4U6EA

Hsmetap in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6eA00
1C21A 1PV9A 1YJ3A 2Q93A 1WN1A 4IU6A 2BB7A 1C27A 1XNZA 3BIPA 3L24A 2BWVA 4EGEA 4PV4A 3TAVA 1XGNA 1QXYA 2BH3A 2BWTA 4MATA 2GG0A 2BHAA 5FCFA 1MATA 2P99A 2V3ZA 1YW9A 2P98A 2EA2A 2GG8A 4FLKA 1KQ0A 2EVOA 5JI6A 2EVCA 4IECA 4U6ZA 2OAZA 2GA2A 3IG4A 2B3LA 1B6AA 1R58A 4IKUA 2EVMA 4U6EA 5E5BA 3IU7A 2MATA 2BHDA 2P9AA 2GZ5A 2GG7A 2DFIA 2Q8KA 3PKEA 3RORA 3CB5A 5D6FA 2HOWA 1O0XA 4IKRA 1N51A 4R60A 4FLJA 4S2RP 4A6WA 2V6CA 2GG9A 2NQ6A 4JUQA 2NQ7A 1R5HA 4IF7A 1M35A 4FO7A 1BOAA 2GTXA 2IW2A 3D27A 2BWUA 4FLIA 4ZWPA 5FCHA 3PKBA 4U1BA 1W2MA 1KQ9A 1WLRA 4U71A 1Y1NA 2GGBA 1KP0A 1C22A 1QZYA 2V3XA 1YW7A 4IKSA 4RZYA 1BN5A 1XGSA 1R5GA 2GG3A 3CTZA 3MATA 4U73A 2GG5A 5CLSA 3PKDA 2OKNA 3FMQA 3BITA 4ZWUA 2GG2A 2ZSGA 4FUKA 3TB5A 4PNCA 1WKMA 5CE6A 1B59A 5CDLA 2B3KA 1CHMA 4OOKA 3S6BA 2GU6A 2Q94A 3IU8A 2GGCA 4S00A 5CIKA 2BWWA 2GU7A 3Q6DA 1WBQA 4FKCA 4FO8A 4IKTA 4HXXA 4ZWOA 2Q95A 1WL6A 4ZNGA 3PKCA 5D6EA 5CDVA 2V3YA 5CNXA 2BWXA 4RGZ1 1JAWA 3IU9A 1XGOA 4IPAA 4U6JA 1C23A 4S01A 4RZZA 1QXWA 1C24A 3FMRA 1QXZA 3MR1A 2EA4A 3FM3A 4U75A 2BHCA 5JFRA 1WY2A 3BIQA 4FLLA 4U6WA 2B3HA 4U76A 5CDEA 2GU5A 2Q92A 2BWSA 4KM3A 3RVAA 5JHUA 1W7VA 1A16A 4Z7MA 1WL9A 1YVMA 2BWYA 3CB6A 2GU4A 4B28A 2ADUA 4S2TP 4U6CA 1XGMA 4U70A 1YW8A 4A6VA 2Q96A 3L7GA 2BHBA 3MX6A 4U69A 4QR8A 2BN7A 3PKAA 2G6PA 4IDYA
chains in the Genus database with same CATH superfamily
1C21A 1PV9A 1YJ3A 2Q93A 1WN1A 4IU6A 2BB7A 1C27A 1XNZA 3BIPA 3L24A 2BWVA 4EGEA 4PV4A 3TAVA 1XGNA 1QXYA 2BH3A 2BWTA 4MATA 2GG0A 2BHAA 5FCFA 1MATA 2P99A 2V3ZA 1YW9A 2P98A 2EA2A 2GG8A 4FLKA 1KQ0A 2EVOA 5JI6A 2EVCA 4IECA 4U6ZA 2OAZA 2GA2A 3IG4A 2B3LA 1B6AA 1R58A 4IKUA 2EVMA 4U6EA 5E5BA 3IU7A 2MATA 2BHDA 2P9AA 2GZ5A 2GG7A 2DFIA 2Q8KA 3PKEA 3RORA 3CB5A 5D6FA 2HOWA 1O0XA 4IKRA 1N51A 4R60A 4FLJA 4S2RP 4A6WA 2V6CA 2GG9A 2NQ6A 4JUQA 2NQ7A 1R5HA 4IF7A 1M35A 4FO7A 1BOAA 2GTXA 2IW2A 3D27A 2BWUA 4FLIA 4ZWPA 5FCHA 3PKBA 4U1BA 1W2MA 1KQ9A 1WLRA 4U71A 1Y1NA 2GGBA 1KP0A 1C22A 1QZYA 