4U6ZA

Hsmetap(f309m) in complex with 1-amino-2-propylpentyl)phosphonic acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6zA00
2GG7A 3RORA 2BHBA 1PV9A 2V3YA 4U6WA 4PNCA 1N51A 2GG2A 4RZZA 3BIPA 3CTZA 1YW7A 2OAZA 5JFRA 1XGNA 2OKNA 1WN1A 4IKRA 3D27A 4U75A 3PKDA 2BWVA 4U6ZA 2BN7A 2GG0A 4R60A 2Q93A 3IG4A 1WKMA 1XGMA 1W7VA 4FLKA 4IPAA 2IW2A 4S00A 5CLSA 2DFIA 3PKEA 4ZWPA 2GG8A 3PKCA 3CB5A 4IU6A 2BB7A 1KP0A 4ZWOA 1B59A 2GU6A 4FLIA 1QXWA 2BHDA 2Q95A 3PKBA 1YW8A 4FO8A 4KM3A 3TB5A 2ZSGA 2BWWA 2BH3A 4JUQA 4S2RP 2G6PA 1B6AA 5CNXA 2Q96A 4IKTA 1XGSA 1WL9A 2Q8KA 2BHCA 3RVAA 2GZ5A 2EA2A 1C22A 2P99A 5JHUA 1KQ9A 2GA2A 2NQ7A 4ZNGA 3TAVA 2MATA 2GGBA 1C21A 1WLRA 2B3KA 4S01A 4U71A 5D6EA 1R5HA 4IF7A 2B3LA 1XNZA 4ZWUA 5CE6A 1C24A 4RZYA 4A6VA 2BWYA 2BWSA 4OOKA 5E5BA 1BN5A 1C27A 3L24A 4FLJA 4U70A 4U6CA 2Q94A 3FMRA 1Y1NA 4FLLA 2GU7A 2P98A 1QXZA 4U69A 2Q92A 3Q6DA 2B3HA 1O0XA 2BWXA 1R58A 1A16A 3FMQA 2GG9A 2V3XA 1R5GA 1YW9A 3IU9A 1BOAA 2EVMA 4FKCA 4RGZ1 4A6WA 3CB6A 1YJ3A 5CDVA 4S2TP 5JI6A 2V6CA 2BWUA 1CHMA 3L7GA 4PV4A 2GG5A 4IECA 3MX6A 1QXYA 5D6FA 3IU8A 2BWTA 1MATA 3MR1A 5CIKA 1WBQA 5CDLA 5FCHA 3MATA 1M35A 2EVOA 2EVCA 2NQ6A 3PKAA 4EGEA 2EA4A 1C23A 1JAWA 3BITA 4MATA 4U6JA 4U1BA 2GGCA 1WY2A 5CDEA 3FM3A 1YVMA 4IKSA 1WL6A 1KQ0A 4QR8A 3BIQA 4IKUA 1W2MA 4U76A 4IDYA 2V3ZA 2GU4A 4FO7A 4HXXA 2GTXA 2P9AA 4U73A 5FCFA 2ADUA 2BHAA 1XGOA 3IU7A 2GU5A 4FUKA 3S6BA 4B28A 4Z7MA 1QZYA 2GG3A 4U6EA 2HOWA
chains in the Genus database with same CATH superfamily
2GG7A 3RORA 2BHBA 1PV9A 2V3YA 4U6WA 4PNCA 1N51A 2GG2A 4RZZA 3BIPA 3CTZA 1YW7A 2OAZA 5JFRA 1XGNA 2OKNA 1WN1A 4IKRA 3D27A 4U75A 3PKDA 2BWVA 4U6ZA 2BN7A 2GG0A 4R60A 2Q93A 3IG4A 1WKMA 1XGMA 1W7VA 4FLKA 4IPAA 2IW2A 4S00A 5CLSA 2DFIA 3PKEA 4ZWPA 2GG8A 3PKCA 3CB5A 4IU6A 2BB7A 1KP0A 4ZWOA 1B59A 2GU6A 4FLIA 1QXWA 2BHDA 2Q95A 3PKBA 1YW8A 4FO8A 4KM3A 3TB5A 2ZSGA 2BWWA 2BH3A 4JUQA 4S2RP 2G6PA 1B6AA 5CNXA 2Q96A 4IKTA 1XGSA 1WL9A 2Q8KA 2BHCA 3RVAA 2GZ5A 2EA2A 1C22A 2P99A 5JHUA 1KQ9A 2GA2A 2NQ7A 4ZNGA 3TAVA 2MATA 2GGBA 1C21A 1WLRA 