2G6PA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with pyridyl pyrimidine derivative
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Pyridinylpyrimidines as Inhibitors of Human Methionine Aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2g6pA00
2P98A 1W7VA 4ZWOA 2GG5A 3PKDA 2BHDA 4IF7A 3BIPA 5D6FA 2Q8KA 1WL9A 2V6CA 5CDEA 4IKSA 1B59A 2HOWA 4ZNGA 4EGEA 4Z7MA 5CLSA 3CB6A 4FKCA 4S2RP 4U71A 4PNCA 4U73A 2BWVA 1W2MA 3BITA 5JFRA 2B3KA 1A16A 4OOKA 4IDYA 5D6EA 2GTXA 2OKNA 1WL6A 5JI6A 5E5BA 5CNXA 4U6EA 2Q96A 4HXXA 2GU6A 2Q94A 1N51A 3MR1A 2GG3A 1WY2A 2NQ7A 2P9AA 4S2TP 1XGMA 1YW8A 1WLRA 1C24A 1XGSA 2GZ5A 3IU8A 4FO7A 3S6BA 3TB5A 2GU4A 2MATA 4IKTA 4QR8A 3PKBA 2GA2A 1C21A 2BWTA 4U70A 2Q92A 1QZYA 4U6WA 2NQ6A 4U75A 1Y1NA 2Q93A 1R5HA 3BIQA 1KP0A 1MATA 2BWYA 4S01A 4RZZA 2GG7A 1PV9A 2GG0A 4B28A 3PKAA 1CHMA 2GG8A 1M35A 1QXZA 5JHUA 1C23A 2GGCA 2V3ZA 2EVMA 4U6JA 2BWUA 2BWXA 1WN1A 2G6PA 3FM3A 2OAZA 2V3YA 3FMRA 2BB7A 4IKUA 4RGZ1 4RZYA 1YW7A 1C22A 2BWSA 2BN7A 1O0XA 1QXYA 5CDLA 3L7GA 1BOAA 3MX6A 2BH3A 3CTZA 4IPAA 4A6VA 2B3LA 4S00A 2DFIA 2P99A 5CDVA 2B3HA 4JUQA 4U6CA 3RVAA 3TAVA 1WBQA 3MATA 5CIKA 1QXWA 4FLJA 4PV4A 1WKMA 2GU5A 2GG9A 2EVCA 4FUKA 2BHBA 2EVOA 3D27A 4ZWUA 5FCHA 2GU7A 2BWWA 2GGBA 1YW9A 1C27A 3FMQA 1XGOA 2IW2A 4IKRA 4U76A 3RORA 3IU7A 2BHCA 3L24A 1XGNA 1KQ0A 4U69A 5CE6A 1R58A 3CB5A 3IG4A 4A6WA 3IU9A 1JAWA 1B6AA 1R5GA 3PKEA 4KM3A 3Q6DA 4FLIA 3PKCA 2ZSGA 1KQ9A 4FO8A 4MATA 2Q95A 4FLLA 1YJ3A 1XNZA 4U6ZA 1BN5A 4IECA 4IU6A 4U1BA 5FCFA 4ZWPA 2BHAA 1YVMA 2EA2A 2EA4A 2V3XA 4FLKA 2GG2A 2ADUA 4R60A
chains in the Genus database with same CATH superfamily
2P98A 1W7VA 4ZWOA 2GG5A 3PKDA 2BHDA 4IF7A 3BIPA 5D6FA 2Q8KA 1WL9A 2V6CA 5CDEA 4IKSA 1B59A 2HOWA 4ZNGA 4EGEA 4Z7MA 5CLSA 3CB6A 4FKCA 4S2RP 4U71A 4PNCA 4U73A 2BWVA 1W2MA 3BITA 5JFRA 2B3KA 1A16A 4OOKA 4IDYA 5D6EA 2GTXA 2OKNA 1WL6A 5JI6A 5E5BA 5CNXA 4U6EA 2Q96A 4HXXA 2GU6A 2Q94A 1N51A 3MR1A 2GG3A 1WY2A 2NQ7A 2P9AA 4S2TP 1XGMA 1YW8A 1WLRA 1C24A 1XGSA 2GZ5A 3IU8A 4FO7A 3S6BA 3TB5A 2GU4A 2MATA 4IKTA 4QR8A 3PKBA 2GA2A 1C21A 