4U6EA

Hsmetap in complex with (amino(phenyl)methyl)phosphonic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6eA00
1QXYA 4IDYA 2ADUA 1R5HA 3IU7A 2GG0A 2BWVA 1WL6A 3PKAA 1PV9A 4IKSA 3PKCA 1C24A 1M35A 3PKEA 2Q96A 4U6ZA 2BN7A 1O0XA 4S00A 2BH3A 4HXXA 2BWYA 1YVMA 1YJ3A 4ZWUA 1XGSA 4QR8A 3TAVA 1KQ0A 2Q8KA 2P99A 4U6JA 4A6WA 4FLJA 3PKBA 3RVAA 1XGOA 1C27A 5D6EA 2BWUA 1WBQA 2B3HA 4U75A 2IW2A 1WN1A 3MX6A 2BHCA 2GG5A 4PNCA 1B6AA 3FMRA 4FLLA 4RGZ1 4Z7MA 3Q6DA 2V6CA 1XNZA 3BIQA 5E5BA 4JUQA 3IG4A 1Y1NA 5CDEA 1A16A 1WKMA 2GZ5A 1KQ9A 1XGNA 2GTXA 4S2TP 5CDLA 1YW8A 3TB5A 4FO8A 5CDVA 2GU5A 2GG7A 2GU4A 2BHAA 3IU9A 5JHUA 1QXWA 2DFIA 3IU8A 2Q92A 2BWTA 2GGCA 4OOKA 4RZYA 4FO7A 1N51A 1C23A 2GG3A 2GG2A 3L7GA 4FLIA 4ZWPA 4U69A 2V3ZA 5CE6A 2GU6A 4B28A 4U70A 2EA4A 2NQ6A 2GG8A 2EA2A 2BWWA 1R5GA 2HOWA 3RORA 3BIPA 3CB6A 1C21A 4IECA 4U6EA 3CTZA 3MR1A 5CIKA 4U6CA 4IKTA 2EVOA 3MATA 2GG9A 4ZNGA 4RZZA 4FUKA 1C22A 2G6PA 2OAZA 1JAWA 3S6BA 4IKRA 2V3XA 5FCHA 4IPAA 2BWXA 1QZYA 4IU6A 4U1BA 4S2RP 2V3YA 2NQ7A 1YW9A 3CB5A 2P98A 2GGBA 3FMQA 5FCFA 1BN5A 1CHMA 4U71A 4R60A 2B3LA 2BB7A 2P9AA 3PKDA 4FKCA 2Q94A 2BHDA 4A6VA 4MATA 3FM3A 4ZWOA 2B3KA 4FLKA 1WLRA 4U6WA 3L24A 4U76A 5D6FA 1BOAA 2ZSGA 4KM3A 2BWSA 2Q95A 2Q93A 1WL9A 4S01A 2OKNA 1QXZA 4PV4A 4EGEA 5CNXA 5CLSA 5JFRA 4IF7A 3BITA 1WY2A 1YW7A 1W2MA 2EVMA 2GA2A 1W7VA 2GU7A 1KP0A 1B59A 2EVCA 4U73A 1XGMA 1R58A 2MATA 5JI6A 4IKUA 3D27A 2BHBA 1MATA
chains in the Genus database with same CATH superfamily
1QXYA 4IDYA 2ADUA 1R5HA 3IU7A 2GG0A 2BWVA 1WL6A 3PKAA 1PV9A 4IKSA 3PKCA 1C24A 1M35A 3PKEA 2Q96A 4U6ZA 2BN7A 1O0XA 4S00A 2BH3A 4HXXA 2BWYA 1YVMA 1YJ3A 4ZWUA 1XGSA 4QR8A 3TAVA 1KQ0A 2Q8KA 2P99A 4U6JA 4A6WA 4FLJA 3PKBA 3RVAA 1XGOA 1C27A 5D6EA 2BWUA 1WBQA 2B3HA 4U75A 2IW2A 1WN1A 3MX6A 2BHCA 2GG5A 4PNCA 1B6AA 3FMRA 4FLLA 4RGZ1 4Z7MA 3Q6DA 2V6CA 1XNZA 3BIQA 5E5BA 4JUQA 3IG4A 1Y1NA 5CDEA 1A16A 1WKMA 2GZ5A 1KQ9A 1XGNA 2GTXA 4S2TP 5CDLA 1YW8A 3TB5A 4FO8A 5CDVA 2GU5A 2GG7A 2GU4A 2BHAA 3IU9A 5JHUA 1QXWA 2DFIA 3IU8A 2Q92A 2BWTA 2GGCA 4OOKA 