2G6PA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with pyridyl pyrimidine derivative
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of Pyridinylpyrimidines as Inhibitors of Human Methionine Aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 98
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2g6pA00
2G6PA 1XGNA 2NQ6A 2BHCA 4FLKA 2B3KA 5E5BA 1R5GA 1C22A 1QZYA 2MATA 2EA4A 2BWYA 2BWWA 2GG2A 2P9AA 3CB5A 1XGMA 2EVMA 4ZWPA 4MATA 4QR8A 2B3LA 4U6WA 1KQ9A 4IDYA 1B59A 4HXXA 3TAVA 4A6VA 1O0XA 2BWTA 4S01A 2BWVA 3PKDA 1BN5A 5JHUA 2GZ5A 1XGSA 1R5HA 4FO7A 4RZZA 2GU7A 2EVOA 3IU8A 1YW8A 2ZSGA 1MATA 1Y1NA 4IKSA 3FM3A 2GG7A 3S6BA 5CE6A 2BH3A 4IU6A 4PV4A 4R60A 4RGZ1 1B6AA 2P99A 2NQ7A 3MATA 2BB7A 2V3ZA 3BIQA 1N51A 1QXYA 4OOKA 2ADUA 2Q92A 4RZYA 4U69A 1WL6A 2B3HA 4S00A 4EGEA 1YW7A 5CDLA 2Q93A 5FCFA 5JI6A 1KQ0A 2IW2A 3CB6A 4U75A 5FCHA 4IKUA 3RVAA 4PNCA 2GG5A 2GTXA 4IF7A 2BHDA 2BWSA 1C23A 4U6EA 3IU7A 2BHBA 3Q6DA 5CDEA 2P98A 1C21A 1A16A 2GU4A 1W7VA 4U76A 4U70A 3BIPA 1WBQA 1W2MA 2BN7A 3IU9A 1WY2A 3PKBA 4FUKA 1YW9A 2Q8KA 2OKNA 1M35A 1WKMA 1WLRA 3PKAA 5D6EA 2V3XA 1WL9A 1PV9A 2GG0A 1R58A 4Z7MA 4IECA 3D27A 4B28A 4JUQA 3FMRA 3PKCA 4ZWOA 1XGOA 3CTZA 4U71A 4IKRA 1JAWA 5CNXA 2BWXA 1CHMA 1QXWA 3BITA 4FLIA 1BOAA 1QXZA 4U6ZA 2Q94A 2EVCA 3MX6A 5CLSA 4U6CA 4FO8A 1C24A 3RORA 4IPAA 3PKEA 1YVMA 2EA2A 3FMQA 4ZWUA 4U1BA 2V3YA 4ZNGA 5JFRA 4S2TP 4A6WA 1YJ3A 5D6FA 2DFIA 1XNZA 2GGCA 2HOWA 3MR1A 5CDVA 3TB5A 2OAZA 2Q96A 2V6CA 2BWUA 4U73A 3IG4A 2GG8A 4U6JA 4IKTA 4FKCA 4KM3A 3L24A 5CIKA 1WN1A 3L7GA 1C27A 4FLLA 4FLJA 2GG9A 2GGBA 2GU6A 2Q95A 2GU5A 4S2RP 1KP0A 2GA2A 2GG3A 2BHAA
chains in the Genus database with same CATH superfamily
2G6PA 1XGNA 2NQ6A 2BHCA 4FLKA 2B3KA 5E5BA 1R5GA 1C22A 1QZYA 2MATA 2EA4A 2BWYA 2BWWA 2GG2A 2P9AA 3CB5A 1XGMA 2EVMA 4ZWPA 4MATA 4QR8A 2B3LA 4U6WA 1KQ9A 4IDYA 1B59A 4HXXA 3TAVA 4A6VA 1O0XA 2BWTA 4S01A 2BWVA 3PKDA 1BN5A 5JHUA 2GZ5A 1XGSA 1R5HA 4FO7A 4RZZA 2GU7A 2EVOA 3IU8A 1YW8A 2ZSGA 1MATA 1Y1NA 4IKSA 3FM3A 2GG7A 3S6BA 5CE6A 2BH3A 4IU6A 4PV4A 4R60A 4RGZ1 1B6AA 2P99A 2NQ7A 