKRA 4IKTA 2HOWA 4U6JA 2Q94A 1WKMA 2BHAA 1XNZA 2DFIA 1C27A 1QXWA 3FMQA 3Q6DA 4FLKA 3CTZA 4U69A 1B59A 3PKCA 2IW2A 1WL6A 4PV4A 3RVAA 1JAWA 2Q92A 2NQ7A 3FMRA 4IPAA 3BIQA 2GU6A 2V6CA 2GTXA 4S00A 2B3HA 4S2RP 5E5BA 2EVCA 4U71A 5CDEA 2GA2A 4ZWOA
chains in the Genus database with same CATH superfamily
2Q95A 5CDVA 2B3LA 4S01A 1BOAA 3CB6A 4ZNGA 4U6EA 2EA4A 5FCHA 3BIPA 1R5GA 4U1BA 4U6ZA 4FKCA 1B6AA 5FCFA 4IDYA 2V3ZA 4JUQA 1W7VA 2BWYA 1XGNA 5CLSA 2GG5A 1QXYA 2Q96A 1XGMA 2GG2A 3MX6A 3TB5A 4U6CA 3IG4A 1WBQA 3PKAA 2B3KA 2EVMA 2GGCA 3PKDA 4IKSA 2GGBA 2GU5A 4RZYA 3MR1A 4FO8A 2BWTA 1QZYA 3IU7A 2BN7A 2GG3A 1YW8A 1C21A 4IU6A 1YJ3A 3L7GA 2P9AA 4U76A 4U70A 1BN5A 3RORA 4MATA 5CE6A 1R5HA 3PKEA 2Q8KA 4FUKA 4ZWUA 5CDLA 1MATA 1QXZA 1CHMA 4IKUA 4QR8A 5JI6A 1YW9A 2BWUA 1M35A 1YVMA 3MATA 3CB5A 4FLJA 4S2TP 2MATA 1KQ0A 1R58A 2EA2A 4RGZ1 4IECA 1WL9A 2GZ5A 4FLLA 1WLRA 2GU7A 4HXXA 3L24A 4RZZA 1PV9A 2BHCA 3IU9A 3BITA 2BWWA 2GG9A 2GG7A 4B28A 1Y1NA 3IU8A 4Z7MA 2GG0A 2V3XA 1A16A 5CNXA 5JHUA 3S6BA 2G6PA 2Q93A 2ZSGA 3FM3A 4PNCA 1WY2A 5D6EA 4FO7A 5CIKA 2BWXA 1YW7A 4KM3A 1C23A 2ADUA 4U6WA 1WN1A 2P98A 2V3YA 5JFRA 4EGEA 1C24A 3TAVA 4A6VA 2BHDA 2OKNA 1KQ9A 3PKBA 2BWVA 4U73A 1XGSA 1O0XA 2GU4A 4U75A 1C22A 2NQ6A 1XGOA 2BH3A 1W2MA 5D6FA 1KP0A 4FLIA 4ZWPA 2OAZA 4IF7A 1N51A 2GG8A 3D27A 2BB7A 2EVOA 4OOKA 4R60A 4A6WA 2BHBA 2BWSA 2P99A 4IKRA 4IKTA 2HOWA 4U6JA 2Q94A 1WKMA 2BHAA 1XNZA 2DFIA 1C27A 1QXWA 3FMQA 3Q6DA 4FLKA 3CTZA 4U69A 1B59A 3PKCA 2IW2A 1WL6A 4PV4A 3RVAA 1JAWA 2Q92A 2NQ7A 3FMRA 4IPAA 3BIQA 2GU6A 2V6CA 2GTXA 4S00A 2B3HA 4S2RP 5E5BA 2EVCA 4U71A 5CDEA 2GA2A 4ZWOA
chains in the Genus database with same CATH topology
2Q95A 5CDVA 2B3LA 4S01A 1BOAA 3CB6A 4ZNGA 4U6EA 2EA4A 5FCHA 3BIPA 1R5GA 4U1BA 4U6ZA 4FKCA 1B6AA 5FCFA 4IDYA 2V3ZA 4JUQA 1W7VA 2BWYA 1XGNA 5CLSA 2GG5A 1QXYA 2Q96A 1XGMA 2GG2A 3MX6A 3TB5A 4U6CA 3IG4A 1WBQA 3PKAA 2B3KA 2EVMA 2GGCA 3PKDA 4IKSA 2GGBA 2GU5A 4RZYA 3MR1A 4FO8A 2BWTA 1QZYA 3IU7A 2BN7A 2GG3A 1YW8A 1C21A 4IU6A 1YJ3A 3L7GA 2P9AA 4U76A 4U70A 1BN5A 3RORA 4MATA 5CE6A 1R5HA 3PKEA 2Q8KA 4FUKA 4ZWUA 5CDLA 1MATA 1QXZA 1CHMA 4IKUA 4QR8A 5JI6A 1YW9A 2BWUA 1M35A 1YVMA 3MATA 3CB5A 4FLJA 4S2TP 2MATA 1KQ0A 1R58A 2EA2A 4RGZ1 4IECA 1WL9A 2GZ5A 4FLLA 1WLRA 2GU7A 4HXXA 3L24A 