4U75A

Hsmetap (f309m) in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u75A00
1W7VA 2BWXA 3FMRA 4OOKA 2Q92A 4PV4A 4ZWOA 1B6AA 2GU4A 4IECA 3RVAA 2BHBA 3IU9A 2GTXA 1M35A 2EA2A 2NQ7A 3L7GA 1YW7A 5CNXA 4S00A 5CDLA 2HOWA 5CDVA 3TB5A 5FCHA 3BIQA 2B3HA 1WBQA 1C22A 2BWVA 4U69A 2V3YA 1W2MA 2P99A 3IG4A 4KM3A 2GG0A 3MATA 5JI6A 2B3LA 2Q96A 1CHMA 4ZWPA 1C27A 4ZNGA 2EA4A 1KP0A 4JUQA 4R60A 3FM3A 2Q94A 4IPAA 1C21A 2GU7A 3TAVA 5JHUA 2GG5A 3IU8A 4RZYA 2BWTA 2BWSA 4U75A 2Q95A 1JAWA 1B59A 3BITA 3MR1A 5D6EA 1KQ9A 4RGZ1 1WY2A 4A6VA 1WL9A 4U76A 4U6CA 3PKEA 2MATA 1C23A 2BHAA 2EVMA 2V3XA 3CB5A 5CLSA 1WKMA 4FLKA 4FLLA 3PKBA 1N51A 1R5GA 4U1BA 4U6WA 1R58A 2Q8KA 3Q6DA 1O0XA 1WLRA 3S6BA 4A6WA 2P9AA 3CTZA 1A16A 2EVCA 1R5HA 1QXWA 1QZYA 3IU7A 3PKCA 2BWWA 2GGCA 3RORA 1WN1A 2V3ZA 2GG3A 1KQ0A 2P98A 4IKUA 2Q93A 2BHCA 1Y1NA 4IKSA 4QR8A 2BN7A 1XGNA 4FO7A 2GG8A 2BH3A 5JFRA 4EGEA 2GU6A 4FUKA 2DFIA 4IKTA 4IU6A 1YJ3A 1C24A 2GG7A 4IF7A 4FKCA 4FO8A 2V6CA 1XNZA 2GU5A 3CB6A 4S2RP 2GG9A 3BIPA 1PV9A 4FLIA 4MATA 2G6PA 2B3KA 4FLJA 2BHDA 4RZZA 1MATA 2EVOA 4Z7MA 1QXZA 2NQ6A 5D6FA 3PKAA 4IDYA 5CDEA 1XGSA 2GA2A 1YW8A 1WL6A 1XGOA 4IKRA 5E5BA 5CE6A 2OAZA 2ZSGA 4ZWUA 1YVMA 3D27A 4B28A 2BWYA 2BWUA 2GZ5A 2GGBA 2OKNA 2BB7A 2ADUA 4U73A 1YW9A 4U6EA 3FMQA 4S01A 4U70A 4U71A 1BN5A 1QXYA 4S2TP 3MX6A 2GG2A 4PNCA 4U6ZA 1BOAA 5CIKA 4HXXA 2IW2A 1XGMA 3PKDA 5FCFA 3L24A 4U6JA
chains in the Genus database with same CATH superfamily
1W7VA 2BWXA 3FMRA 4OOKA 2Q92A 4PV4A 4ZWOA 1B6AA 2GU4A 4IECA 3RVAA 2BHBA 3IU9A 2GTXA 1M35A 2EA2A 2NQ7A 3L7GA 1YW7A 5CNXA 4S00A 5CDLA 2HOWA 5CDVA 3TB5A 5FCHA 3BIQA 2B3HA 1WBQA 1C22A 2BWVA 4U69A 2V3YA 1W2MA 2P99A 3IG4A 4KM3A 2GG0A 3MATA 5JI6A 2B3LA 2Q96A 1CHMA 4ZWPA 1C27A 4ZNGA 2EA4A 1KP0A 4JUQA 4R60A 3FM3A 2Q94A 4IPAA 1C21A 2GU7A 3TAVA 5JHUA 2GG5A 3IU8A 4RZYA 2BWTA 2BWSA 4U75A 2Q95A 1JAWA 1B59A 3BITA 3MR1A 5D6EA 1KQ9A 4RGZ1 1WY2A 4A6VA 1WL9A 4U76A 4U6CA 3PKEA 2MATA 1C23A 2BHAA 2EVMA 2V3XA 3CB5A 5CLSA 1WKMA 4FLKA 4FLLA 3PKBA 1N51A 1R5GA 4U1BA 4U6WA 1R58A 2Q8KA 