2V3XA 1YW7A 4IKSA 4RZYA 1BN5A 1XGSA 1R5GA 2GG3A 3CTZA 3MATA 4U73A 2GG5A 5CLSA 3PKDA 2OKNA 3FMQA 3BITA 4ZWUA 2GG2A 2ZSGA 4FUKA 3TB5A 4PNCA 1WKMA 5CE6A 1B59A 5CDLA 2B3KA 1CHMA 4OOKA 3S6BA 2GU6A 2Q94A 3IU8A 2GGCA 4S00A 5CIKA 2BWWA 2GU7A 3Q6DA 1WBQA 4FKCA 4FO8A 4IKTA 4HXXA 4ZWOA 2Q95A 1WL6A 4ZNGA 3PKCA 5D6EA 5CDVA 2V3YA 5CNXA 2BWXA 4RGZ1 1JAWA 3IU9A 1XGOA 4IPAA 4U6JA 1C23A 4S01A 4RZZA 1QXWA 1C24A 3FMRA 1QXZA 3MR1A 2EA4A 3FM3A 4U75A 2BHCA 5JFRA 1WY2A 3BIQA 4FLLA 4U6WA 2B3HA 4U76A 5CDEA 2GU5A 2Q92A 2BWSA 4KM3A 3RVAA 5JHUA 1W7VA 1A16A 4Z7MA 1WL9A 1YVMA 2BWYA 3CB6A 2GU4A 4B28A 2ADUA 4S2TP 4U6CA 1XGMA 4U70A 1YW8A 4A6VA 2Q96A 3L7GA 2BHBA 3MX6A 4U69A 4QR8A 2BN7A 3PKAA 2G6PA 4IDYA
chains in the Genus database with same CATH topology
1C21A 1PV9A 1YJ3A 2Q93A 1WN1A 4IU6A 2BB7A 1C27A 1XNZA 3BIPA 3L24A 2BWVA 4EGEA 4PV4A 3TAVA 1XGNA 1QXYA 2BH3A 2BWTA 4MATA 2GG0A 2BHAA 5FCFA 1MATA 2P99A 2V3ZA 1YW9A 2P98A 2EA2A 2GG8A 4FLKA 1KQ0A 2EVOA 5JI6A 2EVCA 4IECA 4U6ZA 2OAZA 2GA2A 3IG4A 2B3LA 1B6AA 1R58A 4IKUA 2EVMA 4U6EA 5E5BA 3IU7A 2MATA 2BHDA 2P9AA 2GZ5A 2GG7A 2DFIA 2Q8KA 3PKEA 3RORA 3CB5A 5D6FA 2HOWA 1O0XA 4IKRA 1N51A 4R60A 4FLJA 4S2RP 4A6WA 2V6CA 2GG9A 2NQ6A 4JUQA 2NQ7A 1R5HA 4IF7A 1M35A 4FO7A 1BOAA 2GTXA 2IW2A 3D27A 2BWUA 4FLIA 4ZWPA 5FCHA 3PKBA 4U1BA 1W2MA 1KQ9A 1WLRA 4U71A 1Y1NA 2GGBA 1KP0A 1C22A 1QZYA 2V3XA 1YW7A 4IKSA 4RZYA 1BN5A 1XGSA 1R5GA 2GG3A 3CTZA 3MATA 4U73A 2GG5A 5CLSA 3PKDA 2OKNA 3FMQA 3BITA 4ZWUA 2GG2A 2ZSGA 4FUKA 3TB5A 4PNCA 1WKMA 5CE6A 1B59A 5CDLA 2B3KA 1CHMA 4OOKA 3S6BA 2GU6A 2Q94A 3IU8A 2GGCA 4S00A 5CIKA 2BWWA 2GU7A 3Q6DA 1WBQA 4FKCA 4FO8A 4IKTA 4HXXA 4ZWOA 2Q95A 1WL6A 4ZNGA 3PKCA 5D6EA 5CDVA 2V3YA 5CNXA 2BWXA 4RGZ1 1JAWA 3IU9A 1XGOA 4IPAA 4U6JA 1C23A 4S01A 4RZZA 1QXWA 1C24A 3FMRA 1QXZA 3MR1A 2EA4A 3FM3A 4U75A 2BHCA 5JFRA 1WY2A 3BIQA 4FLLA 4U6WA 2B3HA 4U76A 5CDEA 2GU5A 2Q92A 2BWSA 4KM3A 3RVAA 5JHUA 1W7VA 1A16A 4Z7MA 1WL9A 1YVMA 2BWYA 3CB6A 2GU4A 4B28A 2ADUA 4S2TP 4U6CA 1XGMA 4U70A 1YW8A 4A6VA 2Q96A 3L7GA 2BHBA 3MX6A 4U69A 