4U6ZA

Hsmetap(f309m) in complex with 1-amino-2-propylpentyl)phosphonic acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6zA00
5JFRA 3BIQA 4S2RP 2BH3A 1PV9A 2ZSGA 4IECA 4B28A 3IU8A 3PKBA 2OKNA 1QZYA 3IG4A 3PKEA 3CB5A 5CNXA 4Z7MA 1XNZA 4IU6A 2P99A 3BIPA 2G6PA 3IU9A 3RVAA 2BWTA 1B59A 2GU4A 3MX6A 4QR8A 1M35A 1BOAA 1O0XA 2DFIA 2GG3A 2P98A 1W2MA 3PKAA 2BWVA 2BN7A 1QXWA 1WKMA 4IKUA 1XGSA 4FLKA 1YJ3A 1YW7A 1W7VA 4U76A 4FO8A 3D27A 4U6ZA 4KM3A 4A6WA 2P9AA 1QXYA 1R58A 5CE6A 1C24A 4PNCA 2GGCA 3MR1A 4HXXA 1C27A 1WY2A 3BITA 4U75A 2Q92A 3FM3A 2B3HA 1XGNA 1Y1NA 2V6CA 1R5HA 3TAVA 4ZWPA 2Q95A 1MATA 3CTZA 4U71A 4FO7A 4IKTA 2OAZA 2GU6A 4OOKA 1C21A 4EGEA 1KQ9A 2EVOA 5CIKA 2GU5A 1YW9A 1YW8A 2BHAA 2BB7A 5JI6A 3IU7A 1BN5A 2BWXA 2GU7A 2GA2A 4IKRA 4U70A 2Q96A 2IW2A 1A16A 4ZNGA 2B3KA 2BHDA 2V3ZA 1WLRA 4S01A 5CDVA 1QXZA 5CLSA 2GZ5A 1JAWA 2B3LA 2Q94A 3FMQA 2EA2A 5CDLA 3L7GA 4FLIA 2GG5A 4S2TP 4U6JA 5FCFA 2BWUA 4FLLA 2GGBA 4A6VA 2Q93A 2GTXA 1C22A 1WL6A 2HOWA 1XGMA 2EA4A 2GG9A 4RGZ1 2BWSA 1CHMA 2GG0A 1WL9A 4U73A 2BHBA 5E5BA 1YVMA 2BWYA 2EVMA 4FKCA 4MATA 4S00A 4ZWUA 4JUQA 4U6WA 4U1BA 1B6AA 4IKSA 1N51A 2V3YA 4PV4A 3PKCA 2NQ6A 5D6FA 3S6BA 3FMRA 4IF7A 2ADUA 3RORA 1WBQA 2GG2A 4U6EA 1WN1A 4RZZA 2BWWA 4ZWOA 5CDEA 5JHUA 4FUKA 2EVCA 4U69A 1R5GA 2MATA 2Q8KA 2NQ7A 3Q6DA 2GG7A 1KQ0A 5D6EA 2BHCA 3L24A 4FLJA 3TB5A 1KP0A 3CB6A 3PKDA 2V3XA 1C23A 2GG8A 1XGOA 5FCHA 4IDYA 4RZYA 4R60A 4U6CA 4IPAA 3MATA
chains in the Genus database with same CATH superfamily
5JFRA 3BIQA 4S2RP 2BH3A 1PV9A 2ZSGA 4IECA 4B28A 3IU8A 3PKBA 2OKNA 1QZYA 3IG4A 3PKEA 3CB5A 5CNXA 4Z7MA 1XNZA 4IU6A 2P99A 3BIPA 2G6PA 3IU9A 3RVAA 2BWTA 1B59A 2GU4A 3MX6A 4QR8A 1M35A 1BOAA 1O0XA 2DFIA 2GG3A 2P98A 1W2MA 3PKAA 2BWVA 2BN7A 1QXWA 1WKMA 4IKUA 1XGSA 4FLKA 1YJ3A 1YW7A 1W7VA 4U76A 4FO8A 3D27A 4U6ZA 4KM3A 4A6WA 2P9AA 1QXYA 1R58A 5CE6A 1C24A 4PNCA 2GGCA 3MR1A 4HXXA 1C27A 1WY2A 3BITA 4U75A 2Q92A 3FM3A 2B3HA 1XGNA 1Y1NA 2V6CA 1R5HA 3TAVA 4ZWPA 2Q95A 1MATA 3CTZA 4U71A 4FO7A 4IKTA 2OAZA 2GU6A 4OOKA 1C21A 4EGEA 1KQ9A 