4U6EA

Hsmetap in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6eA00
1MATA 2BWVA 1WY2A 2BWTA 1QXWA 1W7VA 5E5BA 4Z7MA 5D6EA 1YJ3A 4MATA 5CNXA 2BN7A 2EVMA 2V3ZA 3TB5A 2GU7A 2GZ5A 2BB7A 4U6EA 1C24A 2GU6A 4U75A 2BHBA 1YW8A 2P9AA 4FO8A 2V3XA 3FMQA 2GG7A 1XGNA 4IU6A 2EVCA 5CDVA 3BIQA 2BH3A 2P99A 3D27A 1C21A 4PNCA 2BWUA 4ZWOA 1KP0A 5CE6A 4QR8A 2EA4A 3FMRA 4A6VA 2OKNA 1XGMA 3PKEA 4IDYA 2ZSGA 4JUQA 2GU4A 1WKMA 3S6BA 1M35A 1KQ0A 1W2MA 2P98A 2Q94A 4FLLA 3TAVA 1WBQA 1N51A 4B28A 4S00A 4IKUA 4U70A 1BN5A 2B3LA 2NQ6A 2Q95A 4U69A 4HXXA 4R60A 2GG5A 2GG8A 4FO7A 3IG4A 4IF7A 2GTXA 4OOKA 3RORA 2GG3A 3IU9A 3IU8A 5JI6A 4IPAA 1R5GA 4IKRA 1PV9A 1B59A 2BWWA 2GG9A 1Y1NA 5CDEA 2BHCA 1BOAA 5JFRA 1R58A 5CIKA 4S2TP 1QXYA 4U6CA 1WN1A 3CTZA 1A16A 4U6JA 5D6FA 4FLJA 4FKCA 4FLKA 2BHAA 2V6CA 2Q92A 1QXZA 4IKSA 2DFIA 4U76A 2Q93A 2NQ7A 3RVAA 4IKTA 2BWYA 3PKAA 5CDLA 5FCHA 2EVOA 1YW9A 2OAZA 3BIPA 4U6WA 4S01A 4S2RP 3PKBA 1C22A 2IW2A 4FUKA 2ADUA 3BITA 1XGSA 2G6PA 2GA2A 1QZYA 3Q6DA 3CB5A 2GG0A 2Q8KA 2BWXA 3L24A 2B3HA 1YVMA 1YW7A 1XNZA 4U71A 3PKDA 4U1BA 1WLRA 1O0XA 1XGOA 3MATA 3FM3A 4A6WA 1B6AA 3IU7A 1KQ9A 2Q96A 2GGBA 2V3YA 4PV4A 1C23A 2GU5A 4KM3A 1WL6A 2GGCA 2HOWA 3MX6A 5FCFA 1C27A 3L7GA 4U6ZA 2GG2A 3MR1A 5JHUA 4ZWPA 2BWSA 4RZYA 1CHMA 2BHDA 4EGEA 4RZZA 5CLSA 1R5HA 2B3KA 4IECA 3PKCA 1WL9A 3CB6A 2MATA 4U73A 4RGZ1 4FLIA 4ZNGA 4ZWUA 2EA2A 1JAWA
chains in the Genus database with same CATH superfamily
1MATA 2BWVA 1WY2A 2BWTA 1QXWA 1W7VA 5E5BA 4Z7MA 5D6EA 1YJ3A 4MATA 5CNXA 2BN7A 2EVMA 2V3ZA 3TB5A 2GU7A 2GZ5A 2BB7A 4U6EA 1C24A 2GU6A 4U75A 2BHBA 1YW8A 2P9AA 4FO8A 2V3XA 3FMQA 2GG7A 1XGNA 4IU6A 2EVCA 5CDVA 3BIQA 2BH3A 2P99A 3D27A 1C21A 4PNCA 2BWUA 4ZWOA 1KP0A 5CE6A 4QR8A 2EA4A 3FMRA 4A6VA 2OKNA 1XGMA 3PKEA 4IDYA 2ZSGA 4JUQA 2GU4A 1WKMA 3S6BA 1M35A 1KQ0A 1W2MA 2P98A 2Q94A 4FLLA 3TAVA 1WBQA 1N51A 4B28A 4S00A 4IKUA 4U70A 1BN5A 2B3LA 2NQ6A 2Q95A 4U69A 4HXXA 4R60A 2GG5A 2GG8A 4FO7A 3IG4A 4IF7A 2GTXA 4OOKA 3RORA 2GG3A 3IU9A 3IU8A 5JI6A 4IPAA 1R5GA 4IKRA 1PV9A 1B59A 2BWWA 