2BWTA 4U70A 2Q92A 1QZYA 4U6WA 2NQ6A 4U75A 1Y1NA 2Q93A 1R5HA 3BIQA 1KP0A 1MATA 2BWYA 4S01A 4RZZA 2GG7A 1PV9A 2GG0A 4B28A 3PKAA 1CHMA 2GG8A 1M35A 1QXZA 5JHUA 1C23A 2GGCA 2V3ZA 2EVMA 4U6JA 2BWUA 2BWXA 1WN1A 2G6PA 3FM3A 2OAZA 2V3YA 3FMRA 2BB7A 4IKUA 4RGZ1 4RZYA 1YW7A 1C22A 2BWSA 2BN7A 1O0XA 1QXYA 5CDLA 3L7GA 1BOAA 3MX6A 2BH3A 3CTZA 4IPAA 4A6VA 2B3LA 4S00A 2DFIA 2P99A 5CDVA 2B3HA 4JUQA 4U6CA 3RVAA 3TAVA 1WBQA 3MATA 5CIKA 1QXWA 4FLJA 4PV4A 1WKMA 2GU5A 2GG9A 2EVCA 4FUKA 2BHBA 2EVOA 3D27A 4ZWUA 5FCHA 2GU7A 2BWWA 2GGBA 1YW9A 1C27A 3FMQA 1XGOA 2IW2A 4IKRA 4U76A 3RORA 3IU7A 2BHCA 3L24A 1XGNA 1KQ0A 4U69A 5CE6A 1R58A 3CB5A 3IG4A 4A6WA 3IU9A 1JAWA 1B6AA 1R5GA 3PKEA 4KM3A 3Q6DA 4FLIA 3PKCA 2ZSGA 1KQ9A 4FO8A 4MATA 2Q95A 4FLLA 1YJ3A 1XNZA 4U6ZA 1BN5A 4IECA 4IU6A 4U1BA 5FCFA 4ZWPA 2BHAA 1YVMA 2EA2A 2EA4A 2V3XA 4FLKA 2GG2A 2ADUA 4R60A
chains in the Genus database with same CATH topology
2P98A 1W7VA 4ZWOA 2GG5A 3PKDA 2BHDA 4IF7A 3BIPA 5D6FA 2Q8KA 1WL9A 2V6CA 5CDEA 4IKSA 1B59A 2HOWA 4ZNGA 4EGEA 4Z7MA 5CLSA 3CB6A 4FKCA 4S2RP 4U71A 4PNCA 4U73A 2BWVA 1W2MA 3BITA 5JFRA 2B3KA 1A16A 4OOKA 4IDYA 5D6EA 2GTXA 2OKNA 1WL6A 5JI6A 5E5BA 5CNXA 4U6EA 2Q96A 4HXXA 2GU6A 2Q94A 1N51A 3MR1A 2GG3A 1WY2A 2NQ7A 2P9AA 4S2TP 1XGMA 1YW8A 1WLRA 1C24A 1XGSA 2GZ5A 3IU8A 4FO7A 3S6BA 3TB5A 2GU4A 2MATA 4IKTA 4QR8A 3PKBA 2GA2A 1C21A 2BWTA 4U70A 2Q92A 1QZYA 4U6WA 2NQ6A 4U75A 1Y1NA 2Q93A 1R5HA 3BIQA 1KP0A 1MATA 2BWYA 4S01A 4RZZA 2GG7A 1PV9A 2GG0A 4B28A 3PKAA 1CHMA 2GG8A 1M35A 1QXZA 5JHUA 1C23A 2GGCA 2V3ZA 2EVMA 4U6JA 2BWUA 2BWXA 1WN1A 2G6PA 3FM3A 2OAZA 2V3YA 3FMRA 2BB7A 4IKUA 4RGZ1 4RZYA 1YW7A 1C22A 2BWSA 2BN7A 1O0XA 1QXYA 5CDLA 3L7GA 1BOAA 3MX6A 2BH3A 3CTZA 4IPAA 4A6VA 2B3LA 4S00A 2DFIA 2P99A 5CDVA 2B3HA 4JUQA 4U6CA 3RVAA 3TAVA 1WBQA 3MATA 5CIKA 1QXWA 4FLJA 4PV4A 1WKMA 2GU5A 2GG9A 2EVCA 4FUKA 2BHBA 2EVOA 3D27A 4ZWUA 5FCHA 2GU7A 2BWWA 2GGBA 1YW9A 1C27A 3FMQA 1XGOA 2IW2A 4IKRA 4U76A 3RORA 3IU7A 2BHCA 3L24A 1XGNA 1KQ0A 4U69A 5CE6A 1R58A 3CB5A 3IG4A 4A6WA 3IU9A 1JAWA 1B6AA 1R5GA 3PKEA 4KM3A 3Q6DA 4FLIA 3PKCA 2ZSGA 