3MATA 2BB7A 2V3ZA 3BIQA 1N51A 1QXYA 4OOKA 2ADUA 2Q92A 4RZYA 4U69A 1WL6A 2B3HA 4S00A 4EGEA 1YW7A 5CDLA 2Q93A 5FCFA 5JI6A 1KQ0A 2IW2A 3CB6A 4U75A 5FCHA 4IKUA 3RVAA 4PNCA 2GG5A 2GTXA 4IF7A 2BHDA 2BWSA 1C23A 4U6EA 3IU7A 2BHBA 3Q6DA 5CDEA 2P98A 1C21A 1A16A 2GU4A 1W7VA 4U76A 4U70A 3BIPA 1WBQA 1W2MA 2BN7A 3IU9A 1WY2A 3PKBA 4FUKA 1YW9A 2Q8KA 2OKNA 1M35A 1WKMA 1WLRA 3PKAA 5D6EA 2V3XA 1WL9A 1PV9A 2GG0A 1R58A 4Z7MA 4IECA 3D27A 4B28A 4JUQA 3FMRA 3PKCA 4ZWOA 1XGOA 3CTZA 4U71A 4IKRA 1JAWA 5CNXA 2BWXA 1CHMA 1QXWA 3BITA 4FLIA 1BOAA 1QXZA 4U6ZA 2Q94A 2EVCA 3MX6A 5CLSA 4U6CA 4FO8A 1C24A 3RORA 4IPAA 3PKEA 1YVMA 2EA2A 3FMQA 4ZWUA 4U1BA 2V3YA 4ZNGA 5JFRA 4S2TP 4A6WA 1YJ3A 5D6FA 2DFIA 1XNZA 2GGCA 2HOWA 3MR1A 5CDVA 3TB5A 2OAZA 2Q96A 2V6CA 2BWUA 4U73A 3IG4A 2GG8A 4U6JA 4IKTA 4FKCA 4KM3A 3L24A 5CIKA 1WN1A 3L7GA 1C27A 4FLLA 4FLJA 2GG9A 2GGBA 2GU6A 2Q95A 2GU5A 4S2RP 1KP0A 2GA2A 2GG3A 2BHAA
chains in the Genus database with same CATH topology
2G6PA 1XGNA 2NQ6A 2BHCA 4FLKA 2B3KA 5E5BA 1R5GA 1C22A 1QZYA 2MATA 2EA4A 2BWYA 2BWWA 2GG2A 2P9AA 3CB5A 1XGMA 2EVMA 4ZWPA 4MATA 4QR8A 2B3LA 4U6WA 1KQ9A 4IDYA 1B59A 4HXXA 3TAVA 4A6VA 1O0XA 2BWTA 4S01A 2BWVA 3PKDA 1BN5A 5JHUA 2GZ5A 1XGSA 1R5HA 4FO7A 4RZZA 2GU7A 2EVOA 3IU8A 1YW8A 2ZSGA 1MATA 1Y1NA 4IKSA 3FM3A 2GG7A 3S6BA 5CE6A 2BH3A 4IU6A 4PV4A 4R60A 4RGZ1 1B6AA 2P99A 2NQ7A 3MATA 2BB7A 2V3ZA 3BIQA 1N51A 1QXYA 4OOKA 2ADUA 2Q92A 4RZYA 4U69A 1WL6A 2B3HA 4S00A 4EGEA 1YW7A 5CDLA 2Q93A 5FCFA 5JI6A 1KQ0A 2IW2A 3CB6A 4U75A 5FCHA 4IKUA 3RVAA 4PNCA 2GG5A 2GTXA 4IF7A 2BHDA 2BWSA 1C23A 4U6EA 3IU7A 2BHBA 3Q6DA 5CDEA 2P98A 1C21A 1A16A 2GU4A 1W7VA 4U76A 4U70A 3BIPA 1WBQA 1W2MA 2BN7A 3IU9A 1WY2A 3PKBA 4FUKA 1YW9A 2Q8KA 2OKNA 1M35A 1WKMA 1WLRA 3PKAA 5D6EA 2V3XA 1WL9A 1PV9A 2GG0A 1R58A 4Z7MA 4IECA 3D27A 4B28A 4JUQA 3FMRA 3PKCA 4ZWOA 1XGOA 3CTZA 4U71A 4IKRA 1JAWA 5CNXA 2BWXA 1CHMA 1QXWA 3BITA 4FLIA 1BOAA 1QXZA 4U6ZA 2Q94A 2EVCA 3MX6A 5CLSA 4U6CA 4FO8A 1C24A 3RORA 4IPAA 3PKEA 1YVMA 2EA2A 3FMQA 4ZWUA 4U1BA 2V3YA 4ZNGA 5JFRA 4S2TP 4A6WA 1YJ3A 5D6FA 2DFIA 1XNZA 2GGCA 2HOWA 3MR1A 5CDVA 