4QR8A 2BN7A 3PKAA 2G6PA 4IDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C21 A;  1PV9 A;  1YJ3 A;  2Q93 A;  1WN1 A;  4IU6 A;  2BB7 A;  1C27 A;  1XNZ A;  3BIP A;  3L24 A;  2BWV A;  4EGE A;  4PV4 A;  3TAV A;  1XGN A;  1QXY A;  2BH3 A;  2BWT A;  4MAT A;  2GG0 A;  2BHA A;  5FCF A;  1MAT A;  2P99 A;  2V3Z A;  1YW9 A;  2P98 A;  2EA2 A;  2GG8 A;  4FLK A;  1KQ0 A;  2EVO A;  5JI6 A;  2EVC A;  4IEC A;  4U6Z A;  2OAZ A;  2GA2 A;  3IG4 A;  2B3L A;  1B6A A;  1R58 A;  4IKU A;  2EVM A;  4U6E A;  5E5B A;  3IU7 A;  2MAT A;  2BHD A;  2P9A A;  2GZ5 A;  2GG7 A;  2DFI A;  2Q8K A;  3PKE A;  3ROR A;  3CB5 A;  5D6F A;  2HOW A;  1O0X A;  4IKR A;  1N51 A;  4R60 A;  4FLJ A;  4S2R P;  4A6W A;  2V6C A;  2GG9 A;  2NQ6 A;  4JUQ A;  2NQ7 A;  1R5H A;  4IF7 A;  1M35 A;  4FO7 A;  1BOA A;  2GTX A;  2IW2 A;  3D27 A;  2BWU A;  4FLI A;  4ZWP A;  5FCH A;  3PKB A;  4U1B A;  1W2M A;  1KQ9 A;  1WLR A;  4U71 A;  1Y1N A;  2GGB A;  1KP0 A;  1C22 A;  1QZY A;  2V3X A;  1YW7 A;  4IKS A;  4RZY A;  1BN5 A;  1XGS A;  1R5G A;  2GG3 A;  3CTZ A;  3MAT A;  4U73 A;  2GG5 A;  5CLS A;  3PKD A;  2OKN A;  3FMQ A;  3BIT A;  4ZWU A;  2GG2 A;  2ZSG A;  4FUK A;  3TB5 A;  4PNC A;  1WKM A;  5CE6 A;  1B59 A;  5CDL A;  2B3K A;  1CHM A;  4OOK A;  3S6B A;  2GU6 A;  2Q94 A;  3IU8 A;  2GGC A;  4S00 A;  5CIK A;  2BWW A;  2GU7 A;  3Q6D A;  1WBQ A;  4FKC A;  4FO8 A;  4IKT A;  4HXX A;  4ZWO A;  2Q95 A;  1WL6 A;  4ZNG A;  3PKC A;  5D6E A;  5CDV A;  2V3Y A;  5CNX A;  2BWX A;  4RGZ 1;  1JAW A;  3IU9 A;  1XGO A;  4IPA A;  4U6J A;  1C23 A;  4S01 A;  4RZZ A;  1QXW A;  1C24 A;  3FMR A;  1QXZ A;  3MR1 A;  2EA4 A;  3FM3 A;  4U75 A;  2BHC A;  5JFR A;  1WY2 A;  3BIQ A;  4FLL A;  4U6W A;  2B3H A;  4U76 A;  5CDE A;  2GU5 A;  2Q92 A;  2BWS A;  4KM3 A;  3RVA A;  5JHU A;  1W7V A;  1A16 A;  4Z7M A;  1WL9 A;  1YVM A;  2BWY A;  3CB6 A;  2GU4 A;  4B28 A;  2ADU A;  4S2T P;  4U6C A;  1XGM A;  4U70 A;  1YW8 A;  4A6V A;  2Q96 A;  3L7G A;  2BHB A;  3MX6 A;  4U69 A;  4QR8 A;  2BN7 A;  3PKA A;  2G6P A;  4IDY A; 
