2G6PA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with pyridyl pyrimidine derivative
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Pyridinylpyrimidines as Inhibitors of Human Methionine Aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2g6pA00
2P9AA 4ZNGA 4S2TP 3PKCA 4FLJA 1YW7A 2V3YA 3BIQA 3FMQA 4IKSA 4KM3A 4U73A 1YVMA 2GG5A 3CTZA 5CIKA 4MATA 2BN7A 2Q94A 4A6VA 2MATA 2Q93A 2GG7A 3D27A 3MX6A 2GGBA 2OAZA 3IU9A 4IPAA 2EVCA 1WL9A 4U6JA 5JI6A 4FLKA 1BN5A 4U75A 4U6ZA 4U69A 3Q6DA 4IKUA 4ZWUA 5CDEA 2B3HA 1B6AA 5CE6A 1C23A 2EA4A 1O0XA 1JAWA 4EGEA 1WLRA 3PKBA 4U76A 3RVAA 3TB5A 2ADUA 1YW8A 4HXXA 3TAVA 4Z7MA 2BWUA 2BWXA 1WL6A 5JHUA 1XGSA 5CDLA 1XNZA 2EVMA 1C27A 2GU5A 2GG8A 3MATA 1PV9A 2GU6A 3S6BA 3CB5A 3FMRA 2Q92A 3IU8A 4FLLA 4S00A 2OKNA 4A6WA 4QR8A 2V3ZA 4IECA 2EA2A 1M35A 2P98A 3FM3A 4R60A 1WN1A 1KQ9A 4FKCA 4U6EA 4ZWOA 2B3LA 2GU7A 1W2MA 3L24A 2BHBA 4IF7A 5CLSA 4RZZA 2BWSA 3L7GA 1QXYA 2B3KA 2NQ6A 4IU6A 1R58A 1N51A 2Q96A 4U1BA 2BWYA 1C22A 5CNXA 5FCHA 2BHCA 4S2RP 4ZWPA 4PV4A 2Q8KA 1R5HA 3MR1A 4FUKA 1A16A 1XGOA 1QXWA 2NQ7A 4IDYA 5JFRA 4U70A 1KQ0A 1C24A 2GG3A 4RZYA 2GU4A 4U6WA 1W7VA 3RORA 1QZYA 1WY2A 1XGMA 1MATA 2GG9A 1XGNA 2BHAA 2ZSGA 4IKTA 4JUQA 2BWWA 4FO8A 4S01A 2G6PA 1B59A 4OOKA 4FLIA 4IKRA 1YW9A 4B28A 2BHDA 2Q95A 2V6CA 5D6FA 1C21A 2IW2A 2BWTA 1BOAA 1WKMA 4U71A 4FO7A 1YJ3A 4RGZ1 1R5GA 3PKAA 2BWVA 2BH3A 2DFIA 1KP0A 1WBQA 2P99A 1Y1NA 2GA2A 3BIPA 2BB7A 3IG4A 2HOWA 5E5BA 2GZ5A 3IU7A 5D6EA 2GTXA 3CB6A 3PKDA 2EVOA 2V3XA 4U6CA 3PKEA 4PNCA 5FCFA 5CDVA 2GGCA 2GG0A 2GG2A 1CHMA 1QXZA 3BITA
chains in the Genus database with same CATH superfamily
2P9AA 4ZNGA 4S2TP 3PKCA 4FLJA 1YW7A 2V3YA 3BIQA 3FMQA 4IKSA 4KM3A 4U73A 1YVMA 2GG5A 3CTZA 5CIKA 4MATA 2BN7A 2Q94A 4A6VA 2MATA 2Q93A 2GG7A 3D27A 3MX6A 2GGBA 2OAZA 3IU9A 4IPAA 2EVCA 1WL9A 4U6JA 5JI6A 4FLKA 1BN5A 4U75A 4U6ZA 4U69A 3Q6DA 4IKUA 4ZWUA 5CDEA 2B3HA 1B6AA 5CE6A 1C23A 2EA4A 1O0XA 1JAWA 4EGEA 1WLRA 3PKBA 4U76A 3RVAA 3TB5A 2ADUA 1YW8A 4HXXA 3TAVA 4Z7MA 2BWUA 2BWXA 1WL6A 5JHUA 1XGSA 5CDLA 1XNZA 2EVMA 1C27A 2GU5A 