3Q6DA 1O0XA 1WLRA 3S6BA 4A6WA 2P9AA 3CTZA 1A16A 2EVCA 1R5HA 1QXWA 1QZYA 3IU7A 3PKCA 2BWWA 2GGCA 3RORA 1WN1A 2V3ZA 2GG3A 1KQ0A 2P98A 4IKUA 2Q93A 2BHCA 1Y1NA 4IKSA 4QR8A 2BN7A 1XGNA 4FO7A 2GG8A 2BH3A 5JFRA 4EGEA 2GU6A 4FUKA 2DFIA 4IKTA 4IU6A 1YJ3A 1C24A 2GG7A 4IF7A 4FKCA 4FO8A 2V6CA 1XNZA 2GU5A 3CB6A 4S2RP 2GG9A 3BIPA 1PV9A 4FLIA 4MATA 2G6PA 2B3KA 4FLJA 2BHDA 4RZZA 1MATA 2EVOA 4Z7MA 1QXZA 2NQ6A 5D6FA 3PKAA 4IDYA 5CDEA 1XGSA 2GA2A 1YW8A 1WL6A 1XGOA 4IKRA 5E5BA 5CE6A 2OAZA 2ZSGA 4ZWUA 1YVMA 3D27A 4B28A 2BWYA 2BWUA 2GZ5A 2GGBA 2OKNA 2BB7A 2ADUA 4U73A 1YW9A 4U6EA 3FMQA 4S01A 4U70A 4U71A 1BN5A 1QXYA 4S2TP 3MX6A 2GG2A 4PNCA 4U6ZA 1BOAA 5CIKA 4HXXA 2IW2A 1XGMA 3PKDA 5FCFA 3L24A 4U6JA
chains in the Genus database with same CATH topology
1W7VA 2BWXA 3FMRA 4OOKA 2Q92A 4PV4A 4ZWOA 1B6AA 2GU4A 4IECA 3RVAA 2BHBA 3IU9A 2GTXA 1M35A 2EA2A 2NQ7A 3L7GA 1YW7A 5CNXA 4S00A 5CDLA 2HOWA 5CDVA 3TB5A 5FCHA 3BIQA 2B3HA 1WBQA 1C22A 2BWVA 4U69A 2V3YA 1W2MA 2P99A 3IG4A 4KM3A 2GG0A 3MATA 5JI6A 2B3LA 2Q96A 1CHMA 4ZWPA 1C27A 4ZNGA 2EA4A 1KP0A 4JUQA 4R60A 3FM3A 2Q94A 4IPAA 1C21A 2GU7A 3TAVA 5JHUA 2GG5A 3IU8A 4RZYA 2BWTA 2BWSA 4U75A 2Q95A 1JAWA 1B59A 3BITA 3MR1A 5D6EA 1KQ9A 4RGZ1 1WY2A 4A6VA 1WL9A 4U76A 4U6CA 3PKEA 2MATA 1C23A 2BHAA 2EVMA 2V3XA 3CB5A 5CLSA 1WKMA 4FLKA 4FLLA 3PKBA 1N51A 1R5GA 4U1BA 4U6WA 1R58A 2Q8KA 3Q6DA 1O0XA 1WLRA 3S6BA 4A6WA 2P9AA 3CTZA 1A16A 2EVCA 1R5HA 1QXWA 1QZYA 3IU7A 3PKCA 2BWWA 2GGCA 3RORA 1WN1A 2V3ZA 2GG3A 1KQ0A 2P98A 4IKUA 2Q93A 2BHCA 1Y1NA 4IKSA 4QR8A 2BN7A 1XGNA 4FO7A 2GG8A 2BH3A 5JFRA 4EGEA 2GU6A 4FUKA 2DFIA 4IKTA 4IU6A 1YJ3A 1C24A 2GG7A 4IF7A 4FKCA 4FO8A 2V6CA 1XNZA 2GU5A 3CB6A 4S2RP 2GG9A 3BIPA 1PV9A 4FLIA 4MATA 2G6PA 2B3KA 4FLJA 2BHDA 4RZZA 1MATA 2EVOA 4Z7MA 1QXZA 2NQ6A 5D6FA 3PKAA 4IDYA 5CDEA 1XGSA 2GA2A 1YW8A 1WL6A 1XGOA 4IKRA 5E5BA 5CE6A 2OAZA 2ZSGA 4ZWUA 1YVMA 3D27A 4B28A 2BWYA 2BWUA 2GZ5A 2GGBA 2OKNA 2BB7A 2ADUA 4U73A 1YW9A 4U6EA 3FMQA 4S01A 4U70A 4U71A 1BN5A 1QXYA 4S2TP 3MX6A 2GG2A 4PNCA 4U6ZA 1BOAA 5CIKA 4HXXA 