4U75A

Hsmetap (f309m) in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u75A00
2GG5A 4FKCA 4KM3A 1C21A 2NQ6A 4R60A 1R5GA 2EVMA 1B59A 1KP0A 2EA4A 2GGCA 3S6BA 1YVMA 2Q94A 4U73A 1C27A 1YW8A 2V3YA 1XGNA 1W7VA 3L24A 4RGZ1 2MATA 3CB6A 4Z7MA 2BWYA 1WL9A 2GTXA 2GG7A 5CLSA 2V6CA 4IF7A 2BWTA 2V3XA 3BIPA 4OOKA 2GU7A 4FLKA 2BWSA 1N51A 3FM3A 3TAVA 1Y1NA 2BHBA 2BWVA 3FMQA 5CDVA 4U69A 4U76A 4IKUA 4U75A 2EVOA 2B3HA 4HXXA 1BOAA 4RZYA 5CDLA 2EVCA 4S2TP 4B28A 4IU6A 5JFRA 4RZZA 1WLRA 1W2MA 3CTZA 2GG0A 4IKTA 2BHCA 4EGEA 3MATA 3MR1A 4A6WA 2IW2A 1C24A 2Q96A 2Q92A 2P9AA 1PV9A 1MATA 2BWWA 5E5BA 3BIQA 1QXYA 2B3KA 5JI6A 3MX6A 2Q93A 2HOWA 2ADUA 1YW9A 3PKAA 2GU5A 1O0XA 4FUKA 4S00A 1KQ0A 4ZWOA 2GG3A 1WL6A 5CDEA 4U6ZA 1QXWA 1WY2A 3PKBA 4JUQA 3IG4A 4ZWUA 4S01A 5CNXA 4U1BA 4PNCA 1B6AA 2GU4A 3L7GA 2BH3A 3RORA 3PKEA 4FLJA 4QR8A 1M35A 2GZ5A 4IDYA 2OAZA 1KQ9A 3IU8A 5CIKA 1CHMA 2OKNA 4MATA 2GA2A 2P98A 2BB7A 1XGOA 2G6PA 3IU9A 4U6EA 2BHDA 2Q8KA 2ZSGA 2Q95A 3TB5A 5FCHA 1QZYA 1A16A 4FLIA 1XGSA 4U71A 1WKMA 1WBQA 3Q6DA 4IKSA 2DFIA 2BWXA 4PV4A 2V3ZA 4ZWPA 1QXZA 2GU6A 3D27A 4S2RP 5CE6A 4FO8A 1JAWA 5D6EA 1C22A 4IECA 4U6JA 5FCFA 1XGMA 1YJ3A 2GG8A 2GGBA 4FO7A 1R58A 4ZNGA 1WN1A 4U70A 1XNZA 2BN7A 1BN5A 2EA2A 2BHAA 3IU7A 1R5HA 3FMRA 5D6FA 3CB5A 2P99A 4U6CA 1YW7A 4A6VA 1C23A 3PKCA 2B3LA 3BITA 2GG2A 2NQ7A 2BWUA 4IKRA 3RVAA 4IPAA 4U6WA 3PKDA 2GG9A 4FLLA 5JHUA
chains in the Genus database with same CATH superfamily
2GG5A 4FKCA 4KM3A 1C21A 2NQ6A 4R60A 1R5GA 2EVMA 1B59A 1KP0A 2EA4A 2GGCA 3S6BA 1YVMA 2Q94A 4U73A 1C27A 1YW8A 2V3YA 1XGNA 1W7VA 3L24A 4RGZ1 2MATA 3CB6A 4Z7MA 2BWYA 1WL9A 2GTXA 2GG7A 5CLSA 2V6CA 4IF7A 2BWTA 2V3XA 3BIPA 4OOKA 2GU7A 4FLKA 2BWSA 1N51A 3FM3A 3TAVA 1Y1NA 2BHBA 2BWVA 3FMQA 5CDVA 4U69A 4U76A 4IKUA 4U75A 2EVOA 2B3HA 4HXXA 1BOAA 4RZYA 5CDLA 2EVCA 4S2TP 4B28A 4IU6A 5JFRA 4RZZA 1WLRA 1W2MA 3CTZA 2GG0A 4IKTA 2BHCA 4EGEA 3MATA 3MR1A 4A6WA 2IW2A 1C24A 2Q96A 2Q92A 2P9AA 1PV9A 1MATA 2BWWA 5E5BA 3BIQA 1QXYA 2B3KA 5JI6A 3MX6A 2Q93A 2HOWA 2ADUA 1YW9A 3PKAA 2GU5A 