2EVOA 5CIKA 2GU5A 1YW9A 1YW8A 2BHAA 2BB7A 5JI6A 3IU7A 1BN5A 2BWXA 2GU7A 2GA2A 4IKRA 4U70A 2Q96A 2IW2A 1A16A 4ZNGA 2B3KA 2BHDA 2V3ZA 1WLRA 4S01A 5CDVA 1QXZA 5CLSA 2GZ5A 1JAWA 2B3LA 2Q94A 3FMQA 2EA2A 5CDLA 3L7GA 4FLIA 2GG5A 4S2TP 4U6JA 5FCFA 2BWUA 4FLLA 2GGBA 4A6VA 2Q93A 2GTXA 1C22A 1WL6A 2HOWA 1XGMA 2EA4A 2GG9A 4RGZ1 2BWSA 1CHMA 2GG0A 1WL9A 4U73A 2BHBA 5E5BA 1YVMA 2BWYA 2EVMA 4FKCA 4MATA 4S00A 4ZWUA 4JUQA 4U6WA 4U1BA 1B6AA 4IKSA 1N51A 2V3YA 4PV4A 3PKCA 2NQ6A 5D6FA 3S6BA 3FMRA 4IF7A 2ADUA 3RORA 1WBQA 2GG2A 4U6EA 1WN1A 4RZZA 2BWWA 4ZWOA 5CDEA 5JHUA 4FUKA 2EVCA 4U69A 1R5GA 2MATA 2Q8KA 2NQ7A 3Q6DA 2GG7A 1KQ0A 5D6EA 2BHCA 3L24A 4FLJA 3TB5A 1KP0A 3CB6A 3PKDA 2V3XA 1C23A 2GG8A 1XGOA 5FCHA 4IDYA 4RZYA 4R60A 4U6CA 4IPAA 3MATA
chains in the Genus database with same CATH topology
5JFRA 3BIQA 4S2RP 2BH3A 1PV9A 2ZSGA 4IECA 4B28A 3IU8A 3PKBA 2OKNA 1QZYA 3IG4A 3PKEA 3CB5A 5CNXA 4Z7MA 1XNZA 4IU6A 2P99A 3BIPA 2G6PA 3IU9A 3RVAA 2BWTA 1B59A 2GU4A 3MX6A 4QR8A 1M35A 1BOAA 1O0XA 2DFIA 2GG3A 2P98A 1W2MA 3PKAA 2BWVA 2BN7A 1QXWA 1WKMA 4IKUA 1XGSA 4FLKA 1YJ3A 1YW7A 1W7VA 4U76A 4FO8A 3D27A 4U6ZA 4KM3A 4A6WA 2P9AA 1QXYA 1R58A 5CE6A 1C24A 4PNCA 2GGCA 3MR1A 4HXXA 1C27A 1WY2A 3BITA 4U75A 2Q92A 3FM3A 2B3HA 1XGNA 1Y1NA 2V6CA 1R5HA 3TAVA 4ZWPA 2Q95A 1MATA 3CTZA 4U71A 4FO7A 4IKTA 2OAZA 2GU6A 4OOKA 1C21A 4EGEA 1KQ9A 2EVOA 5CIKA 2GU5A 1YW9A 1YW8A 2BHAA 2BB7A 5JI6A 3IU7A 1BN5A 2BWXA 2GU7A 2GA2A 4IKRA 4U70A 2Q96A 2IW2A 1A16A 4ZNGA 2B3KA 2BHDA 2V3ZA 1WLRA 4S01A 5CDVA 1QXZA 5CLSA 2GZ5A 1JAWA 2B3LA 2Q94A 3FMQA 2EA2A 5CDLA 3L7GA 4FLIA 2GG5A 4S2TP 4U6JA 5FCFA 2BWUA 4FLLA 2GGBA 4A6VA 2Q93A 2GTXA 1C22A 1WL6A 2HOWA 1XGMA 2EA4A 2GG9A 4RGZ1 2BWSA 1CHMA 2GG0A 1WL9A 4U73A 2BHBA 5E5BA 1YVMA 2BWYA 2EVMA 4FKCA 4MATA 4S00A 4ZWUA 4JUQA 4U6WA 4U1BA 1B6AA 4IKSA 1N51A 2V3YA 4PV4A 3PKCA 2NQ6A 5D6FA 3S6BA 3FMRA 4IF7A 2ADUA 3RORA 1WBQA 2GG2A 4U6EA 1WN1A 4RZZA 2BWWA 4ZWOA 5CDEA 5JHUA 4FUKA 2EVCA 4U69A 1R5GA 2MATA 2Q8KA 2NQ7A 3Q6DA 2GG7A 1KQ0A 5D6EA 2BHCA 3L24A 4FLJA 3TB5A 1KP0A 3CB6A 3PKDA 2V3XA 