2IW2A 1XGMA 3PKDA 5FCFA 3L24A 4U6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7V A;  2BWX A;  3FMR A;  4OOK A;  2Q92 A;  4PV4 A;  4ZWO A;  1B6A A;  2GU4 A;  4IEC A;  3RVA A;  2BHB A;  3IU9 A;  2GTX A;  1M35 A;  2EA2 A;  2NQ7 A;  3L7G A;  1YW7 A;  5CNX A;  4S00 A;  5CDL A;  2HOW A;  5CDV A;  3TB5 A;  5FCH A;  3BIQ A;  2B3H A;  1WBQ A;  1C22 A;  2BWV A;  4U69 A;  2V3Y A;  1W2M A;  2P99 A;  3IG4 A;  4KM3 A;  2GG0 A;  3MAT A;  5JI6 A;  2B3L A;  2Q96 A;  1CHM A;  4ZWP A;  1C27 A;  4ZNG A;  2EA4 A;  1KP0 A;  4JUQ A;  4R60 A;  3FM3 A;  2Q94 A;  4IPA A;  1C21 A;  2GU7 A;  3TAV A;  5JHU A;  2GG5 A;  3IU8 A;  4RZY A;  2BWT A;  2BWS A;  4U75 A;  2Q95 A;  1JAW A;  1B59 A;  3BIT A;  3MR1 A;  5D6E A;  1KQ9 A;  4RGZ 1;  1WY2 A;  4A6V A;  1WL9 A;  4U76 A;  4U6C A;  3PKE A;  2MAT A;  1C23 A;  2BHA A;  2EVM A;  2V3X A;  3CB5 A;  5CLS A;  1WKM A;  4FLK A;  4FLL A;  3PKB A;  1N51 A;  1R5G A;  4U1B A;  4U6W A;  1R58 A;  2Q8K A;  3Q6D A;  1O0X A;  1WLR A;  3S6B A;  4A6W A;  2P9A A;  3CTZ A;  1A16 A;  2EVC A;  1R5H A;  1QXW A;  1QZY A;  3IU7 A;  3PKC A;  2BWW A;  2GGC A;  3ROR A;  1WN1 A;  2V3Z A;  2GG3 A;  1KQ0 A;  2P98 A;  4IKU A;  2Q93 A;  2BHC A;  1Y1N A;  4IKS A;  4QR8 A;  2BN7 A;  1XGN A;  4FO7 A;  2GG8 A;  2BH3 A;  5JFR A;  4EGE A;  2GU6 A;  4FUK A;  2DFI A;  4IKT A;  4IU6 A;  1YJ3 A;  1C24 A;  2GG7 A;  4IF7 A;  4FKC A;  4FO8 A;  2V6C A;  1XNZ A;  2GU5 A;  3CB6 A;  4S2R P;  2GG9 A;  3BIP A;  1PV9 A;  4FLI A;  4MAT A;  2G6P A;  2B3K A;  4FLJ A;  2BHD A;  4RZZ A;  1MAT A;  2EVO A;  4Z7M A;  1QXZ A;  2NQ6 A;  5D6F A;  3PKA A;  4IDY A;  5CDE A;  1XGS A;  2GA2 A;  1YW8 A;  1WL6 A;  1XGO A;  4IKR A;  5E5B A;  5CE6 A;  2OAZ A;  2ZSG A;  4ZWU A;  1YVM A;  3D27 A;  4B28 A;  2BWY A;  2BWU A;  2GZ5 A;  2GGB A;  2OKN A;  2BB7 A;  2ADU A;  4U73 A;  1YW9 A;  4U6E A;  3FMQ A;  4S01 A;  4U70 A;  4U71 A;  1BN5 A;  1QXY A;  4S2T P;  3MX6 A;  2GG2 A;  4PNC A;  4U6Z A;  1BOA A;  5CIK A;  4HXX A;  2IW2 A;  1XGM A;  3PKD A;  5FCF A;  3L24 A;  4U6J A; 