2B3KA 4S01A 4U71A 5D6EA 1R5HA 4IF7A 2B3LA 1XNZA 4ZWUA 5CE6A 1C24A 4RZYA 4A6VA 2BWYA 2BWSA 4OOKA 5E5BA 1BN5A 1C27A 3L24A 4FLJA 4U70A 4U6CA 2Q94A 3FMRA 1Y1NA 4FLLA 2GU7A 2P98A 1QXZA 4U69A 2Q92A 3Q6DA 2B3HA 1O0XA 2BWXA 1R58A 1A16A 3FMQA 2GG9A 2V3XA 1R5GA 1YW9A 3IU9A 1BOAA 2EVMA 4FKCA 4RGZ1 4A6WA 3CB6A 1YJ3A 5CDVA 4S2TP 5JI6A 2V6CA 2BWUA 1CHMA 3L7GA 4PV4A 2GG5A 4IECA 3MX6A 1QXYA 5D6FA 3IU8A 2BWTA 1MATA 3MR1A 5CIKA 1WBQA 5CDLA 5FCHA 3MATA 1M35A 2EVOA 2EVCA 2NQ6A 3PKAA 4EGEA 2EA4A 1C23A 1JAWA 3BITA 4MATA 4U6JA 4U1BA 2GGCA 1WY2A 5CDEA 3FM3A 1YVMA 4IKSA 1WL6A 1KQ0A 4QR8A 3BIQA 4IKUA 1W2MA 4U76A 4IDYA 2V3ZA 2GU4A 4FO7A 4HXXA 2GTXA 2P9AA 4U73A 5FCFA 2ADUA 2BHAA 1XGOA 3IU7A 2GU5A 4FUKA 3S6BA 4B28A 4Z7MA 1QZYA 2GG3A 4U6EA 2HOWA
chains in the Genus database with same CATH topology
2GG7A 3RORA 2BHBA 1PV9A 2V3YA 4U6WA 4PNCA 1N51A 2GG2A 4RZZA 3BIPA 3CTZA 1YW7A 2OAZA 5JFRA 1XGNA 2OKNA 1WN1A 4IKRA 3D27A 4U75A 3PKDA 2BWVA 4U6ZA 2BN7A 2GG0A 4R60A 2Q93A 3IG4A 1WKMA 1XGMA 1W7VA 4FLKA 4IPAA 2IW2A 4S00A 5CLSA 2DFIA 3PKEA 4ZWPA 2GG8A 3PKCA 3CB5A 4IU6A 2BB7A 1KP0A 4ZWOA 1B59A 2GU6A 4FLIA 1QXWA 2BHDA 2Q95A 3PKBA 1YW8A 4FO8A 4KM3A 3TB5A 2ZSGA 2BWWA 2BH3A 4JUQA 4S2RP 2G6PA 1B6AA 5CNXA 2Q96A 4IKTA 1XGSA 1WL9A 2Q8KA 2BHCA 3RVAA 2GZ5A 2EA2A 1C22A 2P99A 5JHUA 1KQ9A 2GA2A 2NQ7A 4ZNGA 3TAVA 2MATA 2GGBA 1C21A 1WLRA 2B3KA 4S01A 4U71A 5D6EA 1R5HA 4IF7A 2B3LA 1XNZA 4ZWUA 5CE6A 1C24A 4RZYA 4A6VA 2BWYA 2BWSA 4OOKA 5E5BA 1BN5A 1C27A 3L24A 4FLJA 4U70A 4U6CA 2Q94A 3FMRA 1Y1NA 4FLLA 2GU7A 2P98A 1QXZA 4U69A 2Q92A 3Q6DA 2B3HA 1O0XA 2BWXA 1R58A 1A16A 3FMQA 2GG9A 2V3XA 1R5GA 1YW9A 3IU9A 1BOAA 2EVMA 4FKCA 4RGZ1 4A6WA 3CB6A 1YJ3A 5CDVA 4S2TP 5JI6A 2V6CA 2BWUA 1CHMA 3L7GA 4PV4A 2GG5A 4IECA 3MX6A 1QXYA 5D6FA 3IU8A 2BWTA 1MATA 3MR1A 5CIKA 1WBQA 5CDLA 5FCHA 3MATA 1M35A 2EVOA 2EVCA 2NQ6A 3PKAA 4EGEA 2EA4A 1C23A 1JAWA 3BITA 4MATA 4U6JA 4U1BA 2GGCA 1WY2A 5CDEA 3FM3A 1YVMA 4IKSA 1WL6A 1KQ0A 4QR8A 3BIQA 4IKUA 1W2MA 4U76A 4IDYA 2V3ZA 2GU4A 4FO7A 4HXXA 2GTXA 2P9AA 4U73A 5FCFA 2ADUA 2BHAA 1XGOA 