1KQ9A 4FO8A 4MATA 2Q95A 4FLLA 1YJ3A 1XNZA 4U6ZA 1BN5A 4IECA 4IU6A 4U1BA 5FCFA 4ZWPA 2BHAA 1YVMA 2EA2A 2EA4A 2V3XA 4FLKA 2GG2A 2ADUA 4R60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P98 A;  1W7V A;  4ZWO A;  2GG5 A;  3PKD A;  2BHD A;  4IF7 A;  3BIP A;  5D6F A;  2Q8K A;  1WL9 A;  2V6C A;  5CDE A;  4IKS A;  1B59 A;  2HOW A;  4ZNG A;  4EGE A;  4Z7M A;  5CLS A;  3CB6 A;  4FKC A;  4S2R P;  4U71 A;  4PNC A;  4U73 A;  2BWV A;  1W2M A;  3BIT A;  5JFR A;  2B3K A;  1A16 A;  4OOK A;  4IDY A;  5D6E A;  2GTX A;  2OKN A;  1WL6 A;  5JI6 A;  5E5B A;  5CNX A;  4U6E A;  2Q96 A;  4HXX A;  2GU6 A;  2Q94 A;  1N51 A;  3MR1 A;  2GG3 A;  1WY2 A;  2NQ7 A;  2P9A A;  4S2T P;  1XGM A;  1YW8 A;  1WLR A;  1C24 A;  1XGS A;  2GZ5 A;  3IU8 A;  4FO7 A;  3S6B A;  3TB5 A;  2GU4 A;  2MAT A;  4IKT A;  4QR8 A;  3PKB A;  2GA2 A;  1C21 A;  2BWT A;  4U70 A;  2Q92 A;  1QZY A;  4U6W A;  2NQ6 A;  4U75 A;  1Y1N A;  2Q93 A;  1R5H A;  3BIQ A;  1KP0 A;  1MAT A;  2BWY A;  4S01 A;  4RZZ A;  2GG7 A;  1PV9 A;  2GG0 A;  4B28 A;  3PKA A;  1CHM A;  2GG8 A;  1M35 A;  1QXZ A;  5JHU A;  1C23 A;  2GGC A;  2V3Z A;  2EVM A;  4U6J A;  2BWU A;  2BWX A;  1WN1 A;  2G6P A;  3FM3 A;  2OAZ A;  2V3Y A;  3FMR A;  2BB7 A;  4IKU A;  4RGZ 1;  4RZY A;  1YW7 A;  1C22 A;  2BWS A;  2BN7 A;  1O0X A;  1QXY A;  5CDL A;  3L7G A;  1BOA A;  3MX6 A;  2BH3 A;  3CTZ A;  4IPA A;  4A6V A;  2B3L A;  4S00 A;  2DFI A;  2P99 A;  5CDV A;  2B3H A;  4JUQ A;  4U6C A;  3RVA A;  3TAV A;  1WBQ A;  3MAT A;  5CIK A;  1QXW A;  4FLJ A;  4PV4 A;  1WKM A;  2GU5 A;  2GG9 A;  2EVC A;  4FUK A;  2BHB A;  2EVO A;  3D27 A;  4ZWU A;  5FCH A;  2GU7 A;  2BWW A;  2GGB A;  1YW9 A;  1C27 A;  3FMQ A;  1XGO A;  2IW2 A;  4IKR A;  4U76 A;  3ROR A;  3IU7 A;  2BHC A;  3L24 A;  1XGN A;  1KQ0 A;  4U69 A;  5CE6 A;  1R58 A;  3CB5 A;  3IG4 A;  4A6W A;  3IU9 A;  1JAW A;  1B6A A;  1R5G A;  3PKE A;  4KM3 A;  3Q6D A;  4FLI A;  3PKC A;  2ZSG A;  1KQ9 A;  4FO8 A;  4MAT A;  2Q95 A;  4FLL A;  1YJ3 A;  1XNZ A;  4U6Z A;  1BN5 A;  4IEC A;  4IU6 A;  4U1B A;  5FCF A;  4ZWP A;  2BHA A;  1YVM A;  2EA2 A;  2EA4 A;  2V3X A;  4FLK A;  2GG2 A;  2ADU A;  4R60 A; 
