2G6PA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with pyridyl pyrimidine derivative
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of Pyridinylpyrimidines as Inhibitors of Human Methionine Aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2g6pA00
4R60A 1C23A 4FLJA 2BWVA 2GGBA 3PKDA 1WL6A 1A16A 2OKNA 5CNXA 2Q8KA 3MR1A 2BWXA 1W2MA 2EA2A 2BHBA 4IDYA 3CB6A 1CHMA 4HXXA 4U75A 1KP0A 3L24A 2GA2A 5D6FA 2NQ6A 2BWTA 3IU8A 5CIKA 1R5GA 4IKTA 4IKSA 4S2RP 3BITA 1N51A 3FMQA 1JAWA 2HOWA 4U71A 1QXYA 1R58A 5D6EA 4FKCA 1C21A 3S6BA 1KQ9A 2BWUA 2B3KA 4IU6A 4U70A 2EVMA 2OAZA 1XGNA 1QXZA 1BN5A 3PKAA 1WLRA 4MATA 1O0XA 3FM3A 1W7VA 3L7GA 2GTXA 2P99A 2GG8A 1WN1A 1C27A 2GG7A 2V3ZA 5JFRA 4A6VA 5CDVA 4IKUA 2EVCA 5FCFA 2BWSA 2GGCA 4IECA 4S2TP 2GG3A 4U73A 4U6WA 3FMRA 2GU6A 1B59A 4U1BA 2EA4A 1XNZA 2GG5A 4IF7A 4ZNGA 2GG9A 4FO7A 2BHAA 4ZWOA 2BWYA 4FLLA 3MX6A 4QR8A 1QZYA 4KM3A 2Q93A 2GG2A 3PKCA 1YW8A 1PV9A 2GU5A 1WBQA 3BIQA 4ZWUA 4FLKA 2GU7A 1WKMA 4JUQA 1C24A 1Y1NA 3PKBA 4FLIA 4RGZ1 5CDLA 4U6JA 2NQ7A 5CLSA 2BHDA 4Z7MA 4IKRA 2B3HA 3D27A 4EGEA 3PKEA 4RZZA 4U69A 2B3LA 4ZWPA 2P9AA 1M35A 3RORA 3IU9A 1MATA 2BHCA 2DFIA 2V3YA 2ADUA 2Q95A 4FUKA 4PNCA 2GG0A 4U76A 1XGSA 5E5BA 5JI6A 1WY2A 3Q6DA 4S01A 1XGOA 2BB7A 5CE6A 3CB5A 2BN7A 4B28A 1B6AA 1C22A 2BWWA 2V6CA 3IG4A 2ZSGA 1XGMA 1YW7A 4IPAA 5CDEA 2Q96A 1KQ0A 2V3XA 1YVMA 4U6ZA 4FO8A 1WL9A 1YJ3A 1YW9A 4U6EA 1QXWA 2EVOA 2G6PA 2IW2A 3IU7A 4OOKA 3MATA 2MATA 3RVAA 2Q94A 3TB5A 4A6WA 1BOAA 3CTZA 4U6CA 2Q92A 4RZYA 2P98A 5FCHA 5JHUA 3TAVA 4S00A 2GU4A 1R5HA 4PV4A 2BH3A 2GZ5A 3BIPA
chains in the Genus database with same CATH superfamily
4R60A 1C23A 4FLJA 2BWVA 2GGBA 3PKDA 1WL6A 1A16A 2OKNA 5CNXA 2Q8KA 3MR1A 2BWXA 1W2MA 2EA2A 2BHBA 4IDYA 3CB6A 1CHMA 4HXXA 4U75A 1KP0A 3L24A 2GA2A 5D6FA 2NQ6A 2BWTA 3IU8A 5CIKA 1R5GA 4IKTA 4IKSA 4S2RP 3BITA 1N51A 3FMQA 1JAWA 2HOWA 4U71A 1QXYA 1R58A 5D6EA 4FKCA 1C21A 3S6BA 1KQ9A 2BWUA 2B3KA 4IU6A 4U70A 2EVMA 2OAZA 1XGNA 1QXZA 1BN5A 3PKAA 1WLRA 4MATA 1O0XA 3FM3A 1W7VA 3L7GA 2GTXA 2P99A 2GG8A 1WN1A 1C27A 2GG7A 2V3ZA 5JFRA 