2GG9A 1Y1NA 5CDEA 2BHCA 1BOAA 5JFRA 1R58A 5CIKA 4S2TP 1QXYA 4U6CA 1WN1A 3CTZA 1A16A 4U6JA 5D6FA 4FLJA 4FKCA 4FLKA 2BHAA 2V6CA 2Q92A 1QXZA 4IKSA 2DFIA 4U76A 2Q93A 2NQ7A 3RVAA 4IKTA 2BWYA 3PKAA 5CDLA 5FCHA 2EVOA 1YW9A 2OAZA 3BIPA 4U6WA 4S01A 4S2RP 3PKBA 1C22A 2IW2A 4FUKA 2ADUA 3BITA 1XGSA 2G6PA 2GA2A 1QZYA 3Q6DA 3CB5A 2GG0A 2Q8KA 2BWXA 3L24A 2B3HA 1YVMA 1YW7A 1XNZA 4U71A 3PKDA 4U1BA 1WLRA 1O0XA 1XGOA 3MATA 3FM3A 4A6WA 1B6AA 3IU7A 1KQ9A 2Q96A 2GGBA 2V3YA 4PV4A 1C23A 2GU5A 4KM3A 1WL6A 2GGCA 2HOWA 3MX6A 5FCFA 1C27A 3L7GA 4U6ZA 2GG2A 3MR1A 5JHUA 4ZWPA 2BWSA 4RZYA 1CHMA 2BHDA 4EGEA 4RZZA 5CLSA 1R5HA 2B3KA 4IECA 3PKCA 1WL9A 3CB6A 2MATA 4U73A 4RGZ1 4FLIA 4ZNGA 4ZWUA 2EA2A 1JAWA
chains in the Genus database with same CATH topology
1MATA 2BWVA 1WY2A 2BWTA 1QXWA 1W7VA 5E5BA 4Z7MA 5D6EA 1YJ3A 4MATA 5CNXA 2BN7A 2EVMA 2V3ZA 3TB5A 2GU7A 2GZ5A 2BB7A 4U6EA 1C24A 2GU6A 4U75A 2BHBA 1YW8A 2P9AA 4FO8A 2V3XA 3FMQA 2GG7A 1XGNA 4IU6A 2EVCA 5CDVA 3BIQA 2BH3A 2P99A 3D27A 1C21A 4PNCA 2BWUA 4ZWOA 1KP0A 5CE6A 4QR8A 2EA4A 3FMRA 4A6VA 2OKNA 1XGMA 3PKEA 4IDYA 2ZSGA 4JUQA 2GU4A 1WKMA 3S6BA 1M35A 1KQ0A 1W2MA 2P98A 2Q94A 4FLLA 3TAVA 1WBQA 1N51A 4B28A 4S00A 4IKUA 4U70A 1BN5A 2B3LA 2NQ6A 2Q95A 4U69A 4HXXA 4R60A 2GG5A 2GG8A 4FO7A 3IG4A 4IF7A 2GTXA 4OOKA 3RORA 2GG3A 3IU9A 3IU8A 5JI6A 4IPAA 1R5GA 4IKRA 1PV9A 1B59A 2BWWA 2GG9A 1Y1NA 5CDEA 2BHCA 1BOAA 5JFRA 1R58A 5CIKA 4S2TP 1QXYA 4U6CA 1WN1A 3CTZA 1A16A 4U6JA 5D6FA 4FLJA 4FKCA 4FLKA 2BHAA 2V6CA 2Q92A 1QXZA 4IKSA 2DFIA 4U76A 2Q93A 2NQ7A 3RVAA 4IKTA 2BWYA 3PKAA 5CDLA 5FCHA 2EVOA 1YW9A 2OAZA 3BIPA 4U6WA 4S01A 4S2RP 3PKBA 1C22A 2IW2A 4FUKA 2ADUA 3BITA 1XGSA 2G6PA 2GA2A 1QZYA 3Q6DA 3CB5A 2GG0A 2Q8KA 2BWXA 3L24A 2B3HA 1YVMA 1YW7A 1XNZA 4U71A 3PKDA 4U1BA 1WLRA 1O0XA 1XGOA 3MATA 3FM3A 4A6WA 1B6AA 3IU7A 1KQ9A 2Q96A 2GGBA 2V3YA 4PV4A 1C23A 2GU5A 4KM3A 1WL6A 2GGCA 2HOWA 3MX6A 5FCFA 1C27A 3L7GA 4U6ZA 2GG2A 3MR1A 5JHUA 4ZWPA 2BWSA 4RZYA 1CHMA 2BHDA 4EGEA 4RZZA 5CLSA 1R5HA 2B3KA 4IECA 3PKCA 1WL9A 3CB6A 2MATA 4U73A 4RGZ1 