3TB5A 2OAZA 2Q96A 2V6CA 2BWUA 4U73A 3IG4A 2GG8A 4U6JA 4IKTA 4FKCA 4KM3A 3L24A 5CIKA 1WN1A 3L7GA 1C27A 4FLLA 4FLJA 2GG9A 2GGBA 2GU6A 2Q95A 2GU5A 4S2RP 1KP0A 2GA2A 2GG3A 2BHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6P A;  1XGN A;  2NQ6 A;  2BHC A;  4FLK A;  2B3K A;  5E5B A;  1R5G A;  1C22 A;  1QZY A;  2MAT A;  2EA4 A;  2BWY A;  2BWW A;  2GG2 A;  2P9A A;  3CB5 A;  1XGM A;  2EVM A;  4ZWP A;  4MAT A;  4QR8 A;  2B3L A;  4U6W A;  1KQ9 A;  4IDY A;  1B59 A;  4HXX A;  3TAV A;  4A6V A;  1O0X A;  2BWT A;  4S01 A;  2BWV A;  3PKD A;  1BN5 A;  5JHU A;  2GZ5 A;  1XGS A;  1R5H A;  4FO7 A;  4RZZ A;  2GU7 A;  2EVO A;  3IU8 A;  1YW8 A;  2ZSG A;  1MAT A;  1Y1N A;  4IKS A;  3FM3 A;  2GG7 A;  3S6B A;  5CE6 A;  2BH3 A;  4IU6 A;  4PV4 A;  4R60 A;  4RGZ 1;  1B6A A;  2P99 A;  2NQ7 A;  3MAT A;  2BB7 A;  2V3Z A;  3BIQ A;  1N51 A;  1QXY A;  4OOK A;  2ADU A;  2Q92 A;  4RZY A;  4U69 A;  1WL6 A;  2B3H A;  4S00 A;  4EGE A;  1YW7 A;  5CDL A;  2Q93 A;  5FCF A;  5JI6 A;  1KQ0 A;  2IW2 A;  3CB6 A;  4U75 A;  5FCH A;  4IKU A;  3RVA A;  4PNC A;  2GG5 A;  2GTX A;  4IF7 A;  2BHD A;  2BWS A;  1C23 A;  4U6E A;  3IU7 A;  2BHB A;  3Q6D A;  5CDE A;  2P98 A;  1C21 A;  1A16 A;  2GU4 A;  1W7V A;  4U76 A;  4U70 A;  3BIP A;  1WBQ A;  1W2M A;  2BN7 A;  3IU9 A;  1WY2 A;  3PKB A;  4FUK A;  1YW9 A;  2Q8K A;  2OKN A;  1M35 A;  1WKM A;  1WLR A;  3PKA A;  5D6E A;  2V3X A;  1WL9 A;  1PV9 A;  2GG0 A;  1R58 A;  4Z7M A;  4IEC A;  3D27 A;  4B28 A;  4JUQ A;  3FMR A;  3PKC A;  4ZWO A;  1XGO A;  3CTZ A;  4U71 A;  4IKR A;  1JAW A;  5CNX A;  2BWX A;  1CHM A;  1QXW A;  3BIT A;  4FLI A;  1BOA A;  1QXZ A;  4U6Z A;  2Q94 A;  2EVC A;  3MX6 A;  5CLS A;  4U6C A;  4FO8 A;  1C24 A;  3ROR A;  4IPA A;  3PKE A;  1YVM A;  2EA2 A;  3FMQ A;  4ZWU A;  4U1B A;  2V3Y A;  4ZNG A;  5JFR A;  4S2T P;  4A6W A;  1YJ3 A;  5D6F A;  2DFI A;  1XNZ A;  2GGC A;  2HOW A;  3MR1 A;  5CDV A;  3TB5 A;  2OAZ A;  2Q96 A;  2V6C A;  2BWU A;  4U73 A;  3IG4 A;  2GG8 A;  4U6J A;  4IKT A;  4FKC A;  4KM3 A;  3L24 A;  5CIK A;  1WN1 A;  3L7G A;  1C27 A;  4FLL A;  4FLJ A;  2GG9 A;  2GGB A;  2GU6 A;  2Q95 A;  2GU5 A;  4S2R P;  1KP0 A;  2GA2 A;  2GG3 A;  2BHA A; 