4RZZA 1PV9A 2BHCA 3IU9A 3BITA 2BWWA 2GG9A 2GG7A 4B28A 1Y1NA 3IU8A 4Z7MA 2GG0A 2V3XA 1A16A 5CNXA 5JHUA 3S6BA 2G6PA 2Q93A 2ZSGA 3FM3A 4PNCA 1WY2A 5D6EA 4FO7A 5CIKA 2BWXA 1YW7A 4KM3A 1C23A 2ADUA 4U6WA 1WN1A 2P98A 2V3YA 5JFRA 4EGEA 1C24A 3TAVA 4A6VA 2BHDA 2OKNA 1KQ9A 3PKBA 2BWVA 4U73A 1XGSA 1O0XA 2GU4A 4U75A 1C22A 2NQ6A 1XGOA 2BH3A 1W2MA 5D6FA 1KP0A 4FLIA 4ZWPA 2OAZA 4IF7A 1N51A 2GG8A 3D27A 2BB7A 2EVOA 4OOKA 4R60A 4A6WA 2BHBA 2BWSA 2P99A 4IKRA 4IKTA 2HOWA 4U6JA 2Q94A 1WKMA 2BHAA 1XNZA 2DFIA 1C27A 1QXWA 3FMQA 3Q6DA 4FLKA 3CTZA 4U69A 1B59A 3PKCA 2IW2A 1WL6A 4PV4A 3RVAA 1JAWA 2Q92A 2NQ7A 3FMRA 4IPAA 3BIQA 2GU6A 2V6CA 2GTXA 4S00A 2B3HA 4S2RP 5E5BA 2EVCA 4U71A 5CDEA 2GA2A 4ZWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q95 A;  5CDV A;  2B3L A;  4S01 A;  1BOA A;  3CB6 A;  4ZNG A;  4U6E A;  2EA4 A;  5FCH A;  3BIP A;  1R5G A;  4U1B A;  4U6Z A;  4FKC A;  1B6A A;  5FCF A;  4IDY A;  2V3Z A;  4JUQ A;  1W7V A;  2BWY A;  1XGN A;  5CLS A;  2GG5 A;  1QXY A;  2Q96 A;  1XGM A;  2GG2 A;  3MX6 A;  3TB5 A;  4U6C A;  3IG4 A;  1WBQ A;  3PKA A;  2B3K A;  2EVM A;  2GGC A;  3PKD A;  4IKS A;  2GGB A;  2GU5 A;  4RZY A;  3MR1 A;  4FO8 A;  2BWT A;  1QZY A;  3IU7 A;  2BN7 A;  2GG3 A;  1YW8 A;  1C21 A;  4IU6 A;  1YJ3 A;  3L7G A;  2P9A A;  4U76 A;  4U70 A;  1BN5 A;  3ROR A;  4MAT A;  5CE6 A;  1R5H A;  3PKE A;  2Q8K A;  4FUK A;  4ZWU A;  5CDL A;  1MAT A;  1QXZ A;  1CHM A;  4IKU A;  4QR8 A;  5JI6 A;  1YW9 A;  2BWU A;  1M35 A;  1YVM A;  3MAT A;  3CB5 A;  4FLJ A;  4S2T P;  2MAT A;  1KQ0 A;  1R58 A;  2EA2 A;  4RGZ 1;  4IEC A;  1WL9 A;  2GZ5 A;  4FLL A;  1WLR A;  2GU7 A;  4HXX A;  3L24 A;  4RZZ A;  1PV9 A;  2BHC A;  3IU9 A;  3BIT A;  2BWW A;  2GG9 A;  2GG7 A;  4B28 A;  1Y1N A;  3IU8 A;  4Z7M A;  2GG0 A;  2V3X A;  1A16 A;  5CNX A;  5JHU A;  3S6B A;  2G6P A;  2Q93 A;  2ZSG A;  3FM3 A;  4PNC A;  1WY2 A;  5D6E A;  4FO7 A;  5CIK A;  2BWX A;  1YW7 A;  4KM3 A;  1C23 A;  2ADU A;  4U6W A;  1WN1 A;  2P98 A;  2V3Y A;  5JFR A;  4EGE A;  1C24 A;  3TAV A;  4A6V A;  2BHD A;  2OKN A;  1KQ9 A;  3PKB A;  2BWV A;  4U73 A;  1XGS A;  1O0X A;  2GU4 A;  4U75 A;  1C22 A;  2NQ6 A;  1XGO A;  2BH3 A;  1W2M A;  5D6F A;  1KP0 A;  4FLI A;  4ZWP A;  2OAZ A;  4IF7 A;  1N51 A;  2GG8 A;  3D27 A;  