4FLIA 4ZNGA 4ZWUA 2EA2A 1JAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAT A;  2BWV A;  1WY2 A;  2BWT A;  1QXW A;  1W7V A;  5E5B A;  4Z7M A;  5D6E A;  1YJ3 A;  4MAT A;  5CNX A;  2BN7 A;  2EVM A;  2V3Z A;  3TB5 A;  2GU7 A;  2GZ5 A;  2BB7 A;  4U6E A;  1C24 A;  2GU6 A;  4U75 A;  2BHB A;  1YW8 A;  2P9A A;  4FO8 A;  2V3X A;  3FMQ A;  2GG7 A;  1XGN A;  4IU6 A;  2EVC A;  5CDV A;  3BIQ A;  2BH3 A;  2P99 A;  3D27 A;  1C21 A;  4PNC A;  2BWU A;  4ZWO A;  1KP0 A;  5CE6 A;  4QR8 A;  2EA4 A;  3FMR A;  4A6V A;  2OKN A;  1XGM A;  3PKE A;  4IDY A;  2ZSG A;  4JUQ A;  2GU4 A;  1WKM A;  3S6B A;  1M35 A;  1KQ0 A;  1W2M A;  2P98 A;  2Q94 A;  4FLL A;  3TAV A;  1WBQ A;  1N51 A;  4B28 A;  4S00 A;  4IKU A;  4U70 A;  1BN5 A;  2B3L A;  2NQ6 A;  2Q95 A;  4U69 A;  4HXX A;  4R60 A;  2GG5 A;  2GG8 A;  4FO7 A;  3IG4 A;  4IF7 A;  2GTX A;  4OOK A;  3ROR A;  2GG3 A;  3IU9 A;  3IU8 A;  5JI6 A;  4IPA A;  1R5G A;  4IKR A;  1PV9 A;  1B59 A;  2BWW A;  2GG9 A;  1Y1N A;  5CDE A;  2BHC A;  1BOA A;  5JFR A;  1R58 A;  5CIK A;  4S2T P;  1QXY A;  4U6C A;  1WN1 A;  3CTZ A;  1A16 A;  4U6J A;  5D6F A;  4FLJ A;  4FKC A;  4FLK A;  2BHA A;  2V6C A;  2Q92 A;  1QXZ A;  4IKS A;  2DFI A;  4U76 A;  2Q93 A;  2NQ7 A;  3RVA A;  4IKT A;  2BWY A;  3PKA A;  5CDL A;  5FCH A;  2EVO A;  1YW9 A;  2OAZ A;  3BIP A;  4U6W A;  4S01 A;  4S2R P;  3PKB A;  1C22 A;  2IW2 A;  4FUK A;  2ADU A;  3BIT A;  1XGS A;  2G6P A;  2GA2 A;  1QZY A;  3Q6D A;  3CB5 A;  2GG0 A;  2Q8K A;  2BWX A;  3L24 A;  2B3H A;  1YVM A;  1YW7 A;  1XNZ A;  4U71 A;  3PKD A;  4U1B A;  1WLR A;  1O0X A;  1XGO A;  3MAT A;  3FM3 A;  4A6W A;  1B6A A;  3IU7 A;  1KQ9 A;  2Q96 A;  2GGB A;  2V3Y A;  4PV4 A;  1C23 A;  2GU5 A;  4KM3 A;  1WL6 A;  2GGC A;  2HOW A;  3MX6 A;  5FCF A;  1C27 A;  3L7G A;  4U6Z A;  2GG2 A;  3MR1 A;  5JHU A;  4ZWP A;  2BWS A;  4RZY A;  1CHM A;  2BHD A;  4EGE A;  4RZZ A;  5CLS A;  1R5H A;  2B3K A;  4IEC A;  3PKC A;  1WL9 A;  3CB6 A;  2MAT A;  4U73 A;  4RGZ 1;  4FLI A;  4ZNG A;  4ZWU A;  2EA2 A;  1JAW A; 