#chains in the Genus database with same CATH topology
 1W7V A;  2BWX A;  3FMR A;  4OOK A;  2Q92 A;  4PV4 A;  4ZWO A;  1B6A A;  2GU4 A;  4IEC A;  3RVA A;  2BHB A;  3IU9 A;  2GTX A;  1M35 A;  2EA2 A;  2NQ7 A;  3L7G A;  1YW7 A;  5CNX A;  4S00 A;  5CDL A;  2HOW A;  5CDV A;  3TB5 A;  5FCH A;  3BIQ A;  2B3H A;  1WBQ A;  1C22 A;  2BWV A;  4U69 A;  2V3Y A;  1W2M A;  2P99 A;  3IG4 A;  4KM3 A;  2GG0 A;  3MAT A;  5JI6 A;  2B3L A;  2Q96 A;  1CHM A;  4ZWP A;  1C27 A;  4ZNG A;  2EA4 A;  1KP0 A;  4JUQ A;  4R60 A;  3FM3 A;  2Q94 A;  4IPA A;  1C21 A;  2GU7 A;  3TAV A;  5JHU A;  2GG5 A;  3IU8 A;  4RZY A;  2BWT A;  2BWS A;  4U75 A;  2Q95 A;  1JAW A;  1B59 A;  3BIT A;  3MR1 A;  5D6E A;  1KQ9 A;  4RGZ 1;  1WY2 A;  4A6V A;  1WL9 A;  4U76 A;  4U6C A;  3PKE A;  2MAT A;  1C23 A;  2BHA A;  2EVM A;  2V3X A;  3CB5 A;  5CLS A;  1WKM A;  4FLK A;  4FLL A;  3PKB A;  1N51 A;  1R5G A;  4U1B A;  4U6W A;  1R58 A;  2Q8K A;  3Q6D A;  1O0X A;  1WLR A;  3S6B A;  4A6W A;  2P9A A;  3CTZ A;  1A16 A;  2EVC A;  1R5H A;  1QXW A;  1QZY A;  3IU7 A;  3PKC A;  2BWW A;  2GGC A;  3ROR A;  1WN1 A;  2V3Z A;  2GG3 A;  1KQ0 A;  2P98 A;  4IKU A;  2Q93 A;  2BHC A;  1Y1N A;  4IKS A;  4QR8 A;  2BN7 A;  1XGN A;  4FO7 A;  2GG8 A;  2BH3 A;  5JFR A;  4EGE A;  2GU6 A;  4FUK A;  2DFI A;  4IKT A;  4IU6 A;  1YJ3 A;  1C24 A;  2GG7 A;  4IF7 A;  4FKC A;  4FO8 A;  2V6C A;  1XNZ A;  2GU5 A;  3CB6 A;  4S2R P;  2GG9 A;  3BIP A;  1PV9 A;  4FLI A;  4MAT A;  2G6P A;  2B3K A;  4FLJ A;  2BHD A;  4RZZ A;  1MAT A;  2EVO A;  4Z7M A;  1QXZ A;  2NQ6 A;  5D6F A;  3PKA A;  4IDY A;  5CDE A;  1XGS A;  2GA2 A;  1YW8 A;  1WL6 A;  1XGO A;  4IKR A;  5E5B A;  5CE6 A;  2OAZ A;  2ZSG A;  4ZWU A;  1YVM A;  3D27 A;  4B28 A;  2BWY A;  2BWU A;  2GZ5 A;  2GGB A;  2OKN A;  2BB7 A;  2ADU A;  4U73 A;  1YW9 A;  4U6E A;  3FMQ A;  4S01 A;  4U70 A;  4U71 A;  1BN5 A;  1QXY A;  4S2T P;  3MX6 A;  2GG2 A;  4PNC A;  4U6Z A;  1BOA A;  5CIK A;  4HXX A;  2IW2 A;  1XGM A;  3PKD A;  5FCF A;  3L24 A;  4U6J A; 