1O0XA 4FUKA 4S00A 1KQ0A 4ZWOA 2GG3A 1WL6A 5CDEA 4U6ZA 1QXWA 1WY2A 3PKBA 4JUQA 3IG4A 4ZWUA 4S01A 5CNXA 4U1BA 4PNCA 1B6AA 2GU4A 3L7GA 2BH3A 3RORA 3PKEA 4FLJA 4QR8A 1M35A 2GZ5A 4IDYA 2OAZA 1KQ9A 3IU8A 5CIKA 1CHMA 2OKNA 4MATA 2GA2A 2P98A 2BB7A 1XGOA 2G6PA 3IU9A 4U6EA 2BHDA 2Q8KA 2ZSGA 2Q95A 3TB5A 5FCHA 1QZYA 1A16A 4FLIA 1XGSA 4U71A 1WKMA 1WBQA 3Q6DA 4IKSA 2DFIA 2BWXA 4PV4A 2V3ZA 4ZWPA 1QXZA 2GU6A 3D27A 4S2RP 5CE6A 4FO8A 1JAWA 5D6EA 1C22A 4IECA 4U6JA 5FCFA 1XGMA 1YJ3A 2GG8A 2GGBA 4FO7A 1R58A 4ZNGA 1WN1A 4U70A 1XNZA 2BN7A 1BN5A 2EA2A 2BHAA 3IU7A 1R5HA 3FMRA 5D6FA 3CB5A 2P99A 4U6CA 1YW7A 4A6VA 1C23A 3PKCA 2B3LA 3BITA 2GG2A 2NQ7A 2BWUA 4IKRA 3RVAA 4IPAA 4U6WA 3PKDA 2GG9A 4FLLA 5JHUA
chains in the Genus database with same CATH topology
2GG5A 4FKCA 4KM3A 1C21A 2NQ6A 4R60A 1R5GA 2EVMA 1B59A 1KP0A 2EA4A 2GGCA 3S6BA 1YVMA 2Q94A 4U73A 1C27A 1YW8A 2V3YA 1XGNA 1W7VA 3L24A 4RGZ1 2MATA 3CB6A 4Z7MA 2BWYA 1WL9A 2GTXA 2GG7A 5CLSA 2V6CA 4IF7A 2BWTA 2V3XA 3BIPA 4OOKA 2GU7A 4FLKA 2BWSA 1N51A 3FM3A 3TAVA 1Y1NA 2BHBA 2BWVA 3FMQA 5CDVA 4U69A 4U76A 4IKUA 4U75A 2EVOA 2B3HA 4HXXA 1BOAA 4RZYA 5CDLA 2EVCA 4S2TP 4B28A 4IU6A 5JFRA 4RZZA 1WLRA 1W2MA 3CTZA 2GG0A 4IKTA 2BHCA 4EGEA 3MATA 3MR1A 4A6WA 2IW2A 1C24A 2Q96A 2Q92A 2P9AA 1PV9A 1MATA 2BWWA 5E5BA 3BIQA 1QXYA 2B3KA 5JI6A 3MX6A 2Q93A 2HOWA 2ADUA 1YW9A 3PKAA 2GU5A 1O0XA 4FUKA 4S00A 1KQ0A 4ZWOA 2GG3A 1WL6A 5CDEA 4U6ZA 1QXWA 1WY2A 3PKBA 4JUQA 3IG4A 4ZWUA 4S01A 5CNXA 4U1BA 4PNCA 1B6AA 2GU4A 3L7GA 2BH3A 3RORA 3PKEA 4FLJA 4QR8A 1M35A 2GZ5A 4IDYA 2OAZA 1KQ9A 3IU8A 5CIKA 1CHMA 2OKNA 4MATA 2GA2A 2P98A 2BB7A 1XGOA 2G6PA 3IU9A 4U6EA 2BHDA 2Q8KA 2ZSGA 2Q95A 3TB5A 5FCHA 1QZYA 1A16A 4FLIA 1XGSA 4U71A 1WKMA 1WBQA 3Q6DA 4IKSA 2DFIA 2BWXA 4PV4A 2V3ZA 4ZWPA 1QXZA 2GU6A 3D27A 4S2RP 5CE6A 4FO8A 1JAWA 5D6EA 1C22A 4IECA 4U6JA 5FCFA 1XGMA 1YJ3A 2GG8A 2GGBA 4FO7A 1R58A 4ZNGA 1WN1A 4U70A 1XNZA 2BN7A 1BN5A 2EA2A 2BHAA 3IU7A 1R5HA 3FMRA 5D6FA 3CB5A 2P99A 4U6CA 1YW7A 4A6VA 1C23A 3PKCA 2B3LA 3BITA 2GG2A 2NQ7A 2BWUA 4IKRA 3RVAA 