4U6ZA

Hsmetap(f309m) in complex with 1-amino-2-propylpentyl)phosphonic acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6zA00
1A16A 4U6CA 4S00A 4FLJA 4IPAA 2GTXA 4FLKA 2EVCA 1XNZA 2EVOA 4OOKA 4U1BA 4EGEA 5FCFA 2Q95A 3RORA 1YJ3A 3RVAA 2BHAA 1WL6A 2GG0A 4S2TP 1R5GA 4A6WA 2BHDA 2V3XA 4U76A 5CIKA 5CLSA 4U69A 2G6PA 5JHUA 4IKUA 1QXWA 5CDVA 3MR1A 3PKEA 4ZWUA 3FMQA 2GG8A 1XGMA 1C23A 4FLLA 1QXZA 2BWVA 1QXYA 1WN1A 2HOWA 4S2RP 5CDEA 2MATA 3MATA 1W2MA 1QZYA 2BHCA 4FLIA 4RGZ1 1Y1NA 3FM3A 4IF7A 4IDYA 2OKNA 4IKTA 2B3LA 3D27A 4FUKA 2EA4A 3MX6A 4MATA 4Z7MA 5CE6A 1W7VA 4FKCA 3CB5A 4KM3A 2BH3A 2GGBA 1R58A 3BIPA 4U6WA 1YVMA 2BHBA 2BN7A 4U73A 1XGNA 2BWWA 2GG2A 4IECA 1WKMA 2BWXA 2Q94A 3L24A 5CDLA 5JFRA 1YW9A 4RZZA 2Q93A 2Q92A 1N51A 2DFIA 2ZSGA 2GU4A 2GU6A 2P9AA 1C24A 3CTZA 1YW8A 2GA2A 2NQ7A 5E5BA 4HXXA 2V6CA 1MATA 3PKCA 1KQ0A 5CNXA 1JAWA 2BWTA 2B3KA 1R5HA 1C21A 4PV4A 2P99A 2EA2A 4U6ZA 4IU6A 3BITA 1YW7A 3IU9A 4U71A 2B3HA 2GG7A 3FMRA 4QR8A 3Q6DA 5JI6A 5FCHA 4U6JA 3CB6A 4U75A 4RZYA 2GZ5A 2NQ6A 4FO8A 2P98A 2ADUA 3BIQA 4PNCA 4B28A 2EVMA 2BWSA 1M35A 2GU5A 5D6FA 4U6EA 4ZWPA 4IKSA 4FO7A 1B6AA 2OAZA 2IW2A 2GU7A 2V3YA 2BWUA 3PKBA 2GGCA 1CHMA 4ZNGA 4S01A 4IKRA 2V3ZA 2Q8KA 3TAVA 1XGSA 3L7GA 2GG9A 1KQ9A 1XGOA 1C27A 1WLRA 2Q96A 1C22A 3S6BA 1O0XA 3TB5A 3IG4A 1WBQA 5D6EA 4JUQA 1WL9A 4A6VA 3IU7A 1PV9A 3IU8A 2GG5A 4ZWOA 4R60A 1WY2A 2BB7A 1KP0A 3PKDA 2BWYA 1BOAA 1BN5A 2GG3A 3PKAA 1B59A 4U70A
chains in the Genus database with same CATH superfamily
1A16A 4U6CA 4S00A 4FLJA 4IPAA 2GTXA 4FLKA 2EVCA 1XNZA 2EVOA 4OOKA 4U1BA 4EGEA 5FCFA 2Q95A 3RORA 1YJ3A 3RVAA 2BHAA 1WL6A 2GG0A 4S2TP 1R5GA 4A6WA 2BHDA 2V3XA 4U76A 5CIKA 5CLSA 4U69A 2G6PA 5JHUA 4IKUA 1QXWA 5CDVA 3MR1A 3PKEA 4ZWUA 3FMQA 2GG8A 1XGMA 1C23A 4FLLA 1QXZA 2BWVA 1QXYA 1WN1A 2HOWA 4S2RP 5CDEA 2MATA 3MATA 1W2MA 1QZYA 2BHCA 4FLIA 4RGZ1 1Y1NA 3FM3A 4IF7A 4IDYA 2OKNA 4IKTA 2B3LA 3D27A 4FUKA 2EA4A 3MX6A 4MATA 4Z7MA 5CE6A 1W7VA 4FKCA 3CB5A 4KM3A 2BH3A 2GGBA 1R58A 3BIPA 4U6WA 1YVMA 2BHBA 2BN7A 4U73A 1XGNA 2BWWA 2GG2A 4IECA 