#chains in the Genus database with same CATH topology
 2G6P A;  1XGN A;  2NQ6 A;  2BHC A;  4FLK A;  2B3K A;  5E5B A;  1R5G A;  1C22 A;  1QZY A;  2MAT A;  2EA4 A;  2BWY A;  2BWW A;  2GG2 A;  2P9A A;  3CB5 A;  1XGM A;  2EVM A;  4ZWP A;  4MAT A;  4QR8 A;  2B3L A;  4U6W A;  1KQ9 A;  4IDY A;  1B59 A;  4HXX A;  3TAV A;  4A6V A;  1O0X A;  2BWT A;  4S01 A;  2BWV A;  3PKD A;  1BN5 A;  5JHU A;  2GZ5 A;  1XGS A;  1R5H A;  4FO7 A;  4RZZ A;  2GU7 A;  2EVO A;  3IU8 A;  1YW8 A;  2ZSG A;  1MAT A;  1Y1N A;  4IKS A;  3FM3 A;  2GG7 A;  3S6B A;  5CE6 A;  2BH3 A;  4IU6 A;  4PV4 A;  4R60 A;  4RGZ 1;  1B6A A;  2P99 A;  2NQ7 A;  3MAT A;  2BB7 A;  2V3Z A;  3BIQ A;  1N51 A;  1QXY A;  4OOK A;  2ADU A;  2Q92 A;  4RZY A;  4U69 A;  1WL6 A;  2B3H A;  4S00 A;  4EGE A;  1YW7 A;  5CDL A;  2Q93 A;  5FCF A;  5JI6 A;  1KQ0 A;  2IW2 A;  3CB6 A;  4U75 A;  5FCH A;  4IKU A;  3RVA A;  4PNC A;  2GG5 A;  2GTX A;  4IF7 A;  2BHD A;  2BWS A;  1C23 A;  4U6E A;  3IU7 A;  2BHB A;  3Q6D A;  5CDE A;  2P98 A;  1C21 A;  1A16 A;  2GU4 A;  1W7V A;  4U76 A;  4U70 A;  3BIP A;  1WBQ A;  1W2M A;  2BN7 A;  3IU9 A;  1WY2 A;  3PKB A;  4FUK A;  1YW9 A;  2Q8K A;  2OKN A;  1M35 A;  1WKM A;  1WLR A;  3PKA A;  5D6E A;  2V3X A;  1WL9 A;  1PV9 A;  2GG0 A;  1R58 A;  4Z7M A;  4IEC A;  3D27 A;  4B28 A;  4JUQ A;  3FMR A;  3PKC A;  4ZWO A;  1XGO A;  3CTZ A;  4U71 A;  4IKR A;  1JAW A;  5CNX A;  2BWX A;  1CHM A;  1QXW A;  3BIT A;  4FLI A;  1BOA A;  1QXZ A;  4U6Z A;  2Q94 A;  2EVC A;  3MX6 A;  5CLS A;  4U6C A;  4FO8 A;  1C24 A;  3ROR A;  4IPA A;  3PKE A;  1YVM A;  2EA2 A;  3FMQ A;  4ZWU A;  4U1B A;  2V3Y A;  4ZNG A;  5JFR A;  4S2T P;  4A6W A;  1YJ3 A;  5D6F A;  2DFI A;  1XNZ A;  2GGC A;  2HOW A;  3MR1 A;  5CDV A;  3TB5 A;  2OAZ A;  2Q96 A;  2V6C A;  2BWU A;  4U73 A;  3IG4 A;  2GG8 A;  4U6J A;  4IKT A;  4FKC A;  4KM3 A;  3L24 A;  5CIK A;  1WN1 A;  3L7G A;  1C27 A;  4FLL A;  4FLJ A;  2GG9 A;  2GGB A;  2GU6 A;  2Q95 A;  2GU5 A;  4S2R P;  1KP0 A;  2GA2 A;  2GG3 A;  2BHA A; 
