4U75A

Hsmetap (f309m) in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u75A00
1QZYA 2EA2A 3TAVA 1MATA 4ZWPA 2P9AA 4U71A 2IW2A 3PKAA 3PKCA 4ZWOA 4S00A 1R5HA 1C27A 1W7VA 2HOWA 2ZSGA 4FO8A 4U76A 2Q93A 2BWYA 2EVCA 3L24A 4S01A 3IU7A 4R60A 1N51A 2B3HA 1C23A 2ADUA 2OKNA 3IU8A 2BB7A 1B59A 2BN7A 1YW8A 4A6WA 2BWXA 1C21A 4IECA 2GG7A 2P99A 2GZ5A 1CHMA 1QXYA 1XNZA 2GA2A 3CB5A 4FLIA 4FLLA 1W2MA 1WBQA 2BWWA 5CDVA 4U73A 1B6AA 4U6WA 4U69A 2EA4A 1YVMA 1WL9A 5FCHA 1YW9A 4U6CA 2V6CA 1R5GA 4A6VA 5E5BA 1KQ9A 2GGCA 4U6JA 1Y1NA 1YJ3A 1WKMA 2BH3A 2BWSA 2Q95A 3MX6A 4FLJA 4U6ZA 2V3YA 4IKUA 4U6EA 4U1BA 1WL6A 2OAZA 3PKEA 3RVAA 1M35A 3FMQA 1PV9A 4RGZ1 3S6BA 3TB5A 1XGOA 2GG2A 2GU5A 2GU4A 1QXZA 2EVOA 4IKTA 4QR8A 1XGSA 1WN1A 4IKSA 2BHCA 1WLRA 2Q92A 2BWTA 4JUQA 1BOAA 4S2TP 4HXXA 2GTXA 4FKCA 5FCFA 4IPAA 3CB6A 1QXWA 1YW7A 3PKDA 3MR1A 3BITA 4B28A 2GG8A 5CDEA 5JFRA 3FMRA 2P98A 2Q96A 2GU7A 2B3LA 5JI6A 4PNCA 2GGBA 1WY2A 2G6PA 3BIQA 3RORA 2GG3A 2BHBA 1KP0A 2BHAA 2NQ7A 4S2RP 4U75A 2V3ZA 2EVMA 2GU6A 5CLSA 4OOKA 1C22A 4MATA 2GG9A 3Q6DA 3L7GA 1XGMA 4RZZA 4KM3A 2GG5A 4ZNGA 2Q8KA 3IG4A 2B3KA 5JHUA 1KQ0A 2Q94A 5D6FA 5CDLA 3IU9A 4IF7A 2MATA 2DFIA 2NQ6A 4ZWUA 5D6EA 1A16A 2BWUA 5CE6A 1JAWA 2BWVA 4IU6A 2BHDA 1C24A 4IKRA 1BN5A 1XGNA 3CTZA 3PKBA 4U70A 4FUKA 3BIPA 4Z7MA 5CIKA 4EGEA 4RZYA 2V3XA 3FM3A 2GG0A 4PV4A 4FLKA 4FO7A 3D27A 4IDYA 1R58A 1O0XA 3MATA 5CNXA
chains in the Genus database with same CATH superfamily
1QZYA 2EA2A 3TAVA 1MATA 4ZWPA 2P9AA 4U71A 2IW2A 3PKAA 3PKCA 4ZWOA 4S00A 1R5HA 1C27A 1W7VA 2HOWA 2ZSGA 4FO8A 4U76A 2Q93A 2BWYA 2EVCA 3L24A 4S01A 3IU7A 4R60A 1N51A 2B3HA 1C23A 2ADUA 2OKNA 3IU8A 2BB7A 1B59A 2BN7A 1YW8A 4A6WA 2BWXA 1C21A 4IECA 2GG7A 2P99A 2GZ5A 1CHMA 1QXYA 1XNZA 2GA2A 3CB5A 4FLIA 4FLLA 1W2MA 1WBQA 2BWWA 5CDVA 4U73A 1B6AA 4U6WA 4U69A 2EA4A 1YVMA 1WL9A 5FCHA 1YW9A 4U6CA 2V6CA 1R5GA 4A6VA 5E5BA 1KQ9A 2GGCA 4U6JA 1Y1NA 1YJ3A 1WKMA 2BH3A 2BWSA 2Q95A 3MX6A 4FLJA 4U6ZA 2V3YA 4IKUA 4U6EA 4U1BA 1WL6A 2OAZA 3PKEA 3RVAA 1M35A 3FMQA 1PV9A 4RGZ1 3S6BA 3TB5A 1XGOA 2GG2A 2GU5A 2GU4A 1QXZA 2EVOA 4IKTA 4QR8A 1XGSA 1WN1A 4IKSA 2BHCA 