4RZYA 4FO7A 1N51A 1C23A 2GG3A 2GG2A 3L7GA 4FLIA 4ZWPA 4U69A 2V3ZA 5CE6A 2GU6A 4B28A 4U70A 2EA4A 2NQ6A 2GG8A 2EA2A 2BWWA 1R5GA 2HOWA 3RORA 3BIPA 3CB6A 1C21A 4IECA 4U6EA 3CTZA 3MR1A 5CIKA 4U6CA 4IKTA 2EVOA 3MATA 2GG9A 4ZNGA 4RZZA 4FUKA 1C22A 2G6PA 2OAZA 1JAWA 3S6BA 4IKRA 2V3XA 5FCHA 4IPAA 2BWXA 1QZYA 4IU6A 4U1BA 4S2RP 2V3YA 2NQ7A 1YW9A 3CB5A 2P98A 2GGBA 3FMQA 5FCFA 1BN5A 1CHMA 4U71A 4R60A 2B3LA 2BB7A 2P9AA 3PKDA 4FKCA 2Q94A 2BHDA 4A6VA 4MATA 3FM3A 4ZWOA 2B3KA 4FLKA 1WLRA 4U6WA 3L24A 4U76A 5D6FA 1BOAA 2ZSGA 4KM3A 2BWSA 2Q95A 2Q93A 1WL9A 4S01A 2OKNA 1QXZA 4PV4A 4EGEA 5CNXA 5CLSA 5JFRA 4IF7A 3BITA 1WY2A 1YW7A 1W2MA 2EVMA 2GA2A 1W7VA 2GU7A 1KP0A 1B59A 2EVCA 4U73A 1XGMA 1R58A 2MATA 5JI6A 4IKUA 3D27A 2BHBA 1MATA
chains in the Genus database with same CATH topology
1QXYA 4IDYA 2ADUA 1R5HA 3IU7A 2GG0A 2BWVA 1WL6A 3PKAA 1PV9A 4IKSA 3PKCA 1C24A 1M35A 3PKEA 2Q96A 4U6ZA 2BN7A 1O0XA 4S00A 2BH3A 4HXXA 2BWYA 1YVMA 1YJ3A 4ZWUA 1XGSA 4QR8A 3TAVA 1KQ0A 2Q8KA 2P99A 4U6JA 4A6WA 4FLJA 3PKBA 3RVAA 1XGOA 1C27A 5D6EA 2BWUA 1WBQA 2B3HA 4U75A 2IW2A 1WN1A 3MX6A 2BHCA 2GG5A 4PNCA 1B6AA 3FMRA 4FLLA 4RGZ1 4Z7MA 3Q6DA 2V6CA 1XNZA 3BIQA 5E5BA 4JUQA 3IG4A 1Y1NA 5CDEA 1A16A 1WKMA 2GZ5A 1KQ9A 1XGNA 2GTXA 4S2TP 5CDLA 1YW8A 3TB5A 4FO8A 5CDVA 2GU5A 2GG7A 2GU4A 2BHAA 3IU9A 5JHUA 1QXWA 2DFIA 3IU8A 2Q92A 2BWTA 2GGCA 4OOKA 4RZYA 4FO7A 1N51A 1C23A 2GG3A 2GG2A 3L7GA 4FLIA 4ZWPA 4U69A 2V3ZA 5CE6A 2GU6A 4B28A 4U70A 2EA4A 2NQ6A 2GG8A 2EA2A 2BWWA 1R5GA 2HOWA 3RORA 3BIPA 3CB6A 1C21A 4IECA 4U6EA 3CTZA 3MR1A 5CIKA 4U6CA 4IKTA 2EVOA 3MATA 2GG9A 4ZNGA 4RZZA 4FUKA 1C22A 2G6PA 2OAZA 1JAWA 3S6BA 4IKRA 2V3XA 5FCHA 4IPAA 2BWXA 1QZYA 4IU6A 4U1BA 4S2RP 2V3YA 2NQ7A 1YW9A 3CB5A 2P98A 2GGBA 3FMQA 5FCFA 1BN5A 1CHMA 4U71A 4R60A 2B3LA 2BB7A 2P9AA 3PKDA 4FKCA 2Q94A 2BHDA 4A6VA 4MATA 3FM3A 4ZWOA 2B3KA 4FLKA 1WLRA 4U6WA 3L24A 4U76A 5D6FA 1BOAA 2ZSGA 4KM3A 2BWSA 2Q95A 2Q93A 1WL9A 4S01A 2OKNA 1QXZA 4PV4A 4EGEA 5CNXA 5CLSA 5JFRA 4IF7A 3BITA 1WY2A 1YW7A 1W2MA 2EVMA 2GA2A 1W7VA 2GU7A 1KP0A 1B59A 2EVCA 