4U6EA

Hsmetap in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6eA00
1KQ0A 1W7VA 4ZNGA 3BIPA 3RVAA 2V3XA 1QXWA 3CB6A 1O0XA 2DFIA 4U73A 5JFRA 2BHCA 3FM3A 3IU8A 2BWXA 3FMQA 1R58A 1R5HA 2BWWA 2EA4A 4U75A 1A16A 2P98A 3L7GA 3Q6DA 4OOKA 3RORA 1XGMA 4ZWUA 2Q95A 2P9AA 4HXXA 1Y1NA 2NQ7A 4ZWOA 2B3LA 2ZSGA 1PV9A 4IKSA 2GGCA 4S2RP 4B28A 4MATA 2BWTA 3PKEA 2GU6A 4FLLA 4U6WA 3TB5A 2Q94A 1WL9A 2BHBA 2GU4A 2EA2A 1QXZA 2BHDA 3L24A 2GG5A 1W2MA 4IF7A 4IKTA 1XGNA 2GG7A 2V6CA 4FUKA 3PKBA 4IKUA 1C27A 2GA2A 3S6BA 3IG4A 4U6ZA 3BITA 2GG8A 2V3ZA 1MATA 2BWSA 2P99A 3PKAA 2Q8KA 4U6CA 5CDLA 2G6PA 1YJ3A 2GU7A 1B59A 1YVMA 5CE6A 1WN1A 4FO7A 1XNZA 5CDVA 4RZZA 4FLKA 5JHUA 2MATA 4FLJA 5CLSA 2BH3A 2GGBA 1JAWA 2GZ5A 3CTZA 3MATA 2BWUA 1KQ9A 4U70A 2ADUA 4S01A 1WL6A 2OAZA 3BIQA 3D27A 4RZYA 5CNXA 4FLIA 5CDEA 3TAVA 4A6WA 4IU6A 2EVOA 1M35A 5D6FA 3CB5A 1C24A 1WY2A 4PNCA 2GG0A 4S00A 4IECA 3PKDA 2GG3A 2HOWA 2Q96A 3IU7A 1YW9A 4JUQA 2EVMA 4IPAA 2V3YA 2GTXA 4U71A 5E5BA 2GG2A 4IDYA 2IW2A 4U76A 2GG9A 2OKNA 3IU9A 1XGSA 4KM3A 2BN7A 4QR8A 2NQ6A 4S2TP 4FKCA 1CHMA 1B6AA 2B3KA 2Q93A 3PKCA 5D6EA 2BHAA 1KP0A 4U6JA 3FMRA 1R5GA 1YW7A 3MR1A 4U1BA 1WKMA 4Z7MA 1BOAA 1C23A 4R60A 1WBQA 2BWYA 4PV4A 1YW8A 4U6EA 5JI6A 4RGZ1 5CIKA 2BB7A 4U69A 5FCHA 1WLRA 4IKRA 4A6VA 1C22A 1XGOA 2B3HA 2EVCA 1C21A 2GU5A 1QZYA 4FO8A 4EGEA 3MX6A 2Q92A 1N51A 5FCFA 1BN5A 2BWVA 1QXYA 4ZWPA
chains in the Genus database with same CATH superfamily
1KQ0A 1W7VA 4ZNGA 3BIPA 3RVAA 2V3XA 1QXWA 3CB6A 1O0XA 2DFIA 4U73A 5JFRA 2BHCA 3FM3A 3IU8A 2BWXA 3FMQA 1R58A 1R5HA 2BWWA 2EA4A 4U75A 1A16A 2P98A 3L7GA 3Q6DA 4OOKA 3RORA 1XGMA 4ZWUA 2Q95A 2P9AA 4HXXA 1Y1NA 2NQ7A 4ZWOA 2B3LA 2ZSGA 1PV9A 4IKSA 2GGCA 4S2RP 4B28A 4MATA 2BWTA 3PKEA 2GU6A 4FLLA 4U6WA 3TB5A 2Q94A 1WL9A 2BHBA 2GU4A 2EA2A 1QXZA 2BHDA 3L24A 2GG5A 1W2MA 4IF7A 4IKTA 1XGNA 2GG7A 2V6CA 4FUKA 3PKBA 4IKUA 1C27A 2GA2A 3S6BA 3IG4A 4U6ZA 3BITA 2GG8A 2V3ZA 1MATA 2BWSA 2P99A 3PKAA 2Q8KA 4U6CA 5CDLA 2G6PA 1YJ3A 2GU7A 1B59A 1YVMA 5CE6A 1WN1A 4FO7A 1XNZA 5CDVA 4RZZA 4FLKA 