#chains in the Genus database with same CATH topology
 1MAT A;  2BWV A;  1WY2 A;  2BWT A;  1QXW A;  1W7V A;  5E5B A;  4Z7M A;  5D6E A;  1YJ3 A;  4MAT A;  5CNX A;  2BN7 A;  2EVM A;  2V3Z A;  3TB5 A;  2GU7 A;  2GZ5 A;  2BB7 A;  4U6E A;  1C24 A;  2GU6 A;  4U75 A;  2BHB A;  1YW8 A;  2P9A A;  4FO8 A;  2V3X A;  3FMQ A;  2GG7 A;  1XGN A;  4IU6 A;  2EVC A;  5CDV A;  3BIQ A;  2BH3 A;  2P99 A;  3D27 A;  1C21 A;  4PNC A;  2BWU A;  4ZWO A;  1KP0 A;  5CE6 A;  4QR8 A;  2EA4 A;  3FMR A;  4A6V A;  2OKN A;  1XGM A;  3PKE A;  4IDY A;  2ZSG A;  4JUQ A;  2GU4 A;  1WKM A;  3S6B A;  1M35 A;  1KQ0 A;  1W2M A;  2P98 A;  2Q94 A;  4FLL A;  3TAV A;  1WBQ A;  1N51 A;  4B28 A;  4S00 A;  4IKU A;  4U70 A;  1BN5 A;  2B3L A;  2NQ6 A;  2Q95 A;  4U69 A;  4HXX A;  4R60 A;  2GG5 A;  2GG8 A;  4FO7 A;  3IG4 A;  4IF7 A;  2GTX A;  4OOK A;  3ROR A;  2GG3 A;  3IU9 A;  3IU8 A;  5JI6 A;  4IPA A;  1R5G A;  4IKR A;  1PV9 A;  1B59 A;  2BWW A;  2GG9 A;  1Y1N A;  5CDE A;  2BHC A;  1BOA A;  5JFR A;  1R58 A;  5CIK A;  4S2T P;  1QXY A;  4U6C A;  1WN1 A;  3CTZ A;  1A16 A;  4U6J A;  5D6F A;  4FLJ A;  4FKC A;  4FLK A;  2BHA A;  2V6C A;  2Q92 A;  1QXZ A;  4IKS A;  2DFI A;  4U76 A;  2Q93 A;  2NQ7 A;  3RVA A;  4IKT A;  2BWY A;  3PKA A;  5CDL A;  5FCH A;  2EVO A;  1YW9 A;  2OAZ A;  3BIP A;  4U6W A;  4S01 A;  4S2R P;  3PKB A;  1C22 A;  2IW2 A;  4FUK A;  2ADU A;  3BIT A;  1XGS A;  2G6P A;  2GA2 A;  1QZY A;  3Q6D A;  3CB5 A;  2GG0 A;  2Q8K A;  2BWX A;  3L24 A;  2B3H A;  1YVM A;  1YW7 A;  1XNZ A;  4U71 A;  3PKD A;  4U1B A;  1WLR A;  1O0X A;  1XGO A;  3MAT A;  3FM3 A;  4A6W A;  1B6A A;  3IU7 A;  1KQ9 A;  2Q96 A;  2GGB A;  2V3Y A;  4PV4 A;  1C23 A;  2GU5 A;  4KM3 A;  1WL6 A;  2GGC A;  2HOW A;  3MX6 A;  5FCF A;  1C27 A;  3L7G A;  4U6Z A;  2GG2 A;  3MR1 A;  5JHU A;  4ZWP A;  2BWS A;  4RZY A;  1CHM A;  2BHD A;  4EGE A;  4RZZ A;  5CLS A;  1R5H A;  2B3K A;  4IEC A;  3PKC A;  1WL9 A;  3CB6 A;  2MAT A;  4U73 A;  4RGZ 1;  4FLI A;  4ZNG A;  4ZWU A;  2EA2 A;  1JAW A; 