2BB7 A;  2EVO A;  4OOK A;  4R60 A;  4A6W A;  2BHB A;  2BWS A;  2P99 A;  4IKR A;  4IKT A;  2HOW A;  4U6J A;  2Q94 A;  1WKM A;  2BHA A;  1XNZ A;  2DFI A;  1C27 A;  1QXW A;  3FMQ A;  3Q6D A;  4FLK A;  3CTZ A;  4U69 A;  1B59 A;  3PKC A;  2IW2 A;  1WL6 A;  4PV4 A;  3RVA A;  1JAW A;  2Q92 A;  2NQ7 A;  3FMR A;  4IPA A;  3BIQ A;  2GU6 A;  2V6C A;  2GTX A;  4S00 A;  2B3H A;  4S2R P;  5E5B A;  2EVC A;  4U71 A;  5CDE A;  2GA2 A;  4ZWO A; 
#chains in the Genus database with same CATH topology
 2Q95 A;  5CDV A;  2B3L A;  4S01 A;  1BOA A;  3CB6 A;  4ZNG A;  4U6E A;  2EA4 A;  5FCH A;  3BIP A;  1R5G A;  4U1B A;  4U6Z A;  4FKC A;  1B6A A;  5FCF A;  4IDY A;  2V3Z A;  4JUQ A;  1W7V A;  2BWY A;  1XGN A;  5CLS A;  2GG5 A;  1QXY A;  2Q96 A;  1XGM A;  2GG2 A;  3MX6 A;  3TB5 A;  4U6C A;  3IG4 A;  1WBQ A;  3PKA A;  2B3K A;  2EVM A;  2GGC A;  3PKD A;  4IKS A;  2GGB A;  2GU5 A;  4RZY A;  3MR1 A;  4FO8 A;  2BWT A;  1QZY A;  3IU7 A;  2BN7 A;  2GG3 A;  1YW8 A;  1C21 A;  4IU6 A;  1YJ3 A;  3L7G A;  2P9A A;  4U76 A;  4U70 A;  1BN5 A;  3ROR A;  4MAT A;  5CE6 A;  1R5H A;  3PKE A;  2Q8K A;  4FUK A;  4ZWU A;  5CDL A;  1MAT A;  1QXZ A;  1CHM A;  4IKU A;  4QR8 A;  5JI6 A;  1YW9 A;  2BWU A;  1M35 A;  1YVM A;  3MAT A;  3CB5 A;  4FLJ A;  4S2T P;  2MAT A;  1KQ0 A;  1R58 A;  2EA2 A;  4RGZ 1;  4IEC A;  1WL9 A;  2GZ5 A;  4FLL A;  1WLR A;  2GU7 A;  4HXX A;  3L24 A;  4RZZ A;  1PV9 A;  2BHC A;  3IU9 A;  3BIT A;  2BWW A;  2GG9 A;  2GG7 A;  4B28 A;  1Y1N A;  3IU8 A;  4Z7M A;  2GG0 A;  2V3X A;  1A16 A;  5CNX A;  5JHU A;  3S6B A;  2G6P A;  2Q93 A;  2ZSG A;  3FM3 A;  4PNC A;  1WY2 A;  5D6E A;  4FO7 A;  5CIK A;  2BWX A;  1YW7 A;  4KM3 A;  1C23 A;  2ADU A;  4U6W A;  1WN1 A;  2P98 A;  2V3Y A;  5JFR A;  4EGE A;  1C24 A;  3TAV A;  4A6V A;  2BHD A;  2OKN A;  1KQ9 A;  3PKB A;  2BWV A;  4U73 A;  1XGS A;  1O0X A;  2GU4 A;  4U75 A;  1C22 A;  2NQ6 A;  1XGO A;  2BH3 A;  1W2M A;  5D6F A;  1KP0 A;  4FLI A;  4ZWP A;  2OAZ A;  4IF7 A;  1N51 A;  2GG8 A;  3D27 A;  2BB7 A;  2EVO A;  4OOK A;  4R60 A;  4A6W A;  2BHB A;  2BWS A;  2P99 A;  4IKR A;  4IKT A;  2HOW A;  4U6J A;  2Q94 A;  1WKM A;  2BHA A;  1XNZ A;  2DFI A;  1C27 A;  1QXW A;  3FMQ A;  3Q6D A;  4FLK A;  3CTZ A;  4U69 A;  1B59 A;  3PKC A;  2IW2 A;  1WL6 A;  4PV4 A;  3RVA A;  1JAW A;  2Q92 A;  2NQ7 A;  3FMR A;  4IPA A;  3BIQ A;  2GU6 A;  2V6C A;  2GTX A;  4S00 A;  2B3H A;  4S2R P;  5E5B A;  2EVC A;  4U71 A;  5CDE A;  2GA2 A;  4ZWO A; 