4A6VA 5CDVA 4IKUA 2EVCA 5FCFA 2BWSA 2GGCA 4IECA 4S2TP 2GG3A 4U73A 4U6WA 3FMRA 2GU6A 1B59A 4U1BA 2EA4A 1XNZA 2GG5A 4IF7A 4ZNGA 2GG9A 4FO7A 2BHAA 4ZWOA 2BWYA 4FLLA 3MX6A 4QR8A 1QZYA 4KM3A 2Q93A 2GG2A 3PKCA 1YW8A 1PV9A 2GU5A 1WBQA 3BIQA 4ZWUA 4FLKA 2GU7A 1WKMA 4JUQA 1C24A 1Y1NA 3PKBA 4FLIA 4RGZ1 5CDLA 4U6JA 2NQ7A 5CLSA 2BHDA 4Z7MA 4IKRA 2B3HA 3D27A 4EGEA 3PKEA 4RZZA 4U69A 2B3LA 4ZWPA 2P9AA 1M35A 3RORA 3IU9A 1MATA 2BHCA 2DFIA 2V3YA 2ADUA 2Q95A 4FUKA 4PNCA 2GG0A 4U76A 1XGSA 5E5BA 5JI6A 1WY2A 3Q6DA 4S01A 1XGOA 2BB7A 5CE6A 3CB5A 2BN7A 4B28A 1B6AA 1C22A 2BWWA 2V6CA 3IG4A 2ZSGA 1XGMA 1YW7A 4IPAA 5CDEA 2Q96A 1KQ0A 2V3XA 1YVMA 4U6ZA 4FO8A 1WL9A 1YJ3A 1YW9A 4U6EA 1QXWA 2EVOA 2G6PA 2IW2A 3IU7A 4OOKA 3MATA 2MATA 3RVAA 2Q94A 3TB5A 4A6WA 1BOAA 3CTZA 4U6CA 2Q92A 4RZYA 2P98A 5FCHA 5JHUA 3TAVA 4S00A 2GU4A 1R5HA 4PV4A 2BH3A 2GZ5A 3BIPA
chains in the Genus database with same CATH topology
4R60A 1C23A 4FLJA 2BWVA 2GGBA 3PKDA 1WL6A 1A16A 2OKNA 5CNXA 2Q8KA 3MR1A 2BWXA 1W2MA 2EA2A 2BHBA 4IDYA 3CB6A 1CHMA 4HXXA 4U75A 1KP0A 3L24A 2GA2A 5D6FA 2NQ6A 2BWTA 3IU8A 5CIKA 1R5GA 4IKTA 4IKSA 4S2RP 3BITA 1N51A 3FMQA 1JAWA 2HOWA 4U71A 1QXYA 1R58A 5D6EA 4FKCA 1C21A 3S6BA 1KQ9A 2BWUA 2B3KA 4IU6A 4U70A 2EVMA 2OAZA 1XGNA 1QXZA 1BN5A 3PKAA 1WLRA 4MATA 1O0XA 3FM3A 1W7VA 3L7GA 2GTXA 2P99A 2GG8A 1WN1A 1C27A 2GG7A 2V3ZA 5JFRA 4A6VA 5CDVA 4IKUA 2EVCA 5FCFA 2BWSA 2GGCA 4IECA 4S2TP 2GG3A 4U73A 4U6WA 3FMRA 2GU6A 1B59A 4U1BA 2EA4A 1XNZA 2GG5A 4IF7A 4ZNGA 2GG9A 4FO7A 2BHAA 4ZWOA 2BWYA 4FLLA 3MX6A 4QR8A 1QZYA 4KM3A 2Q93A 2GG2A 3PKCA 1YW8A 1PV9A 2GU5A 1WBQA 3BIQA 4ZWUA 4FLKA 2GU7A 1WKMA 4JUQA 1C24A 1Y1NA 3PKBA 4FLIA 4RGZ1 5CDLA 4U6JA 2NQ7A 5CLSA 2BHDA 4Z7MA 4IKRA 2B3HA 3D27A 4EGEA 3PKEA 4RZZA 4U69A 2B3LA 4ZWPA 2P9AA 1M35A 3RORA 3IU9A 1MATA 2BHCA 2DFIA 2V3YA 2ADUA 2Q95A 4FUKA 4PNCA 2GG0A 4U76A 1XGSA 5E5BA 5JI6A 1WY2A 3Q6DA 4S01A 1XGOA 2BB7A 5CE6A 3CB5A 2BN7A 4B28A 1B6AA 1C22A 2BWWA 2V6CA 3IG4A 2ZSGA 1XGMA 1YW7A 4IPAA 5CDEA 2Q96A 1KQ0A 2V3XA 1YVMA 4U6ZA 4FO8A 1WL9A 1YJ3A 1YW9A 4U6EA 1QXWA 2EVOA 2G6PA 2IW2A 