1WLRA 2Q92A 2BWTA 4JUQA 1BOAA 4S2TP 4HXXA 2GTXA 4FKCA 5FCFA 4IPAA 3CB6A 1QXWA 1YW7A 3PKDA 3MR1A 3BITA 4B28A 2GG8A 5CDEA 5JFRA 3FMRA 2P98A 2Q96A 2GU7A 2B3LA 5JI6A 4PNCA 2GGBA 1WY2A 2G6PA 3BIQA 3RORA 2GG3A 2BHBA 1KP0A 2BHAA 2NQ7A 4S2RP 4U75A 2V3ZA 2EVMA 2GU6A 5CLSA 4OOKA 1C22A 4MATA 2GG9A 3Q6DA 3L7GA 1XGMA 4RZZA 4KM3A 2GG5A 4ZNGA 2Q8KA 3IG4A 2B3KA 5JHUA 1KQ0A 2Q94A 5D6FA 5CDLA 3IU9A 4IF7A 2MATA 2DFIA 2NQ6A 4ZWUA 5D6EA 1A16A 2BWUA 5CE6A 1JAWA 2BWVA 4IU6A 2BHDA 1C24A 4IKRA 1BN5A 1XGNA 3CTZA 3PKBA 4U70A 4FUKA 3BIPA 4Z7MA 5CIKA 4EGEA 4RZYA 2V3XA 3FM3A 2GG0A 4PV4A 4FLKA 4FO7A 3D27A 4IDYA 1R58A 1O0XA 3MATA 5CNXA
chains in the Genus database with same CATH topology
1QZYA 2EA2A 3TAVA 1MATA 4ZWPA 2P9AA 4U71A 2IW2A 3PKAA 3PKCA 4ZWOA 4S00A 1R5HA 1C27A 1W7VA 2HOWA 2ZSGA 4FO8A 4U76A 2Q93A 2BWYA 2EVCA 3L24A 4S01A 3IU7A 4R60A 1N51A 2B3HA 1C23A 2ADUA 2OKNA 3IU8A 2BB7A 1B59A 2BN7A 1YW8A 4A6WA 2BWXA 1C21A 4IECA 2GG7A 2P99A 2GZ5A 1CHMA 1QXYA 1XNZA 2GA2A 3CB5A 4FLIA 4FLLA 1W2MA 1WBQA 2BWWA 5CDVA 4U73A 1B6AA 4U6WA 4U69A 2EA4A 1YVMA 1WL9A 5FCHA 1YW9A 4U6CA 2V6CA 1R5GA 4A6VA 5E5BA 1KQ9A 2GGCA 4U6JA 1Y1NA 1YJ3A 1WKMA 2BH3A 2BWSA 2Q95A 3MX6A 4FLJA 4U6ZA 2V3YA 4IKUA 4U6EA 4U1BA 1WL6A 2OAZA 3PKEA 3RVAA 1M35A 3FMQA 1PV9A 4RGZ1 3S6BA 3TB5A 1XGOA 2GG2A 2GU5A 2GU4A 1QXZA 2EVOA 4IKTA 4QR8A 1XGSA 1WN1A 4IKSA 2BHCA 1WLRA 2Q92A 2BWTA 4JUQA 1BOAA 4S2TP 4HXXA 2GTXA 4FKCA 5FCFA 4IPAA 3CB6A 1QXWA 1YW7A 3PKDA 3MR1A 3BITA 4B28A 2GG8A 5CDEA 5JFRA 3FMRA 2P98A 2Q96A 2GU7A 2B3LA 5JI6A 4PNCA 2GGBA 1WY2A 2G6PA 3BIQA 3RORA 2GG3A 2BHBA 1KP0A 2BHAA 2NQ7A 4S2RP 4U75A 2V3ZA 2EVMA 2GU6A 5CLSA 4OOKA 1C22A 4MATA 2GG9A 3Q6DA 3L7GA 1XGMA 4RZZA 4KM3A 2GG5A 4ZNGA 2Q8KA 3IG4A 2B3KA 5JHUA 1KQ0A 2Q94A 5D6FA 5CDLA 3IU9A 4IF7A 2MATA 2DFIA 2NQ6A 4ZWUA 5D6EA 1A16A 2BWUA 5CE6A 1JAWA 2BWVA 4IU6A 2BHDA 1C24A 4IKRA 1BN5A 1XGNA 3CTZA 3PKBA 4U70A 4FUKA 3BIPA 4Z7MA 5CIKA 4EGEA 4RZYA 2V3XA 3FM3A 2GG0A 4PV4A 4FLKA 4FO7A 3D27A 4IDYA 1R58A 1O0XA 3MATA 5CNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZY A;  2EA2 A;  3TAV A;  1MAT A;  4ZWP A;  2P9A A;  4U71 A;  2IW2 