1C23A 2GG8A 1XGOA 5FCHA 4IDYA 4RZYA 4R60A 4U6CA 4IPAA 3MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFR A;  3BIQ A;  4S2R P;  2BH3 A;  1PV9 A;  2ZSG A;  4IEC A;  4B28 A;  3IU8 A;  3PKB A;  2OKN A;  1QZY A;  3IG4 A;  3PKE A;  3CB5 A;  5CNX A;  4Z7M A;  1XNZ A;  4IU6 A;  2P99 A;  3BIP A;  2G6P A;  3IU9 A;  3RVA A;  2BWT A;  1B59 A;  2GU4 A;  3MX6 A;  4QR8 A;  1M35 A;  1BOA A;  1O0X A;  2DFI A;  2GG3 A;  2P98 A;  1W2M A;  3PKA A;  2BWV A;  2BN7 A;  1QXW A;  1WKM A;  4IKU A;  1XGS A;  4FLK A;  1YJ3 A;  1YW7 A;  1W7V A;  4U76 A;  4FO8 A;  3D27 A;  4U6Z A;  4KM3 A;  4A6W A;  2P9A A;  1QXY A;  1R58 A;  5CE6 A;  1C24 A;  4PNC A;  2GGC A;  3MR1 A;  4HXX A;  1C27 A;  1WY2 A;  3BIT A;  4U75 A;  2Q92 A;  3FM3 A;  2B3H A;  1XGN A;  1Y1N A;  2V6C A;  1R5H A;  3TAV A;  4ZWP A;  2Q95 A;  1MAT A;  3CTZ A;  4U71 A;  4FO7 A;  4IKT A;  2OAZ A;  2GU6 A;  4OOK A;  1C21 A;  4EGE A;  1KQ9 A;  2EVO A;  5CIK A;  2GU5 A;  1YW9 A;  1YW8 A;  2BHA A;  2BB7 A;  5JI6 A;  3IU7 A;  1BN5 A;  2BWX A;  2GU7 A;  2GA2 A;  4IKR A;  4U70 A;  2Q96 A;  2IW2 A;  1A16 A;  4ZNG A;  2B3K A;  2BHD A;  2V3Z A;  1WLR A;  4S01 A;  5CDV A;  1QXZ A;  5CLS A;  2GZ5 A;  1JAW A;  2B3L A;  2Q94 A;  3FMQ A;  2EA2 A;  5CDL A;  3L7G A;  4FLI A;  2GG5 A;  4S2T P;  4U6J A;  5FCF A;  2BWU A;  4FLL A;  2GGB A;  4A6V A;  2Q93 A;  2GTX A;  1C22 A;  1WL6 A;  2HOW A;  1XGM A;  2EA4 A;  2GG9 A;  4RGZ 1;  2BWS A;  1CHM A;  2GG0 A;  1WL9 A;  4U73 A;  2BHB A;  5E5B A;  1YVM A;  2BWY A;  2EVM A;  4FKC A;  4MAT A;  4S00 A;  4ZWU A;  4JUQ A;  4U6W A;  4U1B A;  1B6A A;  4IKS A;  1N51 A;  2V3Y A;  4PV4 A;  3PKC A;  2NQ6 A;  5D6F A;  3S6B A;  3FMR A;  4IF7 A;  2ADU A;  3ROR A;  1WBQ A;  2GG2 A;  4U6E A;  1WN1 A;  4RZZ A;  2BWW A;  4ZWO A;  5CDE A;  5JHU A;  4FUK A;  2EVC A;  4U69 A;  1R5G A;  2MAT A;  2Q8K A;  2NQ7 A;  3Q6D A;  2GG7 A;  1KQ0 A;  5D6E A;  2BHC A;  3L24 A;  4FLJ A;  3TB5 A;  1KP0 A;  3CB6 A;  3PKD A;  2V3X A;  1C23 A;  2GG8 A;  1XGO A;  5FCH A;  4IDY A;  4RZY A;  4R60 A;  4U6C A;  4IPA A;  3MAT A; 
