4U6EA

Hsmetap in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6eA00
3PKAA 3L7GA 4PNCA 4JUQA 2Q92A 3IU7A 2P99A 1YJ3A 1XGMA 4U70A 1KP0A 1MATA 2B3KA 3MX6A 4IF7A 2GG7A 2ADUA 2BHCA 4FO8A 5D6FA 4ZNGA 5JI6A 2GGBA 1KQ0A 5CLSA 2BWUA 3BIQA 2V3XA 3MR1A 1XGSA 4HXXA 2GU6A 1XNZA 1WY2A 3IU8A 1C21A 4S2TP 4RGZ1 3CB6A 2Q96A 3BITA 5JFRA 1PV9A 2GU7A 4FLLA 5CDLA 1N51A 4KM3A 4IKSA 2EVOA 4U6ZA 4RZZA 5FCFA 3RORA 3BIPA 3RVAA 3TAVA 4U6WA 4FKCA 2GGCA 2BHBA 4R60A 1QZYA 4U73A 2NQ6A 5CE6A 2BH3A 1W7VA 2GU5A 2GG3A 1WLRA 4U1BA 5JHUA 2Q95A 4IU6A 4MATA 2P9AA 5CDVA 2IW2A 2GG9A 2B3LA 2G6PA 1A16A 2GG0A 4U6JA 4ZWOA 1JAWA 4U71A 1C23A 3PKBA 4FLKA 4IPAA 3TB5A 2EA4A 2DFIA 2BHDA 2P98A 1WBQA 5CNXA 5D6EA 3MATA 4Z7MA 3S6BA 1O0XA 1M35A 1Y1NA 2BWSA 1QXZA 2V3YA 2BWVA 2Q94A 1XGNA 4RZYA 3FMRA 2EA2A 2GU4A 2GG2A 4IDYA 4A6WA 1CHMA 5CIKA 4IKTA 4QR8A 2GG5A 4FLIA 2GTXA 3CTZA 4PV4A 2Q8KA 4ZWPA 2OKNA 1W2MA 4S01A 3CB5A 1B6AA 1YW9A 2GG8A 1R5GA 2BWTA 3IU9A 2B3HA 4FUKA 4IKUA 4ZWUA 1WN1A 1YVMA 3PKDA 3PKEA 2V6CA 2GZ5A 2OAZA 4IECA 1B59A 2BN7A 1XGOA 1KQ9A 4U69A 1YW8A 2GA2A 5CDEA 4FLJA 4U75A 4EGEA 5FCHA 2BHAA 4U76A 2BB7A 2BWYA 3L24A 5E5BA 4U6EA 1R5HA 1WKMA 1C24A 2HOWA 1C27A 4FO7A 4IKRA 3Q6DA 1R58A 4OOKA 4S00A 4B28A 4U6CA 1QXWA 3D27A 2BWXA 1C22A 1WL6A 2EVMA 2ZSGA 1QXYA 2BWWA 3FM3A 1BOAA 3FMQA 3IG4A 4A6VA 3PKCA 2Q93A 2NQ7A 4S2RP 1BN5A 2EVCA 2MATA 1WL9A 2V3ZA 1YW7A
chains in the Genus database with same CATH superfamily
3PKAA 3L7GA 4PNCA 4JUQA 2Q92A 3IU7A 2P99A 1YJ3A 1XGMA 4U70A 1KP0A 1MATA 2B3KA 3MX6A 4IF7A 2GG7A 2ADUA 2BHCA 4FO8A 5D6FA 4ZNGA 5JI6A 2GGBA 1KQ0A 5CLSA 2BWUA 3BIQA 2V3XA 3MR1A 1XGSA 4HXXA 2GU6A 1XNZA 1WY2A 3IU8A 1C21A 4S2TP 4RGZ1 3CB6A 2Q96A 3BITA 5JFRA 1PV9A 2GU7A 4FLLA 5CDLA 1N51A 4KM3A 4IKSA 2EVOA 4U6ZA 4RZZA 5FCFA 3RORA 3BIPA 3RVAA 3TAVA 4U6WA 4FKCA 2GGCA 2BHBA 4R60A 1QZYA 4U73A 2NQ6A 5CE6A 2BH3A 1W7VA 2GU5A 2GG3A 1WLRA 4U1BA 5JHUA 2Q95A 4IU6A 4MATA 2P9AA 5CDVA 2IW2A 2GG9A 2B3LA 2G6PA 1A16A 2GG0A 4U6JA 4ZWOA 1JAWA 4U71A 1C23A 3PKBA 4FLKA 4IPAA 3TB5A 2EA4A 2DFIA 