5JHUA 2MATA 4FLJA 5CLSA 2BH3A 2GGBA 1JAWA 2GZ5A 3CTZA 3MATA 2BWUA 1KQ9A 4U70A 2ADUA 4S01A 1WL6A 2OAZA 3BIQA 3D27A 4RZYA 5CNXA 4FLIA 5CDEA 3TAVA 4A6WA 4IU6A 2EVOA 1M35A 5D6FA 3CB5A 1C24A 1WY2A 4PNCA 2GG0A 4S00A 4IECA 3PKDA 2GG3A 2HOWA 2Q96A 3IU7A 1YW9A 4JUQA 2EVMA 4IPAA 2V3YA 2GTXA 4U71A 5E5BA 2GG2A 4IDYA 2IW2A 4U76A 2GG9A 2OKNA 3IU9A 1XGSA 4KM3A 2BN7A 4QR8A 2NQ6A 4S2TP 4FKCA 1CHMA 1B6AA 2B3KA 2Q93A 3PKCA 5D6EA 2BHAA 1KP0A 4U6JA 3FMRA 1R5GA 1YW7A 3MR1A 4U1BA 1WKMA 4Z7MA 1BOAA 1C23A 4R60A 1WBQA 2BWYA 4PV4A 1YW8A 4U6EA 5JI6A 4RGZ1 5CIKA 2BB7A 4U69A 5FCHA 1WLRA 4IKRA 4A6VA 1C22A 1XGOA 2B3HA 2EVCA 1C21A 2GU5A 1QZYA 4FO8A 4EGEA 3MX6A 2Q92A 1N51A 5FCFA 1BN5A 2BWVA 1QXYA 4ZWPA
chains in the Genus database with same CATH topology
1KQ0A 1W7VA 4ZNGA 3BIPA 3RVAA 2V3XA 1QXWA 3CB6A 1O0XA 2DFIA 4U73A 5JFRA 2BHCA 3FM3A 3IU8A 2BWXA 3FMQA 1R58A 1R5HA 2BWWA 2EA4A 4U75A 1A16A 2P98A 3L7GA 3Q6DA 4OOKA 3RORA 1XGMA 4ZWUA 2Q95A 2P9AA 4HXXA 1Y1NA 2NQ7A 4ZWOA 2B3LA 2ZSGA 1PV9A 4IKSA 2GGCA 4S2RP 4B28A 4MATA 2BWTA 3PKEA 2GU6A 4FLLA 4U6WA 3TB5A 2Q94A 1WL9A 2BHBA 2GU4A 2EA2A 1QXZA 2BHDA 3L24A 2GG5A 1W2MA 4IF7A 4IKTA 1XGNA 2GG7A 2V6CA 4FUKA 3PKBA 4IKUA 1C27A 2GA2A 3S6BA 3IG4A 4U6ZA 3BITA 2GG8A 2V3ZA 1MATA 2BWSA 2P99A 3PKAA 2Q8KA 4U6CA 5CDLA 2G6PA 1YJ3A 2GU7A 1B59A 1YVMA 5CE6A 1WN1A 4FO7A 1XNZA 5CDVA 4RZZA 4FLKA 5JHUA 2MATA 4FLJA 5CLSA 2BH3A 2GGBA 1JAWA 2GZ5A 3CTZA 3MATA 2BWUA 1KQ9A 4U70A 2ADUA 4S01A 1WL6A 2OAZA 3BIQA 3D27A 4RZYA 5CNXA 4FLIA 5CDEA 3TAVA 4A6WA 4IU6A 2EVOA 1M35A 5D6FA 3CB5A 1C24A 1WY2A 4PNCA 2GG0A 4S00A 4IECA 3PKDA 2GG3A 2HOWA 2Q96A 3IU7A 1YW9A 4JUQA 2EVMA 4IPAA 2V3YA 2GTXA 4U71A 5E5BA 2GG2A 4IDYA 2IW2A 4U76A 2GG9A 2OKNA 3IU9A 1XGSA 4KM3A 2BN7A 4QR8A 2NQ6A 4S2TP 4FKCA 1CHMA 1B6AA 2B3KA 2Q93A 3PKCA 5D6EA 2BHAA 1KP0A 4U6JA 3FMRA 1R5GA 1YW7A 3MR1A 4U1BA 1WKMA 4Z7MA 1BOAA 1C23A 4R60A 1WBQA 2BWYA 4PV4A 1YW8A 4U6EA 5JI6A 4RGZ1 5CIKA 2BB7A 4U69A 5FCHA 1WLRA 4IKRA 4A6VA 1C22A 1XGOA 2B3HA 2EVCA 1C21A 2GU5A 1QZYA 4FO8A 4EGEA 3MX6A 2Q92A 1N51A 