#chains in the Genus database with same CATH homology
 1MAT A;  2BWV A;  1WY2 A;  2BWT A;  1QXW A;  1W7V A;  5E5B A;  4Z7M A;  5D6E A;  1YJ3 A;  4MAT A;  5CNX A;  2BN7 A;  2EVM A;  2V3Z A;  3TB5 A;  2GU7 A;  2GZ5 A;  2BB7 A;  4U6E A;  1C24 A;  2GU6 A;  4U75 A;  2BHB A;  1YW8 A;  2P9A A;  4FO8 A;  2V3X A;  3FMQ A;  2GG7 A;  1XGN A;  4IU6 A;  2EVC A;  5CDV A;  3BIQ A;  2BH3 A;  2P99 A;  3D27 A;  1C21 A;  4PNC A;  2BWU A;  4ZWO A;  1KP0 A;  5CE6 A;  4QR8 A;  2EA4 A;  3FMR A;  4A6V A;  2OKN A;  1XGM A;  3PKE A;  4IDY A;  2ZSG A;  4JUQ A;  2GU4 A;  1WKM A;  3S6B A;  1M35 A;  1KQ0 A;  1W2M A;  2P98 A;  2Q94 A;  4FLL A;  3TAV A;  1WBQ A;  1N51 A;  4B28 A;  4S00 A;  4IKU A;  4U70 A;  1BN5 A;  2B3L A;  2NQ6 A;  2Q95 A;  4U69 A;  4HXX A;  4R60 A;  2GG5 A;  2GG8 A;  4FO7 A;  3IG4 A;  4IF7 A;  2GTX A;  4OOK A;  3ROR A;  2GG3 A;  3IU9 A;  3IU8 A;  5JI6 A;  4IPA A;  1R5G A;  4IKR A;  1PV9 A;  1B59 A;  2BWW A;  2GG9 A;  1Y1N A;  5CDE A;  2BHC A;  1BOA A;  5JFR A;  1R58 A;  5CIK A;  4S2T P;  1QXY A;  4U6C A;  1WN1 A;  3CTZ A;  1A16 A;  4U6J A;  5D6F A;  4FLJ A;  4FKC A;  4FLK A;  2BHA A;  2V6C A;  2Q92 A;  1QXZ A;  4IKS A;  2DFI A;  4U76 A;  2Q93 A;  2NQ7 A;  3RVA A;  4IKT A;  2BWY A;  3PKA A;  5CDL A;  5FCH A;  2EVO A;  1YW9 A;  2OAZ A;  3BIP A;  4U6W A;  4S01 A;  4S2R P;  3PKB A;  1C22 A;  2IW2 A;  4FUK A;  2ADU A;  3BIT A;  1XGS A;  2G6P A;  2GA2 A;  1QZY A;  3Q6D A;  3CB5 A;  2GG0 A;  2Q8K A;  2BWX A;  3L24 A;  2B3H A;  1YVM A;  1YW7 A;  1XNZ A;  4U71 A;  3PKD A;  4U1B A;  1WLR A;  1O0X A;  1XGO A;  3MAT A;  3FM3 A;  4A6W A;  1B6A A;  3IU7 A;  1KQ9 A;  2Q96 A;  2GGB A;  2V3Y A;  4PV4 A;  1C23 A;  2GU5 A;  4KM3 A;  1WL6 A;  2GGC A;  2HOW A;  3MX6 A;  5FCF A;  1C27 A;  3L7G A;  4U6Z A;  2GG2 A;  3MR1 A;  5JHU A;  4ZWP A;  2BWS A;  4RZY A;  1CHM A;  2BHD A;  4EGE A;  4RZZ A;  5CLS A;  1R5H A;  2B3K A;  4IEC A;  3PKC A;  1WL9 A;  3CB6 A;  2MAT A;  4U73 A;  4RGZ 1;  4FLI A;  4ZNG A;  4ZWU A;  2EA2 A;  1JAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...