#chains in the Genus database with same CATH homology
 1W7V A;  2BWX A;  3FMR A;  4OOK A;  2Q92 A;  4PV4 A;  4ZWO A;  1B6A A;  2GU4 A;  4IEC A;  3RVA A;  2BHB A;  3IU9 A;  2GTX A;  1M35 A;  2EA2 A;  2NQ7 A;  3L7G A;  1YW7 A;  5CNX A;  4S00 A;  5CDL A;  2HOW A;  5CDV A;  3TB5 A;  5FCH A;  3BIQ A;  2B3H A;  1WBQ A;  1C22 A;  2BWV A;  4U69 A;  2V3Y A;  1W2M A;  2P99 A;  3IG4 A;  4KM3 A;  2GG0 A;  3MAT A;  5JI6 A;  2B3L A;  2Q96 A;  1CHM A;  4ZWP A;  1C27 A;  4ZNG A;  2EA4 A;  1KP0 A;  4JUQ A;  4R60 A;  3FM3 A;  2Q94 A;  4IPA A;  1C21 A;  2GU7 A;  3TAV A;  5JHU A;  2GG5 A;  3IU8 A;  4RZY A;  2BWT A;  2BWS A;  4U75 A;  2Q95 A;  1JAW A;  1B59 A;  3BIT A;  3MR1 A;  5D6E A;  1KQ9 A;  4RGZ 1;  1WY2 A;  4A6V A;  1WL9 A;  4U76 A;  4U6C A;  3PKE A;  2MAT A;  1C23 A;  2BHA A;  2EVM A;  2V3X A;  3CB5 A;  5CLS A;  1WKM A;  4FLK A;  4FLL A;  3PKB A;  1N51 A;  1R5G A;  4U1B A;  4U6W A;  1R58 A;  2Q8K A;  3Q6D A;  1O0X A;  1WLR A;  3S6B A;  4A6W A;  2P9A A;  3CTZ A;  1A16 A;  2EVC A;  1R5H A;  1QXW A;  1QZY A;  3IU7 A;  3PKC A;  2BWW A;  2GGC A;  3ROR A;  1WN1 A;  2V3Z A;  2GG3 A;  1KQ0 A;  2P98 A;  4IKU A;  2Q93 A;  2BHC A;  1Y1N A;  4IKS A;  4QR8 A;  2BN7 A;  1XGN A;  4FO7 A;  2GG8 A;  2BH3 A;  5JFR A;  4EGE A;  2GU6 A;  4FUK A;  2DFI A;  4IKT A;  4IU6 A;  1YJ3 A;  1C24 A;  2GG7 A;  4IF7 A;  4FKC A;  4FO8 A;  2V6C A;  1XNZ A;  2GU5 A;  3CB6 A;  4S2R P;  2GG9 A;  3BIP A;  1PV9 A;  4FLI A;  4MAT A;  2G6P A;  2B3K A;  4FLJ A;  2BHD A;  4RZZ A;  1MAT A;  2EVO A;  4Z7M A;  1QXZ A;  2NQ6 A;  5D6F A;  3PKA A;  4IDY A;  5CDE A;  1XGS A;  2GA2 A;  1YW8 A;  1WL6 A;  1XGO A;  4IKR A;  5E5B A;  5CE6 A;  2OAZ A;  2ZSG A;  4ZWU A;  1YVM A;  3D27 A;  4B28 A;  2BWY A;  2BWU A;  2GZ5 A;  2GGB A;  2OKN A;  2BB7 A;  2ADU A;  4U73 A;  1YW9 A;  4U6E A;  3FMQ A;  4S01 A;  4U70 A;  4U71 A;  1BN5 A;  1QXY A;  4S2T P;  3MX6 A;  2GG2 A;  4PNC A;  4U6Z A;  1BOA A;  5CIK A;  4HXX A;  2IW2 A;  1XGM A;  3PKD A;  5FCF A;  3L24 A;  4U6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...