5FCFA 1BN5A 2BWVA 1QXYA 4ZWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ0 A;  1W7V A;  4ZNG A;  3BIP A;  3RVA A;  2V3X A;  1QXW A;  3CB6 A;  1O0X A;  2DFI A;  4U73 A;  5JFR A;  2BHC A;  3FM3 A;  3IU8 A;  2BWX A;  3FMQ A;  1R58 A;  1R5H A;  2BWW A;  2EA4 A;  4U75 A;  1A16 A;  2P98 A;  3L7G A;  3Q6D A;  4OOK A;  3ROR A;  1XGM A;  4ZWU A;  2Q95 A;  2P9A A;  4HXX A;  1Y1N A;  2NQ7 A;  4ZWO A;  2B3L A;  2ZSG A;  1PV9 A;  4IKS A;  2GGC A;  4S2R P;  4B28 A;  4MAT A;  2BWT A;  3PKE A;  2GU6 A;  4FLL A;  4U6W A;  3TB5 A;  2Q94 A;  1WL9 A;  2BHB A;  2GU4 A;  2EA2 A;  1QXZ A;  2BHD A;  3L24 A;  2GG5 A;  1W2M A;  4IF7 A;  4IKT A;  1XGN A;  2GG7 A;  2V6C A;  4FUK A;  3PKB A;  4IKU A;  1C27 A;  2GA2 A;  3S6B A;  3IG4 A;  4U6Z A;  3BIT A;  2GG8 A;  2V3Z A;  1MAT A;  2BWS A;  2P99 A;  3PKA A;  2Q8K A;  4U6C A;  5CDL A;  2G6P A;  1YJ3 A;  2GU7 A;  1B59 A;  1YVM A;  5CE6 A;  1WN1 A;  4FO7 A;  1XNZ A;  5CDV A;  4RZZ A;  4FLK A;  5JHU A;  2MAT A;  4FLJ A;  5CLS A;  2BH3 A;  2GGB A;  1JAW A;  2GZ5 A;  3CTZ A;  3MAT A;  2BWU A;  1KQ9 A;  4U70 A;  2ADU A;  4S01 A;  1WL6 A;  2OAZ A;  3BIQ A;  3D27 A;  4RZY A;  5CNX A;  4FLI A;  5CDE A;  3TAV A;  4A6W A;  4IU6 A;  2EVO A;  1M35 A;  5D6F A;  3CB5 A;  1C24 A;  1WY2 A;  4PNC A;  2GG0 A;  4S00 A;  4IEC A;  3PKD A;  2GG3 A;  2HOW A;  2Q96 A;  3IU7 A;  1YW9 A;  4JUQ A;  2EVM A;  4IPA A;  2V3Y A;  2GTX A;  4U71 A;  5E5B A;  2GG2 A;  4IDY A;  2IW2 A;  4U76 A;  2GG9 A;  2OKN A;  3IU9 A;  1XGS A;  4KM3 A;  2BN7 A;  4QR8 A;  2NQ6 A;  4S2T P;  4FKC A;  1CHM A;  1B6A A;  2B3K A;  2Q93 A;  3PKC A;  5D6E A;  2BHA A;  1KP0 A;  4U6J A;  3FMR A;  1R5G A;  1YW7 A;  3MR1 A;  4U1B A;  1WKM A;  4Z7M A;  1BOA A;  1C23 A;  4R60 A;  1WBQ A;  2BWY A;  4PV4 A;  1YW8 A;  4U6E A;  5JI6 A;  4RGZ 1;  5CIK A;  2BB7 A;  4U69 A;  5FCH A;  1WLR A;  4IKR A;  4A6V A;  1C22 A;  1XGO A;  2B3H A;  2EVC A;  1C21 A;  2GU5 A;  1QZY A;  4FO8 A;  4EGE A;  3MX6 A;  2Q92 A;  1N51 A;  5FCF A;  1BN5 A;  2BWV A;  1QXY A;  4ZWP A; 