3IU7A 2GU5A 4FUKA 3S6BA 4B28A 4Z7MA 1QZYA 2GG3A 4U6EA 2HOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG7 A;  3ROR A;  2BHB A;  1PV9 A;  2V3Y A;  4U6W A;  4PNC A;  1N51 A;  2GG2 A;  4RZZ A;  3BIP A;  3CTZ A;  1YW7 A;  2OAZ A;  5JFR A;  1XGN A;  2OKN A;  1WN1 A;  4IKR A;  3D27 A;  4U75 A;  3PKD A;  2BWV A;  4U6Z A;  2BN7 A;  2GG0 A;  4R60 A;  2Q93 A;  3IG4 A;  1WKM A;  1XGM A;  1W7V A;  4FLK A;  4IPA A;  2IW2 A;  4S00 A;  5CLS A;  2DFI A;  3PKE A;  4ZWP A;  2GG8 A;  3PKC A;  3CB5 A;  4IU6 A;  2BB7 A;  1KP0 A;  4ZWO A;  1B59 A;  2GU6 A;  4FLI A;  1QXW A;  2BHD A;  2Q95 A;  3PKB A;  1YW8 A;  4FO8 A;  4KM3 A;  3TB5 A;  2ZSG A;  2BWW A;  2BH3 A;  4JUQ A;  4S2R P;  2G6P A;  1B6A A;  5CNX A;  2Q96 A;  4IKT A;  1XGS A;  1WL9 A;  2Q8K A;  2BHC A;  3RVA A;  2GZ5 A;  2EA2 A;  1C22 A;  2P99 A;  5JHU A;  1KQ9 A;  2GA2 A;  2NQ7 A;  4ZNG A;  3TAV A;  2MAT A;  2GGB A;  1C21 A;  1WLR A;  2B3K A;  4S01 A;  4U71 A;  5D6E A;  1R5H A;  4IF7 A;  2B3L A;  1XNZ A;  4ZWU A;  5CE6 A;  1C24 A;  4RZY A;  4A6V A;  2BWY A;  2BWS A;  4OOK A;  5E5B A;  1BN5 A;  1C27 A;  3L24 A;  4FLJ A;  4U70 A;  4U6C A;  2Q94 A;  3FMR A;  1Y1N A;  4FLL A;  2GU7 A;  2P98 A;  1QXZ A;  4U69 A;  2Q92 A;  3Q6D A;  2B3H A;  1O0X A;  2BWX A;  1R58 A;  1A16 A;  3FMQ A;  2GG9 A;  2V3X A;  1R5G A;  1YW9 A;  3IU9 A;  1BOA A;  2EVM A;  4FKC A;  4RGZ 1;  4A6W A;  3CB6 A;  1YJ3 A;  5CDV A;  4S2T P;  5JI6 A;  2V6C A;  2BWU A;  1CHM A;  3L7G A;  4PV4 A;  2GG5 A;  4IEC A;  3MX6 A;  1QXY A;  5D6F A;  3IU8 A;  2BWT A;  1MAT A;  3MR1 A;  5CIK A;  1WBQ A;  5CDL A;  5FCH A;  3MAT A;  1M35 A;  2EVO A;  2EVC A;  2NQ6 A;  3PKA A;  4EGE A;  2EA4 A;  1C23 A;  1JAW A;  3BIT A;  4MAT A;  4U6J A;  4U1B A;  2GGC A;  1WY2 A;  5CDE A;  3FM3 A;  1YVM A;  4IKS A;  1WL6 A;  1KQ0 A;  4QR8 A;  3BIQ A;  4IKU A;  1W2M A;  4U76 A;  4IDY A;  2V3Z A;  2GU4 A;  4FO7 A;  4HXX A;  2GTX A;  2P9A A;  4U73 A;  5FCF A;  2ADU A;  2BHA A;  1XGO A;  3IU7 A;  2GU5 A;  4FUK A;  3S6B A;  4B28 A;  4Z7M A;  1QZY A;  2GG3 A;  4U6E A;  2HOW A; 