1WKMA 2BWXA 2Q94A 3L24A 5CDLA 5JFRA 1YW9A 4RZZA 2Q93A 2Q92A 1N51A 2DFIA 2ZSGA 2GU4A 2GU6A 2P9AA 1C24A 3CTZA 1YW8A 2GA2A 2NQ7A 5E5BA 4HXXA 2V6CA 1MATA 3PKCA 1KQ0A 5CNXA 1JAWA 2BWTA 2B3KA 1R5HA 1C21A 4PV4A 2P99A 2EA2A 4U6ZA 4IU6A 3BITA 1YW7A 3IU9A 4U71A 2B3HA 2GG7A 3FMRA 4QR8A 3Q6DA 5JI6A 5FCHA 4U6JA 3CB6A 4U75A 4RZYA 2GZ5A 2NQ6A 4FO8A 2P98A 2ADUA 3BIQA 4PNCA 4B28A 2EVMA 2BWSA 1M35A 2GU5A 5D6FA 4U6EA 4ZWPA 4IKSA 4FO7A 1B6AA 2OAZA 2IW2A 2GU7A 2V3YA 2BWUA 3PKBA 2GGCA 1CHMA 4ZNGA 4S01A 4IKRA 2V3ZA 2Q8KA 3TAVA 1XGSA 3L7GA 2GG9A 1KQ9A 1XGOA 1C27A 1WLRA 2Q96A 1C22A 3S6BA 1O0XA 3TB5A 3IG4A 1WBQA 5D6EA 4JUQA 1WL9A 4A6VA 3IU7A 1PV9A 3IU8A 2GG5A 4ZWOA 4R60A 1WY2A 2BB7A 1KP0A 3PKDA 2BWYA 1BOAA 1BN5A 2GG3A 3PKAA 1B59A 4U70A
chains in the Genus database with same CATH topology
1A16A 4U6CA 4S00A 4FLJA 4IPAA 2GTXA 4FLKA 2EVCA 1XNZA 2EVOA 4OOKA 4U1BA 4EGEA 5FCFA 2Q95A 3RORA 1YJ3A 3RVAA 2BHAA 1WL6A 2GG0A 4S2TP 1R5GA 4A6WA 2BHDA 2V3XA 4U76A 5CIKA 5CLSA 4U69A 2G6PA 5JHUA 4IKUA 1QXWA 5CDVA 3MR1A 3PKEA 4ZWUA 3FMQA 2GG8A 1XGMA 1C23A 4FLLA 1QXZA 2BWVA 1QXYA 1WN1A 2HOWA 4S2RP 5CDEA 2MATA 3MATA 1W2MA 1QZYA 2BHCA 4FLIA 4RGZ1 1Y1NA 3FM3A 4IF7A 4IDYA 2OKNA 4IKTA 2B3LA 3D27A 4FUKA 2EA4A 3MX6A 4MATA 4Z7MA 5CE6A 1W7VA 4FKCA 3CB5A 4KM3A 2BH3A 2GGBA 1R58A 3BIPA 4U6WA 1YVMA 2BHBA 2BN7A 4U73A 1XGNA 2BWWA 2GG2A 4IECA 1WKMA 2BWXA 2Q94A 3L24A 5CDLA 5JFRA 1YW9A 4RZZA 2Q93A 2Q92A 1N51A 2DFIA 2ZSGA 2GU4A 2GU6A 2P9AA 1C24A 3CTZA 1YW8A 2GA2A 2NQ7A 5E5BA 4HXXA 2V6CA 1MATA 3PKCA 1KQ0A 5CNXA 1JAWA 2BWTA 2B3KA 1R5HA 1C21A 4PV4A 2P99A 2EA2A 4U6ZA 4IU6A 3BITA 1YW7A 3IU9A 4U71A 2B3HA 2GG7A 3FMRA 4QR8A 3Q6DA 5JI6A 5FCHA 4U6JA 3CB6A 4U75A 4RZYA 2GZ5A 2NQ6A 4FO8A 2P98A 2ADUA 3BIQA 4PNCA 4B28A 2EVMA 2BWSA 1M35A 2GU5A 5D6FA 4U6EA 4ZWPA 4IKSA 4FO7A 1B6AA 2OAZA 2IW2A 2GU7A 2V3YA 2BWUA 3PKBA 2GGCA 1CHMA 4ZNGA 4S01A 4IKRA 2V3ZA 2Q8KA 3TAVA 1XGSA 3L7GA 2GG9A 1KQ9A 1XGOA 1C27A 1WLRA 2Q96A 1C22A 3S6BA 1O0XA 3TB5A 3IG4A 1WBQA 5D6EA 4JUQA 1WL9A 4A6VA 3IU7A 1PV9A 3IU8A 2GG5A 4ZWOA 4R60A 1WY2A 