4IPAA 4U6WA 3PKDA 2GG9A 4FLLA 5JHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG5 A;  4FKC A;  4KM3 A;  1C21 A;  2NQ6 A;  4R60 A;  1R5G A;  2EVM A;  1B59 A;  1KP0 A;  2EA4 A;  2GGC A;  3S6B A;  1YVM A;  2Q94 A;  4U73 A;  1C27 A;  1YW8 A;  2V3Y A;  1XGN A;  1W7V A;  3L24 A;  4RGZ 1;  2MAT A;  3CB6 A;  4Z7M A;  2BWY A;  1WL9 A;  2GTX A;  2GG7 A;  5CLS A;  2V6C A;  4IF7 A;  2BWT A;  2V3X A;  3BIP A;  4OOK A;  2GU7 A;  4FLK A;  2BWS A;  1N51 A;  3FM3 A;  3TAV A;  1Y1N A;  2BHB A;  2BWV A;  3FMQ A;  5CDV A;  4U69 A;  4U76 A;  4IKU A;  4U75 A;  2EVO A;  2B3H A;  4HXX A;  1BOA A;  4RZY A;  5CDL A;  2EVC A;  4S2T P;  4B28 A;  4IU6 A;  5JFR A;  4RZZ A;  1WLR A;  1W2M A;  3CTZ A;  2GG0 A;  4IKT A;  2BHC A;  4EGE A;  3MAT A;  3MR1 A;  4A6W A;  2IW2 A;  1C24 A;  2Q96 A;  2Q92 A;  2P9A A;  1PV9 A;  1MAT A;  2BWW A;  5E5B A;  3BIQ A;  1QXY A;  2B3K A;  5JI6 A;  3MX6 A;  2Q93 A;  2HOW A;  2ADU A;  1YW9 A;  3PKA A;  2GU5 A;  1O0X A;  4FUK A;  4S00 A;  1KQ0 A;  4ZWO A;  2GG3 A;  1WL6 A;  5CDE A;  4U6Z A;  1QXW A;  1WY2 A;  3PKB A;  4JUQ A;  3IG4 A;  4ZWU A;  4S01 A;  5CNX A;  4U1B A;  4PNC A;  1B6A A;  2GU4 A;  3L7G A;  2BH3 A;  3ROR A;  3PKE A;  4FLJ A;  4QR8 A;  1M35 A;  2GZ5 A;  4IDY A;  2OAZ A;  1KQ9 A;  3IU8 A;  5CIK A;  1CHM A;  2OKN A;  4MAT A;  2GA2 A;  2P98 A;  2BB7 A;  1XGO A;  2G6P A;  3IU9 A;  4U6E A;  2BHD A;  2Q8K A;  2ZSG A;  2Q95 A;  3TB5 A;  5FCH A;  1QZY A;  1A16 A;  4FLI A;  1XGS A;  4U71 A;  1WKM A;  1WBQ A;  3Q6D A;  4IKS A;  2DFI A;  2BWX A;  4PV4 A;  2V3Z A;  4ZWP A;  1QXZ A;  2GU6 A;  3D27 A;  4S2R P;  5CE6 A;  4FO8 A;  1JAW A;  5D6E A;  1C22 A;  4IEC A;  4U6J A;  5FCF A;  1XGM A;  1YJ3 A;  2GG8 A;  2GGB A;  4FO7 A;  1R58 A;  4ZNG A;  1WN1 A;  4U70 A;  1XNZ A;  2BN7 A;  1BN5 A;  2EA2 A;  2BHA A;  3IU7 A;  1R5H A;  3FMR A;  5D6F A;  3CB5 A;  2P99 A;  4U6C A;  1YW7 A;  4A6V A;  1C23 A;  3PKC A;  2B3L A;  3BIT A;  2GG2 A;  2NQ7 A;  2BWU A;  4IKR A;  3RVA A;  4IPA A;  4U6W A;  3PKD A;  2GG9 A;  4FLL A;  5JHU A; 