2GG8A 3MATA 1PV9A 2GU6A 3S6BA 3CB5A 3FMRA 2Q92A 3IU8A 4FLLA 4S00A 2OKNA 4A6WA 4QR8A 2V3ZA 4IECA 2EA2A 1M35A 2P98A 3FM3A 4R60A 1WN1A 1KQ9A 4FKCA 4U6EA 4ZWOA 2B3LA 2GU7A 1W2MA 3L24A 2BHBA 4IF7A 5CLSA 4RZZA 2BWSA 3L7GA 1QXYA 2B3KA 2NQ6A 4IU6A 1R58A 1N51A 2Q96A 4U1BA 2BWYA 1C22A 5CNXA 5FCHA 2BHCA 4S2RP 4ZWPA 4PV4A 2Q8KA 1R5HA 3MR1A 4FUKA 1A16A 1XGOA 1QXWA 2NQ7A 4IDYA 5JFRA 4U70A 1KQ0A 1C24A 2GG3A 4RZYA 2GU4A 4U6WA 1W7VA 3RORA 1QZYA 1WY2A 1XGMA 1MATA 2GG9A 1XGNA 2BHAA 2ZSGA 4IKTA 4JUQA 2BWWA 4FO8A 4S01A 2G6PA 1B59A 4OOKA 4FLIA 4IKRA 1YW9A 4B28A 2BHDA 2Q95A 2V6CA 5D6FA 1C21A 2IW2A 2BWTA 1BOAA 1WKMA 4U71A 4FO7A 1YJ3A 4RGZ1 1R5GA 3PKAA 2BWVA 2BH3A 2DFIA 1KP0A 1WBQA 2P99A 1Y1NA 2GA2A 3BIPA 2BB7A 3IG4A 2HOWA 5E5BA 2GZ5A 3IU7A 5D6EA 2GTXA 3CB6A 3PKDA 2EVOA 2V3XA 4U6CA 3PKEA 4PNCA 5FCFA 5CDVA 2GGCA 2GG0A 2GG2A 1CHMA 1QXZA 3BITA
chains in the Genus database with same CATH topology
2P9AA 4ZNGA 4S2TP 3PKCA 4FLJA 1YW7A 2V3YA 3BIQA 3FMQA 4IKSA 4KM3A 4U73A 1YVMA 2GG5A 3CTZA 5CIKA 4MATA 2BN7A 2Q94A 4A6VA 2MATA 2Q93A 2GG7A 3D27A 3MX6A 2GGBA 2OAZA 3IU9A 4IPAA 2EVCA 1WL9A 4U6JA 5JI6A 4FLKA 1BN5A 4U75A 4U6ZA 4U69A 3Q6DA 4IKUA 4ZWUA 5CDEA 2B3HA 1B6AA 5CE6A 1C23A 2EA4A 1O0XA 1JAWA 4EGEA 1WLRA 3PKBA 4U76A 3RVAA 3TB5A 2ADUA 1YW8A 4HXXA 3TAVA 4Z7MA 2BWUA 2BWXA 1WL6A 5JHUA 1XGSA 5CDLA 1XNZA 2EVMA 1C27A 2GU5A 2GG8A 3MATA 1PV9A 2GU6A 3S6BA 3CB5A 3FMRA 2Q92A 3IU8A 4FLLA 4S00A 2OKNA 4A6WA 4QR8A 2V3ZA 4IECA 2EA2A 1M35A 2P98A 3FM3A 4R60A 1WN1A 1KQ9A 4FKCA 4U6EA 4ZWOA 2B3LA 2GU7A 1W2MA 3L24A 2BHBA 4IF7A 5CLSA 4RZZA 2BWSA 3L7GA 1QXYA 2B3KA 2NQ6A 4IU6A 1R58A 1N51A 2Q96A 4U1BA 2BWYA 1C22A 5CNXA 5FCHA 2BHCA 4S2RP 4ZWPA 4PV4A 2Q8KA 1R5HA 3MR1A 4FUKA 1A16A 1XGOA 1QXWA 2NQ7A 4IDYA 5JFRA 4U70A 1KQ0A 1C24A 2GG3A 4RZYA 2GU4A 4U6WA 1W7VA 3RORA 1QZYA 1WY2A 1XGMA 1MATA 2GG9A 1XGNA 2BHAA 2ZSGA 4IKTA 4JUQA 2BWWA 4FO8A 4S01A 2G6PA 1B59A 4OOKA 4FLIA 4IKRA 1YW9A 4B28A 2BHDA 2Q95A 2V6CA 5D6FA 1C21A 2IW2A 2BWTA 1BOAA 1WKMA 4U71A 4FO7A 1YJ3A 4RGZ1 1R5GA 3PKAA 2BWVA 2BH3A 2DFIA 1KP0A 1WBQA 2P99A 1Y1NA 2GA2A 3BIPA 