2BB7A 1KP0A 3PKDA 2BWYA 1BOAA 1BN5A 2GG3A 3PKAA 1B59A 4U70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A16 A;  4U6C A;  4S00 A;  4FLJ A;  4IPA A;  2GTX A;  4FLK A;  2EVC A;  1XNZ A;  2EVO A;  4OOK A;  4U1B A;  4EGE A;  5FCF A;  2Q95 A;  3ROR A;  1YJ3 A;  3RVA A;  2BHA A;  1WL6 A;  2GG0 A;  4S2T P;  1R5G A;  4A6W A;  2BHD A;  2V3X A;  4U76 A;  5CIK A;  5CLS A;  4U69 A;  2G6P A;  5JHU A;  4IKU A;  1QXW A;  5CDV A;  3MR1 A;  3PKE A;  4ZWU A;  3FMQ A;  2GG8 A;  1XGM A;  1C23 A;  4FLL A;  1QXZ A;  2BWV A;  1QXY A;  1WN1 A;  2HOW A;  4S2R P;  5CDE A;  2MAT A;  3MAT A;  1W2M A;  1QZY A;  2BHC A;  4FLI A;  4RGZ 1;  1Y1N A;  3FM3 A;  4IF7 A;  4IDY A;  2OKN A;  4IKT A;  2B3L A;  3D27 A;  4FUK A;  2EA4 A;  3MX6 A;  4MAT A;  4Z7M A;  5CE6 A;  1W7V A;  4FKC A;  3CB5 A;  4KM3 A;  2BH3 A;  2GGB A;  1R58 A;  3BIP A;  4U6W A;  1YVM A;  2BHB A;  2BN7 A;  4U73 A;  1XGN A;  2BWW A;  2GG2 A;  4IEC A;  1WKM A;  2BWX A;  2Q94 A;  3L24 A;  5CDL A;  5JFR A;  1YW9 A;  4RZZ A;  2Q93 A;  2Q92 A;  1N51 A;  2DFI A;  2ZSG A;  2GU4 A;  2GU6 A;  2P9A A;  1C24 A;  3CTZ A;  1YW8 A;  2GA2 A;  2NQ7 A;  5E5B A;  4HXX A;  2V6C A;  1MAT A;  3PKC A;  1KQ0 A;  5CNX A;  1JAW A;  2BWT A;  2B3K A;  1R5H A;  1C21 A;  4PV4 A;  2P99 A;  2EA2 A;  4U6Z A;  4IU6 A;  3BIT A;  1YW7 A;  3IU9 A;  4U71 A;  2B3H A;  2GG7 A;  3FMR A;  4QR8 A;  3Q6D A;  5JI6 A;  5FCH A;  4U6J A;  3CB6 A;  4U75 A;  4RZY A;  2GZ5 A;  2NQ6 A;  4FO8 A;  2P98 A;  2ADU A;  3BIQ A;  4PNC A;  4B28 A;  2EVM A;  2BWS A;  1M35 A;  2GU5 A;  5D6F A;  4U6E A;  4ZWP A;  4IKS A;  4FO7 A;  1B6A A;  2OAZ A;  2IW2 A;  2GU7 A;  2V3Y A;  2BWU A;  3PKB A;  2GGC A;  1CHM A;  4ZNG A;  4S01 A;  4IKR A;  2V3Z A;  2Q8K A;  3TAV A;  1XGS A;  3L7G A;  2GG9 A;  1KQ9 A;  1XGO A;  1C27 A;  1WLR A;  2Q96 A;  1C22 A;  3S6B A;  1O0X A;  3TB5 A;  3IG4 A;  1WBQ A;  5D6E A;  4JUQ A;  1WL9 A;  4A6V A;  3IU7 A;  1PV9 A;  3IU8 A;  2GG5 A;  4ZWO A;  4R60 A;  1WY2 A;  2BB7 A;  1KP0 A;  3PKD A;  2BWY A;  1BOA A;  1BN5 A;  2GG3 A;  3PKA A;  1B59 A;  4U70 A; 