4U73A 1XGMA 1R58A 2MATA 5JI6A 4IKUA 3D27A 2BHBA 1MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXY A;  4IDY A;  2ADU A;  1R5H A;  3IU7 A;  2GG0 A;  2BWV A;  1WL6 A;  3PKA A;  1PV9 A;  4IKS A;  3PKC A;  1C24 A;  1M35 A;  3PKE A;  2Q96 A;  4U6Z A;  2BN7 A;  1O0X A;  4S00 A;  2BH3 A;  4HXX A;  2BWY A;  1YVM A;  1YJ3 A;  4ZWU A;  1XGS A;  4QR8 A;  3TAV A;  1KQ0 A;  2Q8K A;  2P99 A;  4U6J A;  4A6W A;  4FLJ A;  3PKB A;  3RVA A;  1XGO A;  1C27 A;  5D6E A;  2BWU A;  1WBQ A;  2B3H A;  4U75 A;  2IW2 A;  1WN1 A;  3MX6 A;  2BHC A;  2GG5 A;  4PNC A;  1B6A A;  3FMR A;  4FLL A;  4RGZ 1;  4Z7M A;  3Q6D A;  2V6C A;  1XNZ A;  3BIQ A;  5E5B A;  4JUQ A;  3IG4 A;  1Y1N A;  5CDE A;  1A16 A;  1WKM A;  2GZ5 A;  1KQ9 A;  1XGN A;  2GTX A;  4S2T P;  5CDL A;  1YW8 A;  3TB5 A;  4FO8 A;  5CDV A;  2GU5 A;  2GG7 A;  2GU4 A;  2BHA A;  3IU9 A;  5JHU A;  1QXW A;  2DFI A;  3IU8 A;  2Q92 A;  2BWT A;  2GGC A;  4OOK A;  4RZY A;  4FO7 A;  1N51 A;  1C23 A;  2GG3 A;  2GG2 A;  3L7G A;  4FLI A;  4ZWP A;  4U69 A;  2V3Z A;  5CE6 A;  2GU6 A;  4B28 A;  4U70 A;  2EA4 A;  2NQ6 A;  2GG8 A;  2EA2 A;  2BWW A;  1R5G A;  2HOW A;  3ROR A;  3BIP A;  3CB6 A;  1C21 A;  4IEC A;  4U6E A;  3CTZ A;  3MR1 A;  5CIK A;  4U6C A;  4IKT A;  2EVO A;  3MAT A;  2GG9 A;  4ZNG A;  4RZZ A;  4FUK A;  1C22 A;  2G6P A;  2OAZ A;  1JAW A;  3S6B A;  4IKR A;  2V3X A;  5FCH A;  4IPA A;  2BWX A;  1QZY A;  4IU6 A;  4U1B A;  4S2R P;  2V3Y A;  2NQ7 A;  1YW9 A;  3CB5 A;  2P98 A;  2GGB A;  3FMQ A;  5FCF A;  1BN5 A;  1CHM A;  4U71 A;  4R60 A;  2B3L A;  2BB7 A;  2P9A A;  3PKD A;  4FKC A;  2Q94 A;  2BHD A;  4A6V A;  4MAT A;  3FM3 A;  4ZWO A;  2B3K A;  4FLK A;  1WLR A;  4U6W A;  3L24 A;  4U76 A;  5D6F A;  1BOA A;  2ZSG A;  4KM3 A;  2BWS A;  2Q95 A;  2Q93 A;  1WL9 A;  4S01 A;  2OKN A;  1QXZ A;  4PV4 A;  4EGE A;  5CNX A;  5CLS A;  5JFR A;  4IF7 A;  3BIT A;  1WY2 A;  1YW7 A;  1W2M A;  2EVM A;  2GA2 A;  1W7V A;  2GU7 A;  1KP0 A;  1B59 A;  2EVC A;  4U73 A;  1XGM A;  1R58 A;  2MAT A;  5JI6 A;  4IKU A;  3D27 A;  2BHB A;  1MAT A; 