#chains in the Genus database with same CATH topology
 2GG7 A;  3ROR A;  2BHB A;  1PV9 A;  2V3Y A;  4U6W A;  4PNC A;  1N51 A;  2GG2 A;  4RZZ A;  3BIP A;  3CTZ A;  1YW7 A;  2OAZ A;  5JFR A;  1XGN A;  2OKN A;  1WN1 A;  4IKR A;  3D27 A;  4U75 A;  3PKD A;  2BWV A;  4U6Z A;  2BN7 A;  2GG0 A;  4R60 A;  2Q93 A;  3IG4 A;  1WKM A;  1XGM A;  1W7V A;  4FLK A;  4IPA A;  2IW2 A;  4S00 A;  5CLS A;  2DFI A;  3PKE A;  4ZWP A;  2GG8 A;  3PKC A;  3CB5 A;  4IU6 A;  2BB7 A;  1KP0 A;  4ZWO A;  1B59 A;  2GU6 A;  4FLI A;  1QXW A;  2BHD A;  2Q95 A;  3PKB A;  1YW8 A;  4FO8 A;  4KM3 A;  3TB5 A;  2ZSG A;  2BWW A;  2BH3 A;  4JUQ A;  4S2R P;  2G6P A;  1B6A A;  5CNX A;  2Q96 A;  4IKT A;  1XGS A;  1WL9 A;  2Q8K A;  2BHC A;  3RVA A;  2GZ5 A;  2EA2 A;  1C22 A;  2P99 A;  5JHU A;  1KQ9 A;  2GA2 A;  2NQ7 A;  4ZNG A;  3TAV A;  2MAT A;  2GGB A;  1C21 A;  1WLR A;  2B3K A;  4S01 A;  4U71 A;  5D6E A;  1R5H A;  4IF7 A;  2B3L A;  1XNZ A;  4ZWU A;  5CE6 A;  1C24 A;  4RZY A;  4A6V A;  2BWY A;  2BWS A;  4OOK A;  5E5B A;  1BN5 A;  1C27 A;  3L24 A;  4FLJ A;  4U70 A;  4U6C A;  2Q94 A;  3FMR A;  1Y1N A;  4FLL A;  2GU7 A;  2P98 A;  1QXZ A;  4U69 A;  2Q92 A;  3Q6D A;  2B3H A;  1O0X A;  2BWX A;  1R58 A;  1A16 A;  3FMQ A;  2GG9 A;  2V3X A;  1R5G A;  1YW9 A;  3IU9 A;  1BOA A;  2EVM A;  4FKC A;  4RGZ 1;  4A6W A;  3CB6 A;  1YJ3 A;  5CDV A;  4S2T P;  5JI6 A;  2V6C A;  2BWU A;  1CHM A;  3L7G A;  4PV4 A;  2GG5 A;  4IEC A;  3MX6 A;  1QXY A;  5D6F A;  3IU8 A;  2BWT A;  1MAT A;  3MR1 A;  5CIK A;  1WBQ A;  5CDL A;  5FCH A;  3MAT A;  1M35 A;  2EVO A;  2EVC A;  2NQ6 A;  3PKA A;  4EGE A;  2EA4 A;  1C23 A;  1JAW A;  3BIT A;  4MAT A;  4U6J A;  4U1B A;  2GGC A;  1WY2 A;  5CDE A;  3FM3 A;  1YVM A;  4IKS A;  1WL6 A;  1KQ0 A;  4QR8 A;  3BIQ A;  4IKU A;  1W2M A;  4U76 A;  4IDY A;  2V3Z A;  2GU4 A;  4FO7 A;  4HXX A;  2GTX A;  2P9A A;  4U73 A;  5FCF A;  2ADU A;  2BHA A;  1XGO A;  3IU7 A;  2GU5 A;  4FUK A;  3S6B A;  4B28 A;  4Z7M A;  1QZY A;  2GG3 A;  4U6E A;  2HOW A; 