2BB7A 3IG4A 2HOWA 5E5BA 2GZ5A 3IU7A 5D6EA 2GTXA 3CB6A 3PKDA 2EVOA 2V3XA 4U6CA 3PKEA 4PNCA 5FCFA 5CDVA 2GGCA 2GG0A 2GG2A 1CHMA 1QXZA 3BITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9A A;  4ZNG A;  4S2T P;  3PKC A;  4FLJ A;  1YW7 A;  2V3Y A;  3BIQ A;  3FMQ A;  4IKS A;  4KM3 A;  4U73 A;  1YVM A;  2GG5 A;  3CTZ A;  5CIK A;  4MAT A;  2BN7 A;  2Q94 A;  4A6V A;  2MAT A;  2Q93 A;  2GG7 A;  3D27 A;  3MX6 A;  2GGB A;  2OAZ A;  3IU9 A;  4IPA A;  2EVC A;  1WL9 A;  4U6J A;  5JI6 A;  4FLK A;  1BN5 A;  4U75 A;  4U6Z A;  4U69 A;  3Q6D A;  4IKU A;  4ZWU A;  5CDE A;  2B3H A;  1B6A A;  5CE6 A;  1C23 A;  2EA4 A;  1O0X A;  1JAW A;  4EGE A;  1WLR A;  3PKB A;  4U76 A;  3RVA A;  3TB5 A;  2ADU A;  1YW8 A;  4HXX A;  3TAV A;  4Z7M A;  2BWU A;  2BWX A;  1WL6 A;  5JHU A;  1XGS A;  5CDL A;  1XNZ A;  2EVM A;  1C27 A;  2GU5 A;  2GG8 A;  3MAT A;  1PV9 A;  2GU6 A;  3S6B A;  3CB5 A;  3FMR A;  2Q92 A;  3IU8 A;  4FLL A;  4S00 A;  2OKN A;  4A6W A;  4QR8 A;  2V3Z A;  4IEC A;  2EA2 A;  1M35 A;  2P98 A;  3FM3 A;  4R60 A;  1WN1 A;  1KQ9 A;  4FKC A;  4U6E A;  4ZWO A;  2B3L A;  2GU7 A;  1W2M A;  3L24 A;  2BHB A;  4IF7 A;  5CLS A;  4RZZ A;  2BWS A;  3L7G A;  1QXY A;  2B3K A;  2NQ6 A;  4IU6 A;  1R58 A;  1N51 A;  2Q96 A;  4U1B A;  2BWY A;  1C22 A;  5CNX A;  5FCH A;  2BHC A;  4S2R P;  4ZWP A;  4PV4 A;  2Q8K A;  1R5H A;  3MR1 A;  4FUK A;  1A16 A;  1XGO A;  1QXW A;  2NQ7 A;  4IDY A;  5JFR A;  4U70 A;  1KQ0 A;  1C24 A;  2GG3 A;  4RZY A;  2GU4 A;  4U6W A;  1W7V A;  3ROR A;  1QZY A;  1WY2 A;  1XGM A;  1MAT A;  2GG9 A;  1XGN A;  2BHA A;  2ZSG A;  4IKT A;  4JUQ A;  2BWW A;  4FO8 A;  4S01 A;  2G6P A;  1B59 A;  4OOK A;  4FLI A;  4IKR A;  1YW9 A;  4B28 A;  2BHD A;  2Q95 A;  2V6C A;  5D6F A;  1C21 A;  2IW2 A;  2BWT A;  1BOA A;  1WKM A;  4U71 A;  4FO7 A;  1YJ3 A;  4RGZ 1;  1R5G A;  3PKA A;  2BWV A;  2BH3 A;  2DFI A;  1KP0 A;  1WBQ A;  2P99 A;  1Y1N A;  2GA2 A;  3BIP A;  2BB7 A;  3IG4 A;  2HOW A;  5E5B A;  2GZ5 A;  3IU7 A;  5D6E A;  2GTX A;  3CB6 A;  3PKD A;  2EVO A;  2V3X A;  4U6C A;  3PKE A;  4PNC A;  5FCF A;  5CDV A;  2GGC A;  2GG0 A;  2GG2 A;  1CHM A;  1QXZ A;  3BIT A; 