#chains in the Genus database with same CATH topology
 1C21 A;  1PV9 A;  1YJ3 A;  2Q93 A;  1WN1 A;  4IU6 A;  2BB7 A;  1C27 A;  1XNZ A;  3BIP A;  3L24 A;  2BWV A;  4EGE A;  4PV4 A;  3TAV A;  1XGN A;  1QXY A;  2BH3 A;  2BWT A;  4MAT A;  2GG0 A;  2BHA A;  5FCF A;  1MAT A;  2P99 A;  2V3Z A;  1YW9 A;  2P98 A;  2EA2 A;  2GG8 A;  4FLK A;  1KQ0 A;  2EVO A;  5JI6 A;  2EVC A;  4IEC A;  4U6Z A;  2OAZ A;  2GA2 A;  3IG4 A;  2B3L A;  1B6A A;  1R58 A;  4IKU A;  2EVM A;  4U6E A;  5E5B A;  3IU7 A;  2MAT A;  2BHD A;  2P9A A;  2GZ5 A;  2GG7 A;  2DFI A;  2Q8K A;  3PKE A;  3ROR A;  3CB5 A;  5D6F A;  2HOW A;  1O0X A;  4IKR A;  1N51 A;  4R60 A;  4FLJ A;  4S2R P;  4A6W A;  2V6C A;  2GG9 A;  2NQ6 A;  4JUQ A;  2NQ7 A;  1R5H A;  4IF7 A;  1M35 A;  4FO7 A;  1BOA A;  2GTX A;  2IW2 A;  3D27 A;  2BWU A;  4FLI A;  4ZWP A;  5FCH A;  3PKB A;  4U1B A;  1W2M A;  1KQ9 A;  1WLR A;  4U71 A;  1Y1N A;  2GGB A;  1KP0 A;  1C22 A;  1QZY A;  2V3X A;  1YW7 A;  4IKS A;  4RZY A;  1BN5 A;  1XGS A;  1R5G A;  2GG3 A;  3CTZ A;  3MAT A;  4U73 A;  2GG5 A;  5CLS A;  3PKD A;  2OKN A;  3FMQ A;  3BIT A;  4ZWU A;  2GG2 A;  2ZSG A;  4FUK A;  3TB5 A;  4PNC A;  1WKM A;  5CE6 A;  1B59 A;  5CDL A;  2B3K A;  1CHM A;  4OOK A;  3S6B A;  2GU6 A;  2Q94 A;  3IU8 A;  2GGC A;  4S00 A;  5CIK A;  2BWW A;  2GU7 A;  3Q6D A;  1WBQ A;  4FKC A;  4FO8 A;  4IKT A;  4HXX A;  4ZWO A;  2Q95 A;  1WL6 A;  4ZNG A;  3PKC A;  5D6E A;  5CDV A;  2V3Y A;  5CNX A;  2BWX A;  4RGZ 1;  1JAW A;  3IU9 A;  1XGO A;  4IPA A;  4U6J A;  1C23 A;  4S01 A;  4RZZ A;  1QXW A;  1C24 A;  3FMR A;  1QXZ A;  3MR1 A;  2EA4 A;  3FM3 A;  4U75 A;  2BHC A;  5JFR A;  1WY2 A;  3BIQ A;  4FLL A;  4U6W A;  2B3H A;  4U76 A;  5CDE A;  2GU5 A;  2Q92 A;  2BWS A;  4KM3 A;  3RVA A;  5JHU A;  1W7V A;  1A16 A;  4Z7M A;  1WL9 A;  1YVM A;  2BWY A;  3CB6 A;  2GU4 A;  4B28 A;  2ADU A;  4S2T P;  4U6C A;  1XGM A;  4U70 A;  1YW8 A;  4A6V A;  2Q96 A;  3L7G A;  2BHB A;  3MX6 A;  4U69 A;  4QR8 A;  2BN7 A;  3PKA A;  2G6P A;  4IDY A; 