#chains in the Genus database with same CATH topology
 1A16 A;  4U6C A;  4S00 A;  4FLJ A;  4IPA A;  2GTX A;  4FLK A;  2EVC A;  1XNZ A;  2EVO A;  4OOK A;  4U1B A;  4EGE A;  5FCF A;  2Q95 A;  3ROR A;  1YJ3 A;  3RVA A;  2BHA A;  1WL6 A;  2GG0 A;  4S2T P;  1R5G A;  4A6W A;  2BHD A;  2V3X A;  4U76 A;  5CIK A;  5CLS A;  4U69 A;  2G6P A;  5JHU A;  4IKU A;  1QXW A;  5CDV A;  3MR1 A;  3PKE A;  4ZWU A;  3FMQ A;  2GG8 A;  1XGM A;  1C23 A;  4FLL A;  1QXZ A;  2BWV A;  1QXY A;  1WN1 A;  2HOW A;  4S2R P;  5CDE A;  2MAT A;  3MAT A;  1W2M A;  1QZY A;  2BHC A;  4FLI A;  4RGZ 1;  1Y1N A;  3FM3 A;  4IF7 A;  4IDY A;  2OKN A;  4IKT A;  2B3L A;  3D27 A;  4FUK A;  2EA4 A;  3MX6 A;  4MAT A;  4Z7M A;  5CE6 A;  1W7V A;  4FKC A;  3CB5 A;  4KM3 A;  2BH3 A;  2GGB A;  1R58 A;  3BIP A;  4U6W A;  1YVM A;  2BHB A;  2BN7 A;  4U73 A;  1XGN A;  2BWW A;  2GG2 A;  4IEC A;  1WKM A;  2BWX A;  2Q94 A;  3L24 A;  5CDL A;  5JFR A;  1YW9 A;  4RZZ A;  2Q93 A;  2Q92 A;  1N51 A;  2DFI A;  2ZSG A;  2GU4 A;  2GU6 A;  2P9A A;  1C24 A;  3CTZ A;  1YW8 A;  2GA2 A;  2NQ7 A;  5E5B A;  4HXX A;  2V6C A;  1MAT A;  3PKC A;  1KQ0 A;  5CNX A;  1JAW A;  2BWT A;  2B3K A;  1R5H A;  1C21 A;  4PV4 A;  2P99 A;  2EA2 A;  4U6Z A;  4IU6 A;  3BIT A;  1YW7 A;  3IU9 A;  4U71 A;  2B3H A;  2GG7 A;  3FMR A;  4QR8 A;  3Q6D A;  5JI6 A;  5FCH A;  4U6J A;  3CB6 A;  4U75 A;  4RZY A;  2GZ5 A;  2NQ6 A;  4FO8 A;  2P98 A;  2ADU A;  3BIQ A;  4PNC A;  4B28 A;  2EVM A;  2BWS A;  1M35 A;  2GU5 A;  5D6F A;  4U6E A;  4ZWP A;  4IKS A;  4FO7 A;  1B6A A;  2OAZ A;  2IW2 A;  2GU7 A;  2V3Y A;  2BWU A;  3PKB A;  2GGC A;  1CHM A;  4ZNG A;  4S01 A;  4IKR A;  2V3Z A;  2Q8K A;  3TAV A;  1XGS A;  3L7G A;  2GG9 A;  1KQ9 A;  1XGO A;  1C27 A;  1WLR A;  2Q96 A;  1C22 A;  3S6B A;  1O0X A;  3TB5 A;  3IG4 A;  1WBQ A;  5D6E A;  4JUQ A;  1WL9 A;  4A6V A;  3IU7 A;  1PV9 A;  3IU8 A;  2GG5 A;  4ZWO A;  4R60 A;  1WY2 A;  2BB7 A;  1KP0 A;  3PKD A;  2BWY A;  1BOA A;  1BN5 A;  2GG3 A;  3PKA A;  1B59 A;  4U70 A; 