3IU7A 4OOKA 3MATA 2MATA 3RVAA 2Q94A 3TB5A 4A6WA 1BOAA 3CTZA 4U6CA 2Q92A 4RZYA 2P98A 5FCHA 5JHUA 3TAVA 4S00A 2GU4A 1R5HA 4PV4A 2BH3A 2GZ5A 3BIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R60 A;  1C23 A;  4FLJ A;  2BWV A;  2GGB A;  3PKD A;  1WL6 A;  1A16 A;  2OKN A;  5CNX A;  2Q8K A;  3MR1 A;  2BWX A;  1W2M A;  2EA2 A;  2BHB A;  4IDY A;  3CB6 A;  1CHM A;  4HXX A;  4U75 A;  1KP0 A;  3L24 A;  2GA2 A;  5D6F A;  2NQ6 A;  2BWT A;  3IU8 A;  5CIK A;  1R5G A;  4IKT A;  4IKS A;  4S2R P;  3BIT A;  1N51 A;  3FMQ A;  1JAW A;  2HOW A;  4U71 A;  1QXY A;  1R58 A;  5D6E A;  4FKC A;  1C21 A;  3S6B A;  1KQ9 A;  2BWU A;  2B3K A;  4IU6 A;  4U70 A;  2EVM A;  2OAZ A;  1XGN A;  1QXZ A;  1BN5 A;  3PKA A;  1WLR A;  4MAT A;  1O0X A;  3FM3 A;  1W7V A;  3L7G A;  2GTX A;  2P99 A;  2GG8 A;  1WN1 A;  1C27 A;  2GG7 A;  2V3Z A;  5JFR A;  4A6V A;  5CDV A;  4IKU A;  2EVC A;  5FCF A;  2BWS A;  2GGC A;  4IEC A;  4S2T P;  2GG3 A;  4U73 A;  4U6W A;  3FMR A;  2GU6 A;  1B59 A;  4U1B A;  2EA4 A;  1XNZ A;  2GG5 A;  4IF7 A;  4ZNG A;  2GG9 A;  4FO7 A;  2BHA A;  4ZWO A;  2BWY A;  4FLL A;  3MX6 A;  4QR8 A;  1QZY A;  4KM3 A;  2Q93 A;  2GG2 A;  3PKC A;  1YW8 A;  1PV9 A;  2GU5 A;  1WBQ A;  3BIQ A;  4ZWU A;  4FLK A;  2GU7 A;  1WKM A;  4JUQ A;  1C24 A;  1Y1N A;  3PKB A;  4FLI A;  4RGZ 1;  5CDL A;  4U6J A;  2NQ7 A;  5CLS A;  2BHD A;  4Z7M A;  4IKR A;  2B3H A;  3D27 A;  4EGE A;  3PKE A;  4RZZ A;  4U69 A;  2B3L A;  4ZWP A;  2P9A A;  1M35 A;  3ROR A;  3IU9 A;  1MAT A;  2BHC A;  2DFI A;  2V3Y A;  2ADU A;  2Q95 A;  4FUK A;  4PNC A;  2GG0 A;  4U76 A;  1XGS A;  5E5B A;  5JI6 A;  1WY2 A;  3Q6D A;  4S01 A;  1XGO A;  2BB7 A;  5CE6 A;  3CB5 A;  2BN7 A;  4B28 A;  1B6A A;  1C22 A;  2BWW A;  2V6C A;  3IG4 A;  2ZSG A;  1XGM A;  1YW7 A;  4IPA A;  5CDE A;  2Q96 A;  1KQ0 A;  2V3X A;  1YVM A;  4U6Z A;  4FO8 A;  1WL9 A;  1YJ3 A;  1YW9 A;  4U6E A;  1QXW A;  2EVO A;  2G6P A;  2IW2 A;  3IU7 A;  4OOK A;  3MAT A;  2MAT A;  3RVA A;  2Q94 A;  3TB5 A;  4A6W A;  1BOA A;  3CTZ A;  4U6C A;  2Q92 A;  4RZY A;  2P98 A;  5FCH A;  5JHU A;  3TAV A;  4S00 A;  2GU4 A;  1R5H A;  4PV4 A;  2BH3 A;  2GZ5 A;  3BIP A; 