#chains in the Genus database with same CATH topology
 1QXY A;  4IDY A;  2ADU A;  1R5H A;  3IU7 A;  2GG0 A;  2BWV A;  1WL6 A;  3PKA A;  1PV9 A;  4IKS A;  3PKC A;  1C24 A;  1M35 A;  3PKE A;  2Q96 A;  4U6Z A;  2BN7 A;  1O0X A;  4S00 A;  2BH3 A;  4HXX A;  2BWY A;  1YVM A;  1YJ3 A;  4ZWU A;  1XGS A;  4QR8 A;  3TAV A;  1KQ0 A;  2Q8K A;  2P99 A;  4U6J A;  4A6W A;  4FLJ A;  3PKB A;  3RVA A;  1XGO A;  1C27 A;  5D6E A;  2BWU A;  1WBQ A;  2B3H A;  4U75 A;  2IW2 A;  1WN1 A;  3MX6 A;  2BHC A;  2GG5 A;  4PNC A;  1B6A A;  3FMR A;  4FLL A;  4RGZ 1;  4Z7M A;  3Q6D A;  2V6C A;  1XNZ A;  3BIQ A;  5E5B A;  4JUQ A;  3IG4 A;  1Y1N A;  5CDE A;  1A16 A;  1WKM A;  2GZ5 A;  1KQ9 A;  1XGN A;  2GTX A;  4S2T P;  5CDL A;  1YW8 A;  3TB5 A;  4FO8 A;  5CDV A;  2GU5 A;  2GG7 A;  2GU4 A;  2BHA A;  3IU9 A;  5JHU A;  1QXW A;  2DFI A;  3IU8 A;  2Q92 A;  2BWT A;  2GGC A;  4OOK A;  4RZY A;  4FO7 A;  1N51 A;  1C23 A;  2GG3 A;  2GG2 A;  3L7G A;  4FLI A;  4ZWP A;  4U69 A;  2V3Z A;  5CE6 A;  2GU6 A;  4B28 A;  4U70 A;  2EA4 A;  2NQ6 A;  2GG8 A;  2EA2 A;  2BWW A;  1R5G A;  2HOW A;  3ROR A;  3BIP A;  3CB6 A;  1C21 A;  4IEC A;  4U6E A;  3CTZ A;  3MR1 A;  5CIK A;  4U6C A;  4IKT A;  2EVO A;  3MAT A;  2GG9 A;  4ZNG A;  4RZZ A;  4FUK A;  1C22 A;  2G6P A;  2OAZ A;  1JAW A;  3S6B A;  4IKR A;  2V3X A;  5FCH A;  4IPA A;  2BWX A;  1QZY A;  4IU6 A;  4U1B A;  4S2R P;  2V3Y A;  2NQ7 A;  1YW9 A;  3CB5 A;  2P98 A;  2GGB A;  3FMQ A;  5FCF A;  1BN5 A;  1CHM A;  4U71 A;  4R60 A;  2B3L A;  2BB7 A;  2P9A A;  3PKD A;  4FKC A;  2Q94 A;  2BHD A;  4A6V A;  4MAT A;  3FM3 A;  4ZWO A;  2B3K A;  4FLK A;  1WLR A;  4U6W A;  3L24 A;  4U76 A;  5D6F A;  1BOA A;  2ZSG A;  4KM3 A;  2BWS A;  2Q95 A;  2Q93 A;  1WL9 A;  4S01 A;  2OKN A;  1QXZ A;  4PV4 A;  4EGE A;  5CNX A;  5CLS A;  5JFR A;  4IF7 A;  3BIT A;  1WY2 A;  1YW7 A;  1W2M A;  2EVM A;  2GA2 A;  1W7V A;  2GU7 A;  1KP0 A;  1B59 A;  2EVC A;  4U73 A;  1XGM A;  1R58 A;  2MAT A;  5JI6 A;  4IKU A;  3D27 A;  2BHB A;  1MAT A; 