#chains in the Genus database with same CATH topology
 2P9A A;  4ZNG A;  4S2T P;  3PKC A;  4FLJ A;  1YW7 A;  2V3Y A;  3BIQ A;  3FMQ A;  4IKS A;  4KM3 A;  4U73 A;  1YVM A;  2GG5 A;  3CTZ A;  5CIK A;  4MAT A;  2BN7 A;  2Q94 A;  4A6V A;  2MAT A;  2Q93 A;  2GG7 A;  3D27 A;  3MX6 A;  2GGB A;  2OAZ A;  3IU9 A;  4IPA A;  2EVC A;  1WL9 A;  4U6J A;  5JI6 A;  4FLK A;  1BN5 A;  4U75 A;  4U6Z A;  4U69 A;  3Q6D A;  4IKU A;  4ZWU A;  5CDE A;  2B3H A;  1B6A A;  5CE6 A;  1C23 A;  2EA4 A;  1O0X A;  1JAW A;  4EGE A;  1WLR A;  3PKB A;  4U76 A;  3RVA A;  3TB5 A;  2ADU A;  1YW8 A;  4HXX A;  3TAV A;  4Z7M A;  2BWU A;  2BWX A;  1WL6 A;  5JHU A;  1XGS A;  5CDL A;  1XNZ A;  2EVM A;  1C27 A;  2GU5 A;  2GG8 A;  3MAT A;  1PV9 A;  2GU6 A;  3S6B A;  3CB5 A;  3FMR A;  2Q92 A;  3IU8 A;  4FLL A;  4S00 A;  2OKN A;  4A6W A;  4QR8 A;  2V3Z A;  4IEC A;  2EA2 A;  1M35 A;  2P98 A;  3FM3 A;  4R60 A;  1WN1 A;  1KQ9 A;  4FKC A;  4U6E A;  4ZWO A;  2B3L A;  2GU7 A;  1W2M A;  3L24 A;  2BHB A;  4IF7 A;  5CLS A;  4RZZ A;  2BWS A;  3L7G A;  1QXY A;  2B3K A;  2NQ6 A;  4IU6 A;  1R58 A;  1N51 A;  2Q96 A;  4U1B A;  2BWY A;  1C22 A;  5CNX A;  5FCH A;  2BHC A;  4S2R P;  4ZWP A;  4PV4 A;  2Q8K A;  1R5H A;  3MR1 A;  4FUK A;  1A16 A;  1XGO A;  1QXW A;  2NQ7 A;  4IDY A;  5JFR A;  4U70 A;  1KQ0 A;  1C24 A;  2GG3 A;  4RZY A;  2GU4 A;  4U6W A;  1W7V A;  3ROR A;  1QZY A;  1WY2 A;  1XGM A;  1MAT A;  2GG9 A;  1XGN A;  2BHA A;  2ZSG A;  4IKT A;  4JUQ A;  2BWW A;  4FO8 A;  4S01 A;  2G6P A;  1B59 A;  4OOK A;  4FLI A;  4IKR A;  1YW9 A;  4B28 A;  2BHD A;  2Q95 A;  2V6C A;  5D6F A;  1C21 A;  2IW2 A;  2BWT A;  1BOA A;  1WKM A;  4U71 A;  4FO7 A;  1YJ3 A;  4RGZ 1;  1R5G A;  3PKA A;  2BWV A;  2BH3 A;  2DFI A;  1KP0 A;  1WBQ A;  2P99 A;  1Y1N A;  2GA2 A;  3BIP A;  2BB7 A;  3IG4 A;  2HOW A;  5E5B A;  2GZ5 A;  3IU7 A;  5D6E A;  2GTX A;  3CB6 A;  3PKD A;  2EVO A;  2V3X A;  4U6C A;  3PKE A;  4PNC A;  5FCF A;  5CDV A;  2GGC A;  2GG0 A;  2GG2 A;  1CHM A;  1QXZ A;  3BIT A; 