#chains in the Genus database with same CATH topology
 1KQ0 A;  1W7V A;  4ZNG A;  3BIP A;  3RVA A;  2V3X A;  1QXW A;  3CB6 A;  1O0X A;  2DFI A;  4U73 A;  5JFR A;  2BHC A;  3FM3 A;  3IU8 A;  2BWX A;  3FMQ A;  1R58 A;  1R5H A;  2BWW A;  2EA4 A;  4U75 A;  1A16 A;  2P98 A;  3L7G A;  3Q6D A;  4OOK A;  3ROR A;  1XGM A;  4ZWU A;  2Q95 A;  2P9A A;  4HXX A;  1Y1N A;  2NQ7 A;  4ZWO A;  2B3L A;  2ZSG A;  1PV9 A;  4IKS A;  2GGC A;  4S2R P;  4B28 A;  4MAT A;  2BWT A;  3PKE A;  2GU6 A;  4FLL A;  4U6W A;  3TB5 A;  2Q94 A;  1WL9 A;  2BHB A;  2GU4 A;  2EA2 A;  1QXZ A;  2BHD A;  3L24 A;  2GG5 A;  1W2M A;  4IF7 A;  4IKT A;  1XGN A;  2GG7 A;  2V6C A;  4FUK A;  3PKB A;  4IKU A;  1C27 A;  2GA2 A;  3S6B A;  3IG4 A;  4U6Z A;  3BIT A;  2GG8 A;  2V3Z A;  1MAT A;  2BWS A;  2P99 A;  3PKA A;  2Q8K A;  4U6C A;  5CDL A;  2G6P A;  1YJ3 A;  2GU7 A;  1B59 A;  1YVM A;  5CE6 A;  1WN1 A;  4FO7 A;  1XNZ A;  5CDV A;  4RZZ A;  4FLK A;  5JHU A;  2MAT A;  4FLJ A;  5CLS A;  2BH3 A;  2GGB A;  1JAW A;  2GZ5 A;  3CTZ A;  3MAT A;  2BWU A;  1KQ9 A;  4U70 A;  2ADU A;  4S01 A;  1WL6 A;  2OAZ A;  3BIQ A;  3D27 A;  4RZY A;  5CNX A;  4FLI A;  5CDE A;  3TAV A;  4A6W A;  4IU6 A;  2EVO A;  1M35 A;  5D6F A;  3CB5 A;  1C24 A;  1WY2 A;  4PNC A;  2GG0 A;  4S00 A;  4IEC A;  3PKD A;  2GG3 A;  2HOW A;  2Q96 A;  3IU7 A;  1YW9 A;  4JUQ A;  2EVM A;  4IPA A;  2V3Y A;  2GTX A;  4U71 A;  5E5B A;  2GG2 A;  4IDY A;  2IW2 A;  4U76 A;  2GG9 A;  2OKN A;  3IU9 A;  1XGS A;  4KM3 A;  2BN7 A;  4QR8 A;  2NQ6 A;  4S2T P;  4FKC A;  1CHM A;  1B6A A;  2B3K A;  2Q93 A;  3PKC A;  5D6E A;  2BHA A;  1KP0 A;  4U6J A;  3FMR A;  1R5G A;  1YW7 A;  3MR1 A;  4U1B A;  1WKM A;  4Z7M A;  1BOA A;  1C23 A;  4R60 A;  1WBQ A;  2BWY A;  4PV4 A;  1YW8 A;  4U6E A;  5JI6 A;  4RGZ 1;  5CIK A;  2BB7 A;  4U69 A;  5FCH A;  1WLR A;  4IKR A;  4A6V A;  1C22 A;  1XGO A;  2B3H A;  2EVC A;  1C21 A;  2GU5 A;  1QZY A;  4FO8 A;  4EGE A;  3MX6 A;  2Q92 A;  1N51 A;  5FCF A;  1BN5 A;  2BWV A;  1QXY A;  4ZWP A; 