2BHDA 2P98A 1WBQA 5CNXA 5D6EA 3MATA 4Z7MA 3S6BA 1O0XA 1M35A 1Y1NA 2BWSA 1QXZA 2V3YA 2BWVA 2Q94A 1XGNA 4RZYA 3FMRA 2EA2A 2GU4A 2GG2A 4IDYA 4A6WA 1CHMA 5CIKA 4IKTA 4QR8A 2GG5A 4FLIA 2GTXA 3CTZA 4PV4A 2Q8KA 4ZWPA 2OKNA 1W2MA 4S01A 3CB5A 1B6AA 1YW9A 2GG8A 1R5GA 2BWTA 3IU9A 2B3HA 4FUKA 4IKUA 4ZWUA 1WN1A 1YVMA 3PKDA 3PKEA 2V6CA 2GZ5A 2OAZA 4IECA 1B59A 2BN7A 1XGOA 1KQ9A 4U69A 1YW8A 2GA2A 5CDEA 4FLJA 4U75A 4EGEA 5FCHA 2BHAA 4U76A 2BB7A 2BWYA 3L24A 5E5BA 4U6EA 1R5HA 1WKMA 1C24A 2HOWA 1C27A 4FO7A 4IKRA 3Q6DA 1R58A 4OOKA 4S00A 4B28A 4U6CA 1QXWA 3D27A 2BWXA 1C22A 1WL6A 2EVMA 2ZSGA 1QXYA 2BWWA 3FM3A 1BOAA 3FMQA 3IG4A 4A6VA 3PKCA 2Q93A 2NQ7A 4S2RP 1BN5A 2EVCA 2MATA 1WL9A 2V3ZA 1YW7A
chains in the Genus database with same CATH topology
3PKAA 3L7GA 4PNCA 4JUQA 2Q92A 3IU7A 2P99A 1YJ3A 1XGMA 4U70A 1KP0A 1MATA 2B3KA 3MX6A 4IF7A 2GG7A 2ADUA 2BHCA 4FO8A 5D6FA 4ZNGA 5JI6A 2GGBA 1KQ0A 5CLSA 2BWUA 3BIQA 2V3XA 3MR1A 1XGSA 4HXXA 2GU6A 1XNZA 1WY2A 3IU8A 1C21A 4S2TP 4RGZ1 3CB6A 2Q96A 3BITA 5JFRA 1PV9A 2GU7A 4FLLA 5CDLA 1N51A 4KM3A 4IKSA 2EVOA 4U6ZA 4RZZA 5FCFA 3RORA 3BIPA 3RVAA 3TAVA 4U6WA 4FKCA 2GGCA 2BHBA 4R60A 1QZYA 4U73A 2NQ6A 5CE6A 2BH3A 1W7VA 2GU5A 2GG3A 1WLRA 4U1BA 5JHUA 2Q95A 4IU6A 4MATA 2P9AA 5CDVA 2IW2A 2GG9A 2B3LA 2G6PA 1A16A 2GG0A 4U6JA 4ZWOA 1JAWA 4U71A 1C23A 3PKBA 4FLKA 4IPAA 3TB5A 2EA4A 2DFIA 2BHDA 2P98A 1WBQA 5CNXA 5D6EA 3MATA 4Z7MA 3S6BA 1O0XA 1M35A 1Y1NA 2BWSA 1QXZA 2V3YA 2BWVA 2Q94A 1XGNA 4RZYA 3FMRA 2EA2A 2GU4A 2GG2A 4IDYA 4A6WA 1CHMA 5CIKA 4IKTA 4QR8A 2GG5A 4FLIA 2GTXA 3CTZA 4PV4A 2Q8KA 4ZWPA 2OKNA 1W2MA 4S01A 3CB5A 1B6AA 1YW9A 2GG8A 1R5GA 2BWTA 3IU9A 2B3HA 4FUKA 4IKUA 4ZWUA 1WN1A 1YVMA 3PKDA 3PKEA 2V6CA 2GZ5A 2OAZA 4IECA 1B59A 2BN7A 1XGOA 1KQ9A 4U69A 1YW8A 2GA2A 5CDEA 4FLJA 4U75A 4EGEA 5FCHA 2BHAA 4U76A 2BB7A 2BWYA 3L24A 5E5BA 4U6EA 1R5HA 1WKMA 1C24A 2HOWA 1C27A 4FO7A 4IKRA 3Q6DA 1R58A 4OOKA 4S00A 4B28A 4U6CA 1QXWA 3D27A 2BWXA 1C22A 1WL6A 2EVMA 2ZSGA 1QXYA 2BWWA 3FM3A 1BOAA 3FMQA 3IG4A 4A6VA 3PKCA 2Q93A 2NQ7A 4S2RP 1BN5A 