#chains in the Genus database with same CATH homology
 2Q95 A;  5CDV A;  2B3L A;  4S01 A;  1BOA A;  3CB6 A;  4ZNG A;  4U6E A;  2EA4 A;  5FCH A;  3BIP A;  1R5G A;  4U1B A;  4U6Z A;  4FKC A;  1B6A A;  5FCF A;  4IDY A;  2V3Z A;  4JUQ A;  1W7V A;  2BWY A;  1XGN A;  5CLS A;  2GG5 A;  1QXY A;  2Q96 A;  1XGM A;  2GG2 A;  3MX6 A;  3TB5 A;  4U6C A;  3IG4 A;  1WBQ A;  3PKA A;  2B3K A;  2EVM A;  2GGC A;  3PKD A;  4IKS A;  2GGB A;  2GU5 A;  4RZY A;  3MR1 A;  4FO8 A;  2BWT A;  1QZY A;  3IU7 A;  2BN7 A;  2GG3 A;  1YW8 A;  1C21 A;  4IU6 A;  1YJ3 A;  3L7G A;  2P9A A;  4U76 A;  4U70 A;  1BN5 A;  3ROR A;  4MAT A;  5CE6 A;  1R5H A;  3PKE A;  2Q8K A;  4FUK A;  4ZWU A;  5CDL A;  1MAT A;  1QXZ A;  1CHM A;  4IKU A;  4QR8 A;  5JI6 A;  1YW9 A;  2BWU A;  1M35 A;  1YVM A;  3MAT A;  3CB5 A;  4FLJ A;  4S2T P;  2MAT A;  1KQ0 A;  1R58 A;  2EA2 A;  4RGZ 1;  4IEC A;  1WL9 A;  2GZ5 A;  4FLL A;  1WLR A;  2GU7 A;  4HXX A;  3L24 A;  4RZZ A;  1PV9 A;  2BHC A;  3IU9 A;  3BIT A;  2BWW A;  2GG9 A;  2GG7 A;  4B28 A;  1Y1N A;  3IU8 A;  4Z7M A;  2GG0 A;  2V3X A;  1A16 A;  5CNX A;  5JHU A;  3S6B A;  2G6P A;  2Q93 A;  2ZSG A;  3FM3 A;  4PNC A;  1WY2 A;  5D6E A;  4FO7 A;  5CIK A;  2BWX A;  1YW7 A;  4KM3 A;  1C23 A;  2ADU A;  4U6W A;  1WN1 A;  2P98 A;  2V3Y A;  5JFR A;  4EGE A;  1C24 A;  3TAV A;  4A6V A;  2BHD A;  2OKN A;  1KQ9 A;  3PKB A;  2BWV A;  4U73 A;  1XGS A;  1O0X A;  2GU4 A;  4U75 A;  1C22 A;  2NQ6 A;  1XGO A;  2BH3 A;  1W2M A;  5D6F A;  1KP0 A;  4FLI A;  4ZWP A;  2OAZ A;  4IF7 A;  1N51 A;  2GG8 A;  3D27 A;  2BB7 A;  2EVO A;  4OOK A;  4R60 A;  4A6W A;  2BHB A;  2BWS A;  2P99 A;  4IKR A;  4IKT A;  2HOW A;  4U6J A;  2Q94 A;  1WKM A;  2BHA A;  1XNZ A;  2DFI A;  1C27 A;  1QXW A;  3FMQ A;  3Q6D A;  4FLK A;  3CTZ A;  4U69 A;  1B59 A;  3PKC A;  2IW2 A;  1WL6 A;  4PV4 A;  3RVA A;  1JAW A;  2Q92 A;  2NQ7 A;  3FMR A;  4IPA A;  3BIQ A;  2GU6 A;  2V6C A;  2GTX A;  4S00 A;  2B3H A;  4S2R P;  5E5B A;  2EVC A;  4U71 A;  5CDE A;  2GA2 A;  4ZWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...