#chains in the Genus database with same CATH topology
 4R60 A;  1C23 A;  4FLJ A;  2BWV A;  2GGB A;  3PKD A;  1WL6 A;  1A16 A;  2OKN A;  5CNX A;  2Q8K A;  3MR1 A;  2BWX A;  1W2M A;  2EA2 A;  2BHB A;  4IDY A;  3CB6 A;  1CHM A;  4HXX A;  4U75 A;  1KP0 A;  3L24 A;  2GA2 A;  5D6F A;  2NQ6 A;  2BWT A;  3IU8 A;  5CIK A;  1R5G A;  4IKT A;  4IKS A;  4S2R P;  3BIT A;  1N51 A;  3FMQ A;  1JAW A;  2HOW A;  4U71 A;  1QXY A;  1R58 A;  5D6E A;  4FKC A;  1C21 A;  3S6B A;  1KQ9 A;  2BWU A;  2B3K A;  4IU6 A;  4U70 A;  2EVM A;  2OAZ A;  1XGN A;  1QXZ A;  1BN5 A;  3PKA A;  1WLR A;  4MAT A;  1O0X A;  3FM3 A;  1W7V A;  3L7G A;  2GTX A;  2P99 A;  2GG8 A;  1WN1 A;  1C27 A;  2GG7 A;  2V3Z A;  5JFR A;  4A6V A;  5CDV A;  4IKU A;  2EVC A;  5FCF A;  2BWS A;  2GGC A;  4IEC A;  4S2T P;  2GG3 A;  4U73 A;  4U6W A;  3FMR A;  2GU6 A;  1B59 A;  4U1B A;  2EA4 A;  1XNZ A;  2GG5 A;  4IF7 A;  4ZNG A;  2GG9 A;  4FO7 A;  2BHA A;  4ZWO A;  2BWY A;  4FLL A;  3MX6 A;  4QR8 A;  1QZY A;  4KM3 A;  2Q93 A;  2GG2 A;  3PKC A;  1YW8 A;  1PV9 A;  2GU5 A;  1WBQ A;  3BIQ A;  4ZWU A;  4FLK A;  2GU7 A;  1WKM A;  4JUQ A;  1C24 A;  1Y1N A;  3PKB A;  4FLI A;  4RGZ 1;  5CDL A;  4U6J A;  2NQ7 A;  5CLS A;  2BHD A;  4Z7M A;  4IKR A;  2B3H A;  3D27 A;  4EGE A;  3PKE A;  4RZZ A;  4U69 A;  2B3L A;  4ZWP A;  2P9A A;  1M35 A;  3ROR A;  3IU9 A;  1MAT A;  2BHC A;  2DFI A;  2V3Y A;  2ADU A;  2Q95 A;  4FUK A;  4PNC A;  2GG0 A;  4U76 A;  1XGS A;  5E5B A;  5JI6 A;  1WY2 A;  3Q6D A;  4S01 A;  1XGO A;  2BB7 A;  5CE6 A;  3CB5 A;  2BN7 A;  4B28 A;  1B6A A;  1C22 A;  2BWW A;  2V6C A;  3IG4 A;  2ZSG A;  1XGM A;  1YW7 A;  4IPA A;  5CDE A;  2Q96 A;  1KQ0 A;  2V3X A;  1YVM A;  4U6Z A;  4FO8 A;  1WL9 A;  1YJ3 A;  1YW9 A;  4U6E A;  1QXW A;  2EVO A;  2G6P A;  2IW2 A;  3IU7 A;  4OOK A;  3MAT A;  2MAT A;  3RVA A;  2Q94 A;  3TB5 A;  4A6W A;  1BOA A;  3CTZ A;  4U6C A;  2Q92 A;  4RZY A;  2P98 A;  5FCH A;  5JHU A;  3TAV A;  4S00 A;  2GU4 A;  1R5H A;  4PV4 A;  2BH3 A;  2GZ5 A;  3BIP A; 