#chains in the Genus database with same CATH topology
 5JFR A;  3BIQ A;  4S2R P;  2BH3 A;  1PV9 A;  2ZSG A;  4IEC A;  4B28 A;  3IU8 A;  3PKB A;  2OKN A;  1QZY A;  3IG4 A;  3PKE A;  3CB5 A;  5CNX A;  4Z7M A;  1XNZ A;  4IU6 A;  2P99 A;  3BIP A;  2G6P A;  3IU9 A;  3RVA A;  2BWT A;  1B59 A;  2GU4 A;  3MX6 A;  4QR8 A;  1M35 A;  1BOA A;  1O0X A;  2DFI A;  2GG3 A;  2P98 A;  1W2M A;  3PKA A;  2BWV A;  2BN7 A;  1QXW A;  1WKM A;  4IKU A;  1XGS A;  4FLK A;  1YJ3 A;  1YW7 A;  1W7V A;  4U76 A;  4FO8 A;  3D27 A;  4U6Z A;  4KM3 A;  4A6W A;  2P9A A;  1QXY A;  1R58 A;  5CE6 A;  1C24 A;  4PNC A;  2GGC A;  3MR1 A;  4HXX A;  1C27 A;  1WY2 A;  3BIT A;  4U75 A;  2Q92 A;  3FM3 A;  2B3H A;  1XGN A;  1Y1N A;  2V6C A;  1R5H A;  3TAV A;  4ZWP A;  2Q95 A;  1MAT A;  3CTZ A;  4U71 A;  4FO7 A;  4IKT A;  2OAZ A;  2GU6 A;  4OOK A;  1C21 A;  4EGE A;  1KQ9 A;  2EVO A;  5CIK A;  2GU5 A;  1YW9 A;  1YW8 A;  2BHA A;  2BB7 A;  5JI6 A;  3IU7 A;  1BN5 A;  2BWX A;  2GU7 A;  2GA2 A;  4IKR A;  4U70 A;  2Q96 A;  2IW2 A;  1A16 A;  4ZNG A;  2B3K A;  2BHD A;  2V3Z A;  1WLR A;  4S01 A;  5CDV A;  1QXZ A;  5CLS A;  2GZ5 A;  1JAW A;  2B3L A;  2Q94 A;  3FMQ A;  2EA2 A;  5CDL A;  3L7G A;  4FLI A;  2GG5 A;  4S2T P;  4U6J A;  5FCF A;  2BWU A;  4FLL A;  2GGB A;  4A6V A;  2Q93 A;  2GTX A;  1C22 A;  1WL6 A;  2HOW A;  1XGM A;  2EA4 A;  2GG9 A;  4RGZ 1;  2BWS A;  1CHM A;  2GG0 A;  1WL9 A;  4U73 A;  2BHB A;  5E5B A;  1YVM A;  2BWY A;  2EVM A;  4FKC A;  4MAT A;  4S00 A;  4ZWU A;  4JUQ A;  4U6W A;  4U1B A;  1B6A A;  4IKS A;  1N51 A;  2V3Y A;  4PV4 A;  3PKC A;  2NQ6 A;  5D6F A;  3S6B A;  3FMR A;  4IF7 A;  2ADU A;  3ROR A;  1WBQ A;  2GG2 A;  4U6E A;  1WN1 A;  4RZZ A;  2BWW A;  4ZWO A;  5CDE A;  5JHU A;  4FUK A;  2EVC A;  4U69 A;  1R5G A;  2MAT A;  2Q8K A;  2NQ7 A;  3Q6D A;  2GG7 A;  1KQ0 A;  5D6E A;  2BHC A;  3L24 A;  4FLJ A;  3TB5 A;  1KP0 A;  3CB6 A;  3PKD A;  2V3X A;  1C23 A;  2GG8 A;  1XGO A;  5FCH A;  4IDY A;  4RZY A;  4R60 A;  4U6C A;  4IPA A;  3MAT A; 