2EVCA 2MATA 1WL9A 2V3ZA 1YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PKA A;  3L7G A;  4PNC A;  4JUQ A;  2Q92 A;  3IU7 A;  2P99 A;  1YJ3 A;  1XGM A;  4U70 A;  1KP0 A;  1MAT A;  2B3K A;  3MX6 A;  4IF7 A;  2GG7 A;  2ADU A;  2BHC A;  4FO8 A;  5D6F A;  4ZNG A;  5JI6 A;  2GGB A;  1KQ0 A;  5CLS A;  2BWU A;  3BIQ A;  2V3X A;  3MR1 A;  1XGS A;  4HXX A;  2GU6 A;  1XNZ A;  1WY2 A;  3IU8 A;  1C21 A;  4S2T P;  4RGZ 1;  3CB6 A;  2Q96 A;  3BIT A;  5JFR A;  1PV9 A;  2GU7 A;  4FLL A;  5CDL A;  1N51 A;  4KM3 A;  4IKS A;  2EVO A;  4U6Z A;  4RZZ A;  5FCF A;  3ROR A;  3BIP A;  3RVA A;  3TAV A;  4U6W A;  4FKC A;  2GGC A;  2BHB A;  4R60 A;  1QZY A;  4U73 A;  2NQ6 A;  5CE6 A;  2BH3 A;  1W7V A;  2GU5 A;  2GG3 A;  1WLR A;  4U1B A;  5JHU A;  2Q95 A;  4IU6 A;  4MAT A;  2P9A A;  5CDV A;  2IW2 A;  2GG9 A;  2B3L A;  2G6P A;  1A16 A;  2GG0 A;  4U6J A;  4ZWO A;  1JAW A;  4U71 A;  1C23 A;  3PKB A;  4FLK A;  4IPA A;  3TB5 A;  2EA4 A;  2DFI A;  2BHD A;  2P98 A;  1WBQ A;  5CNX A;  5D6E A;  3MAT A;  4Z7M A;  3S6B A;  1O0X A;  1M35 A;  1Y1N A;  2BWS A;  1QXZ A;  2V3Y A;  2BWV A;  2Q94 A;  1XGN A;  4RZY A;  3FMR A;  2EA2 A;  2GU4 A;  2GG2 A;  4IDY A;  4A6W A;  1CHM A;  5CIK A;  4IKT A;  4QR8 A;  2GG5 A;  4FLI A;  2GTX A;  3CTZ A;  4PV4 A;  2Q8K A;  4ZWP A;  2OKN A;  1W2M A;  4S01 A;  3CB5 A;  1B6A A;  1YW9 A;  2GG8 A;  1R5G A;  2BWT A;  3IU9 A;  2B3H A;  4FUK A;  4IKU A;  4ZWU A;  1WN1 A;  1YVM A;  3PKD A;  3PKE A;  2V6C A;  2GZ5 A;  2OAZ A;  4IEC A;  1B59 A;  2BN7 A;  1XGO A;  1KQ9 A;  4U69 A;  1YW8 A;  2GA2 A;  5CDE A;  4FLJ A;  4U75 A;  4EGE A;  5FCH A;  2BHA A;  4U76 A;  2BB7 A;  2BWY A;  3L24 A;  5E5B A;  4U6E A;  1R5H A;  1WKM A;  1C24 A;  2HOW A;  1C27 A;  4FO7 A;  4IKR A;  3Q6D A;  1R58 A;  4OOK A;  4S00 A;  4B28 A;  4U6C A;  1QXW A;  3D27 A;  2BWX A;  1C22 A;  1WL6 A;  2EVM A;  2ZSG A;  1QXY A;  2BWW A;  3FM3 A;  1BOA A;  3FMQ A;  3IG4 A;  4A6V A;  3PKC A;  2Q93 A;  2NQ7 A;  4S2R P;  1BN5 A;  2EVC A;  2MAT A;  1WL9 A;  2V3Z A;  1YW7 A; 