#chains in the Genus database with same CATH topology
 2P98 A;  1W7V A;  4ZWO A;  2GG5 A;  3PKD A;  2BHD A;  4IF7 A;  3BIP A;  5D6F A;  2Q8K A;  1WL9 A;  2V6C A;  5CDE A;  4IKS A;  1B59 A;  2HOW A;  4ZNG A;  4EGE A;  4Z7M A;  5CLS A;  3CB6 A;  4FKC A;  4S2R P;  4U71 A;  4PNC A;  4U73 A;  2BWV A;  1W2M A;  3BIT A;  5JFR A;  2B3K A;  1A16 A;  4OOK A;  4IDY A;  5D6E A;  2GTX A;  2OKN A;  1WL6 A;  5JI6 A;  5E5B A;  5CNX A;  4U6E A;  2Q96 A;  4HXX A;  2GU6 A;  2Q94 A;  1N51 A;  3MR1 A;  2GG3 A;  1WY2 A;  2NQ7 A;  2P9A A;  4S2T P;  1XGM A;  1YW8 A;  1WLR A;  1C24 A;  1XGS A;  2GZ5 A;  3IU8 A;  4FO7 A;  3S6B A;  3TB5 A;  2GU4 A;  2MAT A;  4IKT A;  4QR8 A;  3PKB A;  2GA2 A;  1C21 A;  2BWT A;  4U70 A;  2Q92 A;  1QZY A;  4U6W A;  2NQ6 A;  4U75 A;  1Y1N A;  2Q93 A;  1R5H A;  3BIQ A;  1KP0 A;  1MAT A;  2BWY A;  4S01 A;  4RZZ A;  2GG7 A;  1PV9 A;  2GG0 A;  4B28 A;  3PKA A;  1CHM A;  2GG8 A;  1M35 A;  1QXZ A;  5JHU A;  1C23 A;  2GGC A;  2V3Z A;  2EVM A;  4U6J A;  2BWU A;  2BWX A;  1WN1 A;  2G6P A;  3FM3 A;  2OAZ A;  2V3Y A;  3FMR A;  2BB7 A;  4IKU A;  4RGZ 1;  4RZY A;  1YW7 A;  1C22 A;  2BWS A;  2BN7 A;  1O0X A;  1QXY A;  5CDL A;  3L7G A;  1BOA A;  3MX6 A;  2BH3 A;  3CTZ A;  4IPA A;  4A6V A;  2B3L A;  4S00 A;  2DFI A;  2P99 A;  5CDV A;  2B3H A;  4JUQ A;  4U6C A;  3RVA A;  3TAV A;  1WBQ A;  3MAT A;  5CIK A;  1QXW A;  4FLJ A;  4PV4 A;  1WKM A;  2GU5 A;  2GG9 A;  2EVC A;  4FUK A;  2BHB A;  2EVO A;  3D27 A;  4ZWU A;  5FCH A;  2GU7 A;  2BWW A;  2GGB A;  1YW9 A;  1C27 A;  3FMQ A;  1XGO A;  2IW2 A;  4IKR A;  4U76 A;  3ROR A;  3IU7 A;  2BHC A;  3L24 A;  1XGN A;  1KQ0 A;  4U69 A;  5CE6 A;  1R58 A;  3CB5 A;  3IG4 A;  4A6W A;  3IU9 A;  1JAW A;  1B6A A;  1R5G A;  3PKE A;  4KM3 A;  3Q6D A;  4FLI A;  3PKC A;  2ZSG A;  1KQ9 A;  4FO8 A;  4MAT A;  2Q95 A;  4FLL A;  1YJ3 A;  1XNZ A;  4U6Z A;  1BN5 A;  4IEC A;  4IU6 A;  4U1B A;  5FCF A;  4ZWP A;  2BHA A;  1YVM A;  2EA2 A;  2EA4 A;  2V3X A;  4FLK A;  2GG2 A;  2ADU A;  4R60 A; 