#chains in the Genus database with same CATH homology
 1A16 A;  4U6C A;  4S00 A;  4FLJ A;  4IPA A;  2GTX A;  4FLK A;  2EVC A;  1XNZ A;  2EVO A;  4OOK A;  4U1B A;  4EGE A;  5FCF A;  2Q95 A;  3ROR A;  1YJ3 A;  3RVA A;  2BHA A;  1WL6 A;  2GG0 A;  4S2T P;  1R5G A;  4A6W A;  2BHD A;  2V3X A;  4U76 A;  5CIK A;  5CLS A;  4U69 A;  2G6P A;  5JHU A;  4IKU A;  1QXW A;  5CDV A;  3MR1 A;  3PKE A;  4ZWU A;  3FMQ A;  2GG8 A;  1XGM A;  1C23 A;  4FLL A;  1QXZ A;  2BWV A;  1QXY A;  1WN1 A;  2HOW A;  4S2R P;  5CDE A;  2MAT A;  3MAT A;  1W2M A;  1QZY A;  2BHC A;  4FLI A;  4RGZ 1;  1Y1N A;  3FM3 A;  4IF7 A;  4IDY A;  2OKN A;  4IKT A;  2B3L A;  3D27 A;  4FUK A;  2EA4 A;  3MX6 A;  4MAT A;  4Z7M A;  5CE6 A;  1W7V A;  4FKC A;  3CB5 A;  4KM3 A;  2BH3 A;  2GGB A;  1R58 A;  3BIP A;  4U6W A;  1YVM A;  2BHB A;  2BN7 A;  4U73 A;  1XGN A;  2BWW A;  2GG2 A;  4IEC A;  1WKM A;  2BWX A;  2Q94 A;  3L24 A;  5CDL A;  5JFR A;  1YW9 A;  4RZZ A;  2Q93 A;  2Q92 A;  1N51 A;  2DFI A;  2ZSG A;  2GU4 A;  2GU6 A;  2P9A A;  1C24 A;  3CTZ A;  1YW8 A;  2GA2 A;  2NQ7 A;  5E5B A;  4HXX A;  2V6C A;  1MAT A;  3PKC A;  1KQ0 A;  5CNX A;  1JAW A;  2BWT A;  2B3K A;  1R5H A;  1C21 A;  4PV4 A;  2P99 A;  2EA2 A;  4U6Z A;  4IU6 A;  3BIT A;  1YW7 A;  3IU9 A;  4U71 A;  2B3H A;  2GG7 A;  3FMR A;  4QR8 A;  3Q6D A;  5JI6 A;  5FCH A;  4U6J A;  3CB6 A;  4U75 A;  4RZY A;  2GZ5 A;  2NQ6 A;  4FO8 A;  2P98 A;  2ADU A;  3BIQ A;  4PNC A;  4B28 A;  2EVM A;  2BWS A;  1M35 A;  2GU5 A;  5D6F A;  4U6E A;  4ZWP A;  4IKS A;  4FO7 A;  1B6A A;  2OAZ A;  2IW2 A;  2GU7 A;  2V3Y A;  2BWU A;  3PKB A;  2GGC A;  1CHM A;  4ZNG A;  4S01 A;  4IKR A;  2V3Z A;  2Q8K A;  3TAV A;  1XGS A;  3L7G A;  2GG9 A;  1KQ9 A;  1XGO A;  1C27 A;  1WLR A;  2Q96 A;  1C22 A;  3S6B A;  1O0X A;  3TB5 A;  3IG4 A;  1WBQ A;  5D6E A;  4JUQ A;  1WL9 A;  4A6V A;  3IU7 A;  1PV9 A;  3IU8 A;  2GG5 A;  4ZWO A;  4R60 A;  1WY2 A;  2BB7 A;  1KP0 A;  3PKD A;  2BWY A;  1BOA A;  1BN5 A;  2GG3 A;  3PKA A;  1B59 A;  4U70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...