#chains in the Genus database with same CATH homology
 2GG7 A;  3ROR A;  2BHB A;  1PV9 A;  2V3Y A;  4U6W A;  4PNC A;  1N51 A;  2GG2 A;  4RZZ A;  3BIP A;  3CTZ A;  1YW7 A;  2OAZ A;  5JFR A;  1XGN A;  2OKN A;  1WN1 A;  4IKR A;  3D27 A;  4U75 A;  3PKD A;  2BWV A;  4U6Z A;  2BN7 A;  2GG0 A;  4R60 A;  2Q93 A;  3IG4 A;  1WKM A;  1XGM A;  1W7V A;  4FLK A;  4IPA A;  2IW2 A;  4S00 A;  5CLS A;  2DFI A;  3PKE A;  4ZWP A;  2GG8 A;  3PKC A;  3CB5 A;  4IU6 A;  2BB7 A;  1KP0 A;  4ZWO A;  1B59 A;  2GU6 A;  4FLI A;  1QXW A;  2BHD A;  2Q95 A;  3PKB A;  1YW8 A;  4FO8 A;  4KM3 A;  3TB5 A;  2ZSG A;  2BWW A;  2BH3 A;  4JUQ A;  4S2R P;  2G6P A;  1B6A A;  5CNX A;  2Q96 A;  4IKT A;  1XGS A;  1WL9 A;  2Q8K A;  2BHC A;  3RVA A;  2GZ5 A;  2EA2 A;  1C22 A;  2P99 A;  5JHU A;  1KQ9 A;  2GA2 A;  2NQ7 A;  4ZNG A;  3TAV A;  2MAT A;  2GGB A;  1C21 A;  1WLR A;  2B3K A;  4S01 A;  4U71 A;  5D6E A;  1R5H A;  4IF7 A;  2B3L A;  1XNZ A;  4ZWU A;  5CE6 A;  1C24 A;  4RZY A;  4A6V A;  2BWY A;  2BWS A;  4OOK A;  5E5B A;  1BN5 A;  1C27 A;  3L24 A;  4FLJ A;  4U70 A;  4U6C A;  2Q94 A;  3FMR A;  1Y1N A;  4FLL A;  2GU7 A;  2P98 A;  1QXZ A;  4U69 A;  2Q92 A;  3Q6D A;  2B3H A;  1O0X A;  2BWX A;  1R58 A;  1A16 A;  3FMQ A;  2GG9 A;  2V3X A;  1R5G A;  1YW9 A;  3IU9 A;  1BOA A;  2EVM A;  4FKC A;  4RGZ 1;  4A6W A;  3CB6 A;  1YJ3 A;  5CDV A;  4S2T P;  5JI6 A;  2V6C A;  2BWU A;  1CHM A;  3L7G A;  4PV4 A;  2GG5 A;  4IEC A;  3MX6 A;  1QXY A;  5D6F A;  3IU8 A;  2BWT A;  1MAT A;  3MR1 A;  5CIK A;  1WBQ A;  5CDL A;  5FCH A;  3MAT A;  1M35 A;  2EVO A;  2EVC A;  2NQ6 A;  3PKA A;  4EGE A;  2EA4 A;  1C23 A;  1JAW A;  3BIT A;  4MAT A;  4U6J A;  4U1B A;  2GGC A;  1WY2 A;  5CDE A;  3FM3 A;  1YVM A;  4IKS A;  1WL6 A;  1KQ0 A;  4QR8 A;  3BIQ A;  4IKU A;  1W2M A;  4U76 A;  4IDY A;  2V3Z A;  2GU4 A;  4FO7 A;  4HXX A;  2GTX A;  2P9A A;  4U73 A;  5FCF A;  2ADU A;  2BHA A;  1XGO A;  3IU7 A;  2GU5 A;  4FUK A;  3S6B A;  4B28 A;  4Z7M A;  1QZY A;  2GG3 A;  4U6E A;  2HOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...