#chains in the Genus database with same CATH homology
 2P98 A;  1W7V A;  4ZWO A;  2GG5 A;  3PKD A;  2BHD A;  4IF7 A;  3BIP A;  5D6F A;  2Q8K A;  1WL9 A;  2V6C A;  5CDE A;  4IKS A;  1B59 A;  2HOW A;  4ZNG A;  4EGE A;  4Z7M A;  5CLS A;  3CB6 A;  4FKC A;  4S2R P;  4U71 A;  4PNC A;  4U73 A;  2BWV A;  1W2M A;  3BIT A;  5JFR A;  2B3K A;  1A16 A;  4OOK A;  4IDY A;  5D6E A;  2GTX A;  2OKN A;  1WL6 A;  5JI6 A;  5E5B A;  5CNX A;  4U6E A;  2Q96 A;  4HXX A;  2GU6 A;  2Q94 A;  1N51 A;  3MR1 A;  2GG3 A;  1WY2 A;  2NQ7 A;  2P9A A;  4S2T P;  1XGM A;  1YW8 A;  1WLR A;  1C24 A;  1XGS A;  2GZ5 A;  3IU8 A;  4FO7 A;  3S6B A;  3TB5 A;  2GU4 A;  2MAT A;  4IKT A;  4QR8 A;  3PKB A;  2GA2 A;  1C21 A;  2BWT A;  4U70 A;  2Q92 A;  1QZY A;  4U6W A;  2NQ6 A;  4U75 A;  1Y1N A;  2Q93 A;  1R5H A;  3BIQ A;  1KP0 A;  1MAT A;  2BWY A;  4S01 A;  4RZZ A;  2GG7 A;  1PV9 A;  2GG0 A;  4B28 A;  3PKA A;  1CHM A;  2GG8 A;  1M35 A;  1QXZ A;  5JHU A;  1C23 A;  2GGC A;  2V3Z A;  2EVM A;  4U6J A;  2BWU A;  2BWX A;  1WN1 A;  2G6P A;  3FM3 A;  2OAZ A;  2V3Y A;  3FMR A;  2BB7 A;  4IKU A;  4RGZ 1;  4RZY A;  1YW7 A;  1C22 A;  2BWS A;  2BN7 A;  1O0X A;  1QXY A;  5CDL A;  3L7G A;  1BOA A;  3MX6 A;  2BH3 A;  3CTZ A;  4IPA A;  4A6V A;  2B3L A;  4S00 A;  2DFI A;  2P99 A;  5CDV A;  2B3H A;  4JUQ A;  4U6C A;  3RVA A;  3TAV A;  1WBQ A;  3MAT A;  5CIK A;  1QXW A;  4FLJ A;  4PV4 A;  1WKM A;  2GU5 A;  2GG9 A;  2EVC A;  4FUK A;  2BHB A;  2EVO A;  3D27 A;  4ZWU A;  5FCH A;  2GU7 A;  2BWW A;  2GGB A;  1YW9 A;  1C27 A;  3FMQ A;  1XGO A;  2IW2 A;  4IKR A;  4U76 A;  3ROR A;  3IU7 A;  2BHC A;  3L24 A;  1XGN A;  1KQ0 A;  4U69 A;  5CE6 A;  1R58 A;  3CB5 A;  3IG4 A;  4A6W A;  3IU9 A;  1JAW A;  1B6A A;  1R5G A;  3PKE A;  4KM3 A;  3Q6D A;  4FLI A;  3PKC A;  2ZSG A;  1KQ9 A;  4FO8 A;  4MAT A;  2Q95 A;  4FLL A;  1YJ3 A;  1XNZ A;  4U6Z A;  1BN5 A;  4IEC A;  4IU6 A;  4U1B A;  5FCF A;  4ZWP A;  2BHA A;  1YVM A;  2EA2 A;  2EA4 A;  2V3X A;  4FLK A;  2GG2 A;  2ADU A;  4R60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...