#chains in the Genus database with same CATH topology
 3PKA A;  3L7G A;  4PNC A;  4JUQ A;  2Q92 A;  3IU7 A;  2P99 A;  1YJ3 A;  1XGM A;  4U70 A;  1KP0 A;  1MAT A;  2B3K A;  3MX6 A;  4IF7 A;  2GG7 A;  2ADU A;  2BHC A;  4FO8 A;  5D6F A;  4ZNG A;  5JI6 A;  2GGB A;  1KQ0 A;  5CLS A;  2BWU A;  3BIQ A;  2V3X A;  3MR1 A;  1XGS A;  4HXX A;  2GU6 A;  1XNZ A;  1WY2 A;  3IU8 A;  1C21 A;  4S2T P;  4RGZ 1;  3CB6 A;  2Q96 A;  3BIT A;  5JFR A;  1PV9 A;  2GU7 A;  4FLL A;  5CDL A;  1N51 A;  4KM3 A;  4IKS A;  2EVO A;  4U6Z A;  4RZZ A;  5FCF A;  3ROR A;  3BIP A;  3RVA A;  3TAV A;  4U6W A;  4FKC A;  2GGC A;  2BHB A;  4R60 A;  1QZY A;  4U73 A;  2NQ6 A;  5CE6 A;  2BH3 A;  1W7V A;  2GU5 A;  2GG3 A;  1WLR A;  4U1B A;  5JHU A;  2Q95 A;  4IU6 A;  4MAT A;  2P9A A;  5CDV A;  2IW2 A;  2GG9 A;  2B3L A;  2G6P A;  1A16 A;  2GG0 A;  4U6J A;  4ZWO A;  1JAW A;  4U71 A;  1C23 A;  3PKB A;  4FLK A;  4IPA A;  3TB5 A;  2EA4 A;  2DFI A;  2BHD A;  2P98 A;  1WBQ A;  5CNX A;  5D6E A;  3MAT A;  4Z7M A;  3S6B A;  1O0X A;  1M35 A;  1Y1N A;  2BWS A;  1QXZ A;  2V3Y A;  2BWV A;  2Q94 A;  1XGN A;  4RZY A;  3FMR A;  2EA2 A;  2GU4 A;  2GG2 A;  4IDY A;  4A6W A;  1CHM A;  5CIK A;  4IKT A;  4QR8 A;  2GG5 A;  4FLI A;  2GTX A;  3CTZ A;  4PV4 A;  2Q8K A;  4ZWP A;  2OKN A;  1W2M A;  4S01 A;  3CB5 A;  1B6A A;  1YW9 A;  2GG8 A;  1R5G A;  2BWT A;  3IU9 A;  2B3H A;  4FUK A;  4IKU A;  4ZWU A;  1WN1 A;  1YVM A;  3PKD A;  3PKE A;  2V6C A;  2GZ5 A;  2OAZ A;  4IEC A;  1B59 A;  2BN7 A;  1XGO A;  1KQ9 A;  4U69 A;  1YW8 A;  2GA2 A;  5CDE A;  4FLJ A;  4U75 A;  4EGE A;  5FCH A;  2BHA A;  4U76 A;  2BB7 A;  2BWY A;  3L24 A;  5E5B A;  4U6E A;  1R5H A;  1WKM A;  1C24 A;  2HOW A;  1C27 A;  4FO7 A;  4IKR A;  3Q6D A;  1R58 A;  4OOK A;  4S00 A;  4B28 A;  4U6C A;  1QXW A;  3D27 A;  2BWX A;  1C22 A;  1WL6 A;  2EVM A;  2ZSG A;  1QXY A;  2BWW A;  3FM3 A;  1BOA A;  3FMQ A;  3IG4 A;  4A6V A;  3PKC A;  2Q93 A;  2NQ7 A;  4S2R P;  1BN5 A;  2EVC A;  2MAT A;  1WL9 A;  2V3Z A;  1YW7 A; 