#chains in the Genus database with same CATH homology
 1QXY A;  4IDY A;  2ADU A;  1R5H A;  3IU7 A;  2GG0 A;  2BWV A;  1WL6 A;  3PKA A;  1PV9 A;  4IKS A;  3PKC A;  1C24 A;  1M35 A;  3PKE A;  2Q96 A;  4U6Z A;  2BN7 A;  1O0X A;  4S00 A;  2BH3 A;  4HXX A;  2BWY A;  1YVM A;  1YJ3 A;  4ZWU A;  1XGS A;  4QR8 A;  3TAV A;  1KQ0 A;  2Q8K A;  2P99 A;  4U6J A;  4A6W A;  4FLJ A;  3PKB A;  3RVA A;  1XGO A;  1C27 A;  5D6E A;  2BWU A;  1WBQ A;  2B3H A;  4U75 A;  2IW2 A;  1WN1 A;  3MX6 A;  2BHC A;  2GG5 A;  4PNC A;  1B6A A;  3FMR A;  4FLL A;  4RGZ 1;  4Z7M A;  3Q6D A;  2V6C A;  1XNZ A;  3BIQ A;  5E5B A;  4JUQ A;  3IG4 A;  1Y1N A;  5CDE A;  1A16 A;  1WKM A;  2GZ5 A;  1KQ9 A;  1XGN A;  2GTX A;  4S2T P;  5CDL A;  1YW8 A;  3TB5 A;  4FO8 A;  5CDV A;  2GU5 A;  2GG7 A;  2GU4 A;  2BHA A;  3IU9 A;  5JHU A;  1QXW A;  2DFI A;  3IU8 A;  2Q92 A;  2BWT A;  2GGC A;  4OOK A;  4RZY A;  4FO7 A;  1N51 A;  1C23 A;  2GG3 A;  2GG2 A;  3L7G A;  4FLI A;  4ZWP A;  4U69 A;  2V3Z A;  5CE6 A;  2GU6 A;  4B28 A;  4U70 A;  2EA4 A;  2NQ6 A;  2GG8 A;  2EA2 A;  2BWW A;  1R5G A;  2HOW A;  3ROR A;  3BIP A;  3CB6 A;  1C21 A;  4IEC A;  4U6E A;  3CTZ A;  3MR1 A;  5CIK A;  4U6C A;  4IKT A;  2EVO A;  3MAT A;  2GG9 A;  4ZNG A;  4RZZ A;  4FUK A;  1C22 A;  2G6P A;  2OAZ A;  1JAW A;  3S6B A;  4IKR A;  2V3X A;  5FCH A;  4IPA A;  2BWX A;  1QZY A;  4IU6 A;  4U1B A;  4S2R P;  2V3Y A;  2NQ7 A;  1YW9 A;  3CB5 A;  2P98 A;  2GGB A;  3FMQ A;  5FCF A;  1BN5 A;  1CHM A;  4U71 A;  4R60 A;  2B3L A;  2BB7 A;  2P9A A;  3PKD A;  4FKC A;  2Q94 A;  2BHD A;  4A6V A;  4MAT A;  3FM3 A;  4ZWO A;  2B3K A;  4FLK A;  1WLR A;  4U6W A;  3L24 A;  4U76 A;  5D6F A;  1BOA A;  2ZSG A;  4KM3 A;  2BWS A;  2Q95 A;  2Q93 A;  1WL9 A;  4S01 A;  2OKN A;  1QXZ A;  4PV4 A;  4EGE A;  5CNX A;  5CLS A;  5JFR A;  4IF7 A;  3BIT A;  1WY2 A;  1YW7 A;  1W2M A;  2EVM A;  2GA2 A;  1W7V A;  2GU7 A;  1KP0 A;  1B59 A;  2EVC A;  4U73 A;  1XGM A;  1R58 A;  2MAT A;  5JI6 A;  4IKU A;  3D27 A;  2BHB A;  1MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...