#chains in the Genus database with same CATH homology
 2P9A A;  4ZNG A;  4S2T P;  3PKC A;  4FLJ A;  1YW7 A;  2V3Y A;  3BIQ A;  3FMQ A;  4IKS A;  4KM3 A;  4U73 A;  1YVM A;  2GG5 A;  3CTZ A;  5CIK A;  4MAT A;  2BN7 A;  2Q94 A;  4A6V A;  2MAT A;  2Q93 A;  2GG7 A;  3D27 A;  3MX6 A;  2GGB A;  2OAZ A;  3IU9 A;  4IPA A;  2EVC A;  1WL9 A;  4U6J A;  5JI6 A;  4FLK A;  1BN5 A;  4U75 A;  4U6Z A;  4U69 A;  3Q6D A;  4IKU A;  4ZWU A;  5CDE A;  2B3H A;  1B6A A;  5CE6 A;  1C23 A;  2EA4 A;  1O0X A;  1JAW A;  4EGE A;  1WLR A;  3PKB A;  4U76 A;  3RVA A;  3TB5 A;  2ADU A;  1YW8 A;  4HXX A;  3TAV A;  4Z7M A;  2BWU A;  2BWX A;  1WL6 A;  5JHU A;  1XGS A;  5CDL A;  1XNZ A;  2EVM A;  1C27 A;  2GU5 A;  2GG8 A;  3MAT A;  1PV9 A;  2GU6 A;  3S6B A;  3CB5 A;  3FMR A;  2Q92 A;  3IU8 A;  4FLL A;  4S00 A;  2OKN A;  4A6W A;  4QR8 A;  2V3Z A;  4IEC A;  2EA2 A;  1M35 A;  2P98 A;  3FM3 A;  4R60 A;  1WN1 A;  1KQ9 A;  4FKC A;  4U6E A;  4ZWO A;  2B3L A;  2GU7 A;  1W2M A;  3L24 A;  2BHB A;  4IF7 A;  5CLS A;  4RZZ A;  2BWS A;  3L7G A;  1QXY A;  2B3K A;  2NQ6 A;  4IU6 A;  1R58 A;  1N51 A;  2Q96 A;  4U1B A;  2BWY A;  1C22 A;  5CNX A;  5FCH A;  2BHC A;  4S2R P;  4ZWP A;  4PV4 A;  2Q8K A;  1R5H A;  3MR1 A;  4FUK A;  1A16 A;  1XGO A;  1QXW A;  2NQ7 A;  4IDY A;  5JFR A;  4U70 A;  1KQ0 A;  1C24 A;  2GG3 A;  4RZY A;  2GU4 A;  4U6W A;  1W7V A;  3ROR A;  1QZY A;  1WY2 A;  1XGM A;  1MAT A;  2GG9 A;  1XGN A;  2BHA A;  2ZSG A;  4IKT A;  4JUQ A;  2BWW A;  4FO8 A;  4S01 A;  2G6P A;  1B59 A;  4OOK A;  4FLI A;  4IKR A;  1YW9 A;  4B28 A;  2BHD A;  2Q95 A;  2V6C A;  5D6F A;  1C21 A;  2IW2 A;  2BWT A;  1BOA A;  1WKM A;  4U71 A;  4FO7 A;  1YJ3 A;  4RGZ 1;  1R5G A;  3PKA A;  2BWV A;  2BH3 A;  2DFI A;  1KP0 A;  1WBQ A;  2P99 A;  1Y1N A;  2GA2 A;  3BIP A;  2BB7 A;  3IG4 A;  2HOW A;  5E5B A;  2GZ5 A;  3IU7 A;  5D6E A;  2GTX A;  3CB6 A;  3PKD A;  2EVO A;  2V3X A;  4U6C A;  3PKE A;  4PNC A;  5FCF A;  5CDV A;  2GGC A;  2GG0 A;  2GG2 A;  1CHM A;  1QXZ A;  3BIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...