#chains in the Genus database with same CATH homology
 5JFR A;  3BIQ A;  4S2R P;  2BH3 A;  1PV9 A;  2ZSG A;  4IEC A;  4B28 A;  3IU8 A;  3PKB A;  2OKN A;  1QZY A;  3IG4 A;  3PKE A;  3CB5 A;  5CNX A;  4Z7M A;  1XNZ A;  4IU6 A;  2P99 A;  3BIP A;  2G6P A;  3IU9 A;  3RVA A;  2BWT A;  1B59 A;  2GU4 A;  3MX6 A;  4QR8 A;  1M35 A;  1BOA A;  1O0X A;  2DFI A;  2GG3 A;  2P98 A;  1W2M A;  3PKA A;  2BWV A;  2BN7 A;  1QXW A;  1WKM A;  4IKU A;  1XGS A;  4FLK A;  1YJ3 A;  1YW7 A;  1W7V A;  4U76 A;  4FO8 A;  3D27 A;  4U6Z A;  4KM3 A;  4A6W A;  2P9A A;  1QXY A;  1R58 A;  5CE6 A;  1C24 A;  4PNC A;  2GGC A;  3MR1 A;  4HXX A;  1C27 A;  1WY2 A;  3BIT A;  4U75 A;  2Q92 A;  3FM3 A;  2B3H A;  1XGN A;  1Y1N A;  2V6C A;  1R5H A;  3TAV A;  4ZWP A;  2Q95 A;  1MAT A;  3CTZ A;  4U71 A;  4FO7 A;  4IKT A;  2OAZ A;  2GU6 A;  4OOK A;  1C21 A;  4EGE A;  1KQ9 A;  2EVO A;  5CIK A;  2GU5 A;  1YW9 A;  1YW8 A;  2BHA A;  2BB7 A;  5JI6 A;  3IU7 A;  1BN5 A;  2BWX A;  2GU7 A;  2GA2 A;  4IKR A;  4U70 A;  2Q96 A;  2IW2 A;  1A16 A;  4ZNG A;  2B3K A;  2BHD A;  2V3Z A;  1WLR A;  4S01 A;  5CDV A;  1QXZ A;  5CLS A;  2GZ5 A;  1JAW A;  2B3L A;  2Q94 A;  3FMQ A;  2EA2 A;  5CDL A;  3L7G A;  4FLI A;  2GG5 A;  4S2T P;  4U6J A;  5FCF A;  2BWU A;  4FLL A;  2GGB A;  4A6V A;  2Q93 A;  2GTX A;  1C22 A;  1WL6 A;  2HOW A;  1XGM A;  2EA4 A;  2GG9 A;  4RGZ 1;  2BWS A;  1CHM A;  2GG0 A;  1WL9 A;  4U73 A;  2BHB A;  5E5B A;  1YVM A;  2BWY A;  2EVM A;  4FKC A;  4MAT A;  4S00 A;  4ZWU A;  4JUQ A;  4U6W A;  4U1B A;  1B6A A;  4IKS A;  1N51 A;  2V3Y A;  4PV4 A;  3PKC A;  2NQ6 A;  5D6F A;  3S6B A;  3FMR A;  4IF7 A;  2ADU A;  3ROR A;  1WBQ A;  2GG2 A;  4U6E A;  1WN1 A;  4RZZ A;  2BWW A;  4ZWO A;  5CDE A;  5JHU A;  4FUK A;  2EVC A;  4U69 A;  1R5G A;  2MAT A;  2Q8K A;  2NQ7 A;  3Q6D A;  2GG7 A;  1KQ0 A;  5D6E A;  2BHC A;  3L24 A;  4FLJ A;  3TB5 A;  1KP0 A;  3CB6 A;  3PKD A;  2V3X A;  1C23 A;  2GG8 A;  1XGO A;  5FCH A;  4IDY A;  4RZY A;  4R60 A;  4U6C A;  4IPA A;  3MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...