#chains in the Genus database with same CATH homology
 2G6P A;  1XGN A;  2NQ6 A;  2BHC A;  4FLK A;  2B3K A;  5E5B A;  1R5G A;  1C22 A;  1QZY A;  2MAT A;  2EA4 A;  2BWY A;  2BWW A;  2GG2 A;  2P9A A;  3CB5 A;  1XGM A;  2EVM A;  4ZWP A;  4MAT A;  4QR8 A;  2B3L A;  4U6W A;  1KQ9 A;  4IDY A;  1B59 A;  4HXX A;  3TAV A;  4A6V A;  1O0X A;  2BWT A;  4S01 A;  2BWV A;  3PKD A;  1BN5 A;  5JHU A;  2GZ5 A;  1XGS A;  1R5H A;  4FO7 A;  4RZZ A;  2GU7 A;  2EVO A;  3IU8 A;  1YW8 A;  2ZSG A;  1MAT A;  1Y1N A;  4IKS A;  3FM3 A;  2GG7 A;  3S6B A;  5CE6 A;  2BH3 A;  4IU6 A;  4PV4 A;  4R60 A;  4RGZ 1;  1B6A A;  2P99 A;  2NQ7 A;  3MAT A;  2BB7 A;  2V3Z A;  3BIQ A;  1N51 A;  1QXY A;  4OOK A;  2ADU A;  2Q92 A;  4RZY A;  4U69 A;  1WL6 A;  2B3H A;  4S00 A;  4EGE A;  1YW7 A;  5CDL A;  2Q93 A;  5FCF A;  5JI6 A;  1KQ0 A;  2IW2 A;  3CB6 A;  4U75 A;  5FCH A;  4IKU A;  3RVA A;  4PNC A;  2GG5 A;  2GTX A;  4IF7 A;  2BHD A;  2BWS A;  1C23 A;  4U6E A;  3IU7 A;  2BHB A;  3Q6D A;  5CDE A;  2P98 A;  1C21 A;  1A16 A;  2GU4 A;  1W7V A;  4U76 A;  4U70 A;  3BIP A;  1WBQ A;  1W2M A;  2BN7 A;  3IU9 A;  1WY2 A;  3PKB A;  4FUK A;  1YW9 A;  2Q8K A;  2OKN A;  1M35 A;  1WKM A;  1WLR A;  3PKA A;  5D6E A;  2V3X A;  1WL9 A;  1PV9 A;  2GG0 A;  1R58 A;  4Z7M A;  4IEC A;  3D27 A;  4B28 A;  4JUQ A;  3FMR A;  3PKC A;  4ZWO A;  1XGO A;  3CTZ A;  4U71 A;  4IKR A;  1JAW A;  5CNX A;  2BWX A;  1CHM A;  1QXW A;  3BIT A;  4FLI A;  1BOA A;  1QXZ A;  4U6Z A;  2Q94 A;  2EVC A;  3MX6 A;  5CLS A;  4U6C A;  4FO8 A;  1C24 A;  3ROR A;  4IPA A;  3PKE A;  1YVM A;  2EA2 A;  3FMQ A;  4ZWU A;  4U1B A;  2V3Y A;  4ZNG A;  5JFR A;  4S2T P;  4A6W A;  1YJ3 A;  5D6F A;  2DFI A;  1XNZ A;  2GGC A;  2HOW A;  3MR1 A;  5CDV A;  3TB5 A;  2OAZ A;  2Q96 A;  2V6C A;  2BWU A;  4U73 A;  3IG4 A;  2GG8 A;  4U6J A;  4IKT A;  4FKC A;  4KM3 A;  3L24 A;  5CIK A;  1WN1 A;  3L7G A;  1C27 A;  4FLL A;  4FLJ A;  2GG9 A;  2GGB A;  2GU6 A;  2Q95 A;  2GU5 A;  4S2R P;  1KP0 A;  2GA2 A;  2GG3 A;  2BHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...