#chains in the Genus database with same CATH homology
 4R60 A;  1C23 A;  4FLJ A;  2BWV A;  2GGB A;  3PKD A;  1WL6 A;  1A16 A;  2OKN A;  5CNX A;  2Q8K A;  3MR1 A;  2BWX A;  1W2M A;  2EA2 A;  2BHB A;  4IDY A;  3CB6 A;  1CHM A;  4HXX A;  4U75 A;  1KP0 A;  3L24 A;  2GA2 A;  5D6F A;  2NQ6 A;  2BWT A;  3IU8 A;  5CIK A;  1R5G A;  4IKT A;  4IKS A;  4S2R P;  3BIT A;  1N51 A;  3FMQ A;  1JAW A;  2HOW A;  4U71 A;  1QXY A;  1R58 A;  5D6E A;  4FKC A;  1C21 A;  3S6B A;  1KQ9 A;  2BWU A;  2B3K A;  4IU6 A;  4U70 A;  2EVM A;  2OAZ A;  1XGN A;  1QXZ A;  1BN5 A;  3PKA A;  1WLR A;  4MAT A;  1O0X A;  3FM3 A;  1W7V A;  3L7G A;  2GTX A;  2P99 A;  2GG8 A;  1WN1 A;  1C27 A;  2GG7 A;  2V3Z A;  5JFR A;  4A6V A;  5CDV A;  4IKU A;  2EVC A;  5FCF A;  2BWS A;  2GGC A;  4IEC A;  4S2T P;  2GG3 A;  4U73 A;  4U6W A;  3FMR A;  2GU6 A;  1B59 A;  4U1B A;  2EA4 A;  1XNZ A;  2GG5 A;  4IF7 A;  4ZNG A;  2GG9 A;  4FO7 A;  2BHA A;  4ZWO A;  2BWY A;  4FLL A;  3MX6 A;  4QR8 A;  1QZY A;  4KM3 A;  2Q93 A;  2GG2 A;  3PKC A;  1YW8 A;  1PV9 A;  2GU5 A;  1WBQ A;  3BIQ A;  4ZWU A;  4FLK A;  2GU7 A;  1WKM A;  4JUQ A;  1C24 A;  1Y1N A;  3PKB A;  4FLI A;  4RGZ 1;  5CDL A;  4U6J A;  2NQ7 A;  5CLS A;  2BHD A;  4Z7M A;  4IKR A;  2B3H A;  3D27 A;  4EGE A;  3PKE A;  4RZZ A;  4U69 A;  2B3L A;  4ZWP A;  2P9A A;  1M35 A;  3ROR A;  3IU9 A;  1MAT A;  2BHC A;  2DFI A;  2V3Y A;  2ADU A;  2Q95 A;  4FUK A;  4PNC A;  2GG0 A;  4U76 A;  1XGS A;  5E5B A;  5JI6 A;  1WY2 A;  3Q6D A;  4S01 A;  1XGO A;  2BB7 A;  5CE6 A;  3CB5 A;  2BN7 A;  4B28 A;  1B6A A;  1C22 A;  2BWW A;  2V6C A;  3IG4 A;  2ZSG A;  1XGM A;  1YW7 A;  4IPA A;  5CDE A;  2Q96 A;  1KQ0 A;  2V3X A;  1YVM A;  4U6Z A;  4FO8 A;  1WL9 A;  1YJ3 A;  1YW9 A;  4U6E A;  1QXW A;  2EVO A;  2G6P A;  2IW2 A;  3IU7 A;  4OOK A;  3MAT A;  2MAT A;  3RVA A;  2Q94 A;  3TB5 A;  4A6W A;  1BOA A;  3CTZ A;  4U6C A;  2Q92 A;  4RZY A;  2P98 A;  5FCH A;  5JHU A;  3TAV A;  4S00 A;  2GU4 A;  1R5H A;  4PV4 A;  2BH3 A;  2GZ5 A;  3BIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...