#chains in the Genus database with same CATH homology
 1KQ0 A;  1W7V A;  4ZNG A;  3BIP A;  3RVA A;  2V3X A;  1QXW A;  3CB6 A;  1O0X A;  2DFI A;  4U73 A;  5JFR A;  2BHC A;  3FM3 A;  3IU8 A;  2BWX A;  3FMQ A;  1R58 A;  1R5H A;  2BWW A;  2EA4 A;  4U75 A;  1A16 A;  2P98 A;  3L7G A;  3Q6D A;  4OOK A;  3ROR A;  1XGM A;  4ZWU A;  2Q95 A;  2P9A A;  4HXX A;  1Y1N A;  2NQ7 A;  4ZWO A;  2B3L A;  2ZSG A;  1PV9 A;  4IKS A;  2GGC A;  4S2R P;  4B28 A;  4MAT A;  2BWT A;  3PKE A;  2GU6 A;  4FLL A;  4U6W A;  3TB5 A;  2Q94 A;  1WL9 A;  2BHB A;  2GU4 A;  2EA2 A;  1QXZ A;  2BHD A;  3L24 A;  2GG5 A;  1W2M A;  4IF7 A;  4IKT A;  1XGN A;  2GG7 A;  2V6C A;  4FUK A;  3PKB A;  4IKU A;  1C27 A;  2GA2 A;  3S6B A;  3IG4 A;  4U6Z A;  3BIT A;  2GG8 A;  2V3Z A;  1MAT A;  2BWS A;  2P99 A;  3PKA A;  2Q8K A;  4U6C A;  5CDL A;  2G6P A;  1YJ3 A;  2GU7 A;  1B59 A;  1YVM A;  5CE6 A;  1WN1 A;  4FO7 A;  1XNZ A;  5CDV A;  4RZZ A;  4FLK A;  5JHU A;  2MAT A;  4FLJ A;  5CLS A;  2BH3 A;  2GGB A;  1JAW A;  2GZ5 A;  3CTZ A;  3MAT A;  2BWU A;  1KQ9 A;  4U70 A;  2ADU A;  4S01 A;  1WL6 A;  2OAZ A;  3BIQ A;  3D27 A;  4RZY A;  5CNX A;  4FLI A;  5CDE A;  3TAV A;  4A6W A;  4IU6 A;  2EVO A;  1M35 A;  5D6F A;  3CB5 A;  1C24 A;  1WY2 A;  4PNC A;  2GG0 A;  4S00 A;  4IEC A;  3PKD A;  2GG3 A;  2HOW A;  2Q96 A;  3IU7 A;  1YW9 A;  4JUQ A;  2EVM A;  4IPA A;  2V3Y A;  2GTX A;  4U71 A;  5E5B A;  2GG2 A;  4IDY A;  2IW2 A;  4U76 A;  2GG9 A;  2OKN A;  3IU9 A;  1XGS A;  4KM3 A;  2BN7 A;  4QR8 A;  2NQ6 A;  4S2T P;  4FKC A;  1CHM A;  1B6A A;  2B3K A;  2Q93 A;  3PKC A;  5D6E A;  2BHA A;  1KP0 A;  4U6J A;  3FMR A;  1R5G A;  1YW7 A;  3MR1 A;  4U1B A;  1WKM A;  4Z7M A;  1BOA A;  1C23 A;  4R60 A;  1WBQ A;  2BWY A;  4PV4 A;  1YW8 A;  4U6E A;  5JI6 A;  4RGZ 1;  5CIK A;  2BB7 A;  4U69 A;  5FCH A;  1WLR A;  4IKR A;  4A6V A;  1C22 A;  1XGO A;  2B3H A;  2EVC A;  1C21 A;  2GU5 A;  1QZY A;  4FO8 A;  4EGE A;  3MX6 A;  2Q92 A;  1N51 A;  5FCF A;  1BN5 A;  2BWV A;  1QXY A;  4ZWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...