#chains in the Genus database with same CATH topology
 2GG5 A;  4FKC A;  4KM3 A;  1C21 A;  2NQ6 A;  4R60 A;  1R5G A;  2EVM A;  1B59 A;  1KP0 A;  2EA4 A;  2GGC A;  3S6B A;  1YVM A;  2Q94 A;  4U73 A;  1C27 A;  1YW8 A;  2V3Y A;  1XGN A;  1W7V A;  3L24 A;  4RGZ 1;  2MAT A;  3CB6 A;  4Z7M A;  2BWY A;  1WL9 A;  2GTX A;  2GG7 A;  5CLS A;  2V6C A;  4IF7 A;  2BWT A;  2V3X A;  3BIP A;  4OOK A;  2GU7 A;  4FLK A;  2BWS A;  1N51 A;  3FM3 A;  3TAV A;  1Y1N A;  2BHB A;  2BWV A;  3FMQ A;  5CDV A;  4U69 A;  4U76 A;  4IKU A;  4U75 A;  2EVO A;  2B3H A;  4HXX A;  1BOA A;  4RZY A;  5CDL A;  2EVC A;  4S2T P;  4B28 A;  4IU6 A;  5JFR A;  4RZZ A;  1WLR A;  1W2M A;  3CTZ A;  2GG0 A;  4IKT A;  2BHC A;  4EGE A;  3MAT A;  3MR1 A;  4A6W A;  2IW2 A;  1C24 A;  2Q96 A;  2Q92 A;  2P9A A;  1PV9 A;  1MAT A;  2BWW A;  5E5B A;  3BIQ A;  1QXY A;  2B3K A;  5JI6 A;  3MX6 A;  2Q93 A;  2HOW A;  2ADU A;  1YW9 A;  3PKA A;  2GU5 A;  1O0X A;  4FUK A;  4S00 A;  1KQ0 A;  4ZWO A;  2GG3 A;  1WL6 A;  5CDE A;  4U6Z A;  1QXW A;  1WY2 A;  3PKB A;  4JUQ A;  3IG4 A;  4ZWU A;  4S01 A;  5CNX A;  4U1B A;  4PNC A;  1B6A A;  2GU4 A;  3L7G A;  2BH3 A;  3ROR A;  3PKE A;  4FLJ A;  4QR8 A;  1M35 A;  2GZ5 A;  4IDY A;  2OAZ A;  1KQ9 A;  3IU8 A;  5CIK A;  1CHM A;  2OKN A;  4MAT A;  2GA2 A;  2P98 A;  2BB7 A;  1XGO A;  2G6P A;  3IU9 A;  4U6E A;  2BHD A;  2Q8K A;  2ZSG A;  2Q95 A;  3TB5 A;  5FCH A;  1QZY A;  1A16 A;  4FLI A;  1XGS A;  4U71 A;  1WKM A;  1WBQ A;  3Q6D A;  4IKS A;  2DFI A;  2BWX A;  4PV4 A;  2V3Z A;  4ZWP A;  1QXZ A;  2GU6 A;  3D27 A;  4S2R P;  5CE6 A;  4FO8 A;  1JAW A;  5D6E A;  1C22 A;  4IEC A;  4U6J A;  5FCF A;  1XGM A;  1YJ3 A;  2GG8 A;  2GGB A;  4FO7 A;  1R58 A;  4ZNG A;  1WN1 A;  4U70 A;  1XNZ A;  2BN7 A;  1BN5 A;  2EA2 A;  2BHA A;  3IU7 A;  1R5H A;  3FMR A;  5D6F A;  3CB5 A;  2P99 A;  4U6C A;  1YW7 A;  4A6V A;  1C23 A;  3PKC A;  2B3L A;  3BIT A;  2GG2 A;  2NQ7 A;  2BWU A;  4IKR A;  3RVA A;  4IPA A;  4U6W A;  3PKD A;  2GG9 A;  4FLL A;  5JHU A; 