#chains in the Genus database with same CATH homology
 1C21 A;  1PV9 A;  1YJ3 A;  2Q93 A;  1WN1 A;  4IU6 A;  2BB7 A;  1C27 A;  1XNZ A;  3BIP A;  3L24 A;  2BWV A;  4EGE A;  4PV4 A;  3TAV A;  1XGN A;  1QXY A;  2BH3 A;  2BWT A;  4MAT A;  2GG0 A;  2BHA A;  5FCF A;  1MAT A;  2P99 A;  2V3Z A;  1YW9 A;  2P98 A;  2EA2 A;  2GG8 A;  4FLK A;  1KQ0 A;  2EVO A;  5JI6 A;  2EVC A;  4IEC A;  4U6Z A;  2OAZ A;  2GA2 A;  3IG4 A;  2B3L A;  1B6A A;  1R58 A;  4IKU A;  2EVM A;  4U6E A;  5E5B A;  3IU7 A;  2MAT A;  2BHD A;  2P9A A;  2GZ5 A;  2GG7 A;  2DFI A;  2Q8K A;  3PKE A;  3ROR A;  3CB5 A;  5D6F A;  2HOW A;  1O0X A;  4IKR A;  1N51 A;  4R60 A;  4FLJ A;  4S2R P;  4A6W A;  2V6C A;  2GG9 A;  2NQ6 A;  4JUQ A;  2NQ7 A;  1R5H A;  4IF7 A;  1M35 A;  4FO7 A;  1BOA A;  2GTX A;  2IW2 A;  3D27 A;  2BWU A;  4FLI A;  4ZWP A;  5FCH A;  3PKB A;  4U1B A;  1W2M A;  1KQ9 A;  1WLR A;  4U71 A;  1Y1N A;  2GGB A;  1KP0 A;  1C22 A;  1QZY A;  2V3X A;  1YW7 A;  4IKS A;  4RZY A;  1BN5 A;  1XGS A;  1R5G A;  2GG3 A;  3CTZ A;  3MAT A;  4U73 A;  2GG5 A;  5CLS A;  3PKD A;  2OKN A;  3FMQ A;  3BIT A;  4ZWU A;  2GG2 A;  2ZSG A;  4FUK A;  3TB5 A;  4PNC A;  1WKM A;  5CE6 A;  1B59 A;  5CDL A;  2B3K A;  1CHM A;  4OOK A;  3S6B A;  2GU6 A;  2Q94 A;  3IU8 A;  2GGC A;  4S00 A;  5CIK A;  2BWW A;  2GU7 A;  3Q6D A;  1WBQ A;  4FKC A;  4FO8 A;  4IKT A;  4HXX A;  4ZWO A;  2Q95 A;  1WL6 A;  4ZNG A;  3PKC A;  5D6E A;  5CDV A;  2V3Y A;  5CNX A;  2BWX A;  4RGZ 1;  1JAW A;  3IU9 A;  1XGO A;  4IPA A;  4U6J A;  1C23 A;  4S01 A;  4RZZ A;  1QXW A;  1C24 A;  3FMR A;  1QXZ A;  3MR1 A;  2EA4 A;  3FM3 A;  4U75 A;  2BHC A;  5JFR A;  1WY2 A;  3BIQ A;  4FLL A;  4U6W A;  2B3H A;  4U76 A;  5CDE A;  2GU5 A;  2Q92 A;  2BWS A;  4KM3 A;  3RVA A;  5JHU A;  1W7V A;  1A16 A;  4Z7M A;  1WL9 A;  1YVM A;  2BWY A;  3CB6 A;  2GU4 A;  4B28 A;  2ADU A;  4S2T P;  4U6C A;  1XGM A;  4U70 A;  1YW8 A;  4A6V A;  2Q96 A;  3L7G A;  2BHB A;  3MX6 A;  4U69 A;  4QR8 A;  2BN7 A;  3PKA A;  2G6P A;  4IDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...