#chains in the Genus database with same CATH homology
 3PKA A;  3L7G A;  4PNC A;  4JUQ A;  2Q92 A;  3IU7 A;  2P99 A;  1YJ3 A;  1XGM A;  4U70 A;  1KP0 A;  1MAT A;  2B3K A;  3MX6 A;  4IF7 A;  2GG7 A;  2ADU A;  2BHC A;  4FO8 A;  5D6F A;  4ZNG A;  5JI6 A;  2GGB A;  1KQ0 A;  5CLS A;  2BWU A;  3BIQ A;  2V3X A;  3MR1 A;  1XGS A;  4HXX A;  2GU6 A;  1XNZ A;  1WY2 A;  3IU8 A;  1C21 A;  4S2T P;  4RGZ 1;  3CB6 A;  2Q96 A;  3BIT A;  5JFR A;  1PV9 A;  2GU7 A;  4FLL A;  5CDL A;  1N51 A;  4KM3 A;  4IKS A;  2EVO A;  4U6Z A;  4RZZ A;  5FCF A;  3ROR A;  3BIP A;  3RVA A;  3TAV A;  4U6W A;  4FKC A;  2GGC A;  2BHB A;  4R60 A;  1QZY A;  4U73 A;  2NQ6 A;  5CE6 A;  2BH3 A;  1W7V A;  2GU5 A;  2GG3 A;  1WLR A;  4U1B A;  5JHU A;  2Q95 A;  4IU6 A;  4MAT A;  2P9A A;  5CDV A;  2IW2 A;  2GG9 A;  2B3L A;  2G6P A;  1A16 A;  2GG0 A;  4U6J A;  4ZWO A;  1JAW A;  4U71 A;  1C23 A;  3PKB A;  4FLK A;  4IPA A;  3TB5 A;  2EA4 A;  2DFI A;  2BHD A;  2P98 A;  1WBQ A;  5CNX A;  5D6E A;  3MAT A;  4Z7M A;  3S6B A;  1O0X A;  1M35 A;  1Y1N A;  2BWS A;  1QXZ A;  2V3Y A;  2BWV A;  2Q94 A;  1XGN A;  4RZY A;  3FMR A;  2EA2 A;  2GU4 A;  2GG2 A;  4IDY A;  4A6W A;  1CHM A;  5CIK A;  4IKT A;  4QR8 A;  2GG5 A;  4FLI A;  2GTX A;  3CTZ A;  4PV4 A;  2Q8K A;  4ZWP A;  2OKN A;  1W2M A;  4S01 A;  3CB5 A;  1B6A A;  1YW9 A;  2GG8 A;  1R5G A;  2BWT A;  3IU9 A;  2B3H A;  4FUK A;  4IKU A;  4ZWU A;  1WN1 A;  1YVM A;  3PKD A;  3PKE A;  2V6C A;  2GZ5 A;  2OAZ A;  4IEC A;  1B59 A;  2BN7 A;  1XGO A;  1KQ9 A;  4U69 A;  1YW8 A;  2GA2 A;  5CDE A;  4FLJ A;  4U75 A;  4EGE A;  5FCH A;  2BHA A;  4U76 A;  2BB7 A;  2BWY A;  3L24 A;  5E5B A;  4U6E A;  1R5H A;  1WKM A;  1C24 A;  2HOW A;  1C27 A;  4FO7 A;  4IKR A;  3Q6D A;  1R58 A;  4OOK A;  4S00 A;  4B28 A;  4U6C A;  1QXW A;  3D27 A;  2BWX A;  1C22 A;  1WL6 A;  2EVM A;  2ZSG A;  1QXY A;  2BWW A;  3FM3 A;  1BOA A;  3FMQ A;  3IG4 A;  4A6V A;  3PKC A;  2Q93 A;  2NQ7 A;  4S2R P;  1BN5 A;  2EVC A;  2MAT A;  1WL9 A;  2V3Z A;  1YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...