#chains in the Genus database with same CATH homology
 2GG5 A;  4FKC A;  4KM3 A;  1C21 A;  2NQ6 A;  4R60 A;  1R5G A;  2EVM A;  1B59 A;  1KP0 A;  2EA4 A;  2GGC A;  3S6B A;  1YVM A;  2Q94 A;  4U73 A;  1C27 A;  1YW8 A;  2V3Y A;  1XGN A;  1W7V A;  3L24 A;  4RGZ 1;  2MAT A;  3CB6 A;  4Z7M A;  2BWY A;  1WL9 A;  2GTX A;  2GG7 A;  5CLS A;  2V6C A;  4IF7 A;  2BWT A;  2V3X A;  3BIP A;  4OOK A;  2GU7 A;  4FLK A;  2BWS A;  1N51 A;  3FM3 A;  3TAV A;  1Y1N A;  2BHB A;  2BWV A;  3FMQ A;  5CDV A;  4U69 A;  4U76 A;  4IKU A;  4U75 A;  2EVO A;  2B3H A;  4HXX A;  1BOA A;  4RZY A;  5CDL A;  2EVC A;  4S2T P;  4B28 A;  4IU6 A;  5JFR A;  4RZZ A;  1WLR A;  1W2M A;  3CTZ A;  2GG0 A;  4IKT A;  2BHC A;  4EGE A;  3MAT A;  3MR1 A;  4A6W A;  2IW2 A;  1C24 A;  2Q96 A;  2Q92 A;  2P9A A;  1PV9 A;  1MAT A;  2BWW A;  5E5B A;  3BIQ A;  1QXY A;  2B3K A;  5JI6 A;  3MX6 A;  2Q93 A;  2HOW A;  2ADU A;  1YW9 A;  3PKA A;  2GU5 A;  1O0X A;  4FUK A;  4S00 A;  1KQ0 A;  4ZWO A;  2GG3 A;  1WL6 A;  5CDE A;  4U6Z A;  1QXW A;  1WY2 A;  3PKB A;  4JUQ A;  3IG4 A;  4ZWU A;  4S01 A;  5CNX A;  4U1B A;  4PNC A;  1B6A A;  2GU4 A;  3L7G A;  2BH3 A;  3ROR A;  3PKE A;  4FLJ A;  4QR8 A;  1M35 A;  2GZ5 A;  4IDY A;  2OAZ A;  1KQ9 A;  3IU8 A;  5CIK A;  1CHM A;  2OKN A;  4MAT A;  2GA2 A;  2P98 A;  2BB7 A;  1XGO A;  2G6P A;  3IU9 A;  4U6E A;  2BHD A;  2Q8K A;  2ZSG A;  2Q95 A;  3TB5 A;  5FCH A;  1QZY A;  1A16 A;  4FLI A;  1XGS A;  4U71 A;  1WKM A;  1WBQ A;  3Q6D A;  4IKS A;  2DFI A;  2BWX A;  4PV4 A;  2V3Z A;  4ZWP A;  1QXZ A;  2GU6 A;  3D27 A;  4S2R P;  5CE6 A;  4FO8 A;  1JAW A;  5D6E A;  1C22 A;  4IEC A;  4U6J A;  5FCF A;  1XGM A;  1YJ3 A;  2GG8 A;  2GGB A;  4FO7 A;  1R58 A;  4ZNG A;  1WN1 A;  4U70 A;  1XNZ A;  2BN7 A;  1BN5 A;  2EA2 A;  2BHA A;  3IU7 A;  1R5H A;  3FMR A;  5D6F A;  3CB5 A;  2P99 A;  4U6C A;  1YW7 A;  4A6V A;  1C23 A;  3PKC A;  2B3L A;  3BIT A;  2GG2 A;  2NQ7 A;  2BWU A;  4IKR A;  3RVA A;  4IPA A;  4U6W A;  3PKD A;  2GG9 A;  4FLL A;  5JHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...