A;  3PKA A;  3PKC A;  4ZWO A;  4S00 A;  1R5H A;  1C27 A;  1W7V A;  2HOW A;  2ZSG A;  4FO8 A;  4U76 A;  2Q93 A;  2BWY A;  2EVC A;  3L24 A;  4S01 A;  3IU7 A;  4R60 A;  1N51 A;  2B3H A;  1C23 A;  2ADU A;  2OKN A;  3IU8 A;  2BB7 A;  1B59 A;  2BN7 A;  1YW8 A;  4A6W A;  2BWX A;  1C21 A;  4IEC A;  2GG7 A;  2P99 A;  2GZ5 A;  1CHM A;  1QXY A;  1XNZ A;  2GA2 A;  3CB5 A;  4FLI A;  4FLL A;  1W2M A;  1WBQ A;  2BWW A;  5CDV A;  4U73 A;  1B6A A;  4U6W A;  4U69 A;  2EA4 A;  1YVM A;  1WL9 A;  5FCH A;  1YW9 A;  4U6C A;  2V6C A;  1R5G A;  4A6V A;  5E5B A;  1KQ9 A;  2GGC A;  4U6J A;  1Y1N A;  1YJ3 A;  1WKM A;  2BH3 A;  2BWS A;  2Q95 A;  3MX6 A;  4FLJ A;  4U6Z A;  2V3Y A;  4IKU A;  4U6E A;  4U1B A;  1WL6 A;  2OAZ A;  3PKE A;  3RVA A;  1M35 A;  3FMQ A;  1PV9 A;  4RGZ 1;  3S6B A;  3TB5 A;  1XGO A;  2GG2 A;  2GU5 A;  2GU4 A;  1QXZ A;  2EVO A;  4IKT A;  4QR8 A;  1XGS A;  1WN1 A;  4IKS A;  2BHC A;  1WLR A;  2Q92 A;  2BWT A;  4JUQ A;  1BOA A;  4S2T P;  4HXX A;  2GTX A;  4FKC A;  5FCF A;  4IPA A;  3CB6 A;  1QXW A;  1YW7 A;  3PKD A;  3MR1 A;  3BIT A;  4B28 A;  2GG8 A;  5CDE A;  5JFR A;  3FMR A;  2P98 A;  2Q96 A;  2GU7 A;  2B3L A;  5JI6 A;  4PNC A;  2GGB A;  1WY2 A;  2G6P A;  3BIQ A;  3ROR A;  2GG3 A;  2BHB A;  1KP0 A;  2BHA A;  2NQ7 A;  4S2R P;  4U75 A;  2V3Z A;  2EVM A;  2GU6 A;  5CLS A;  4OOK A;  1C22 A;  4MAT A;  2GG9 A;  3Q6D A;  3L7G A;  1XGM A;  4RZZ A;  4KM3 A;  2GG5 A;  4ZNG A;  2Q8K A;  3IG4 A;  2B3K A;  5JHU A;  1KQ0 A;  2Q94 A;  5D6F A;  5CDL A;  3IU9 A;  4IF7 A;  2MAT A;  2DFI A;  2NQ6 A;  4ZWU A;  5D6E A;  1A16 A;  2BWU A;  5CE6 A;  1JAW A;  2BWV A;  4IU6 A;  2BHD A;  1C24 A;  4IKR A;  1BN5 A;  1XGN A;  3CTZ A;  3PKB A;  4U70 A;  4FUK A;  3BIP A;  4Z7M A;  5CIK A;  4EGE A;  4RZY A;  2V3X A;  3FM3 A;  2GG0 A;  4PV4 A;  4FLK A;  4FO7 A;  3D27 A;  4IDY A;  1R58 A;  1O0X A;  3MAT A;  5CNX A; 
#chains in the Genus database with same CATH topology
 1QZY A;  2EA2 A;  3TAV A;  1MAT A;  4ZWP A;  2P9A A;  4U71 A;  2IW2 A;  3PKA A;  3PKC A;  4ZWO A;  4S00 A;  1R5H A;  1C27 A;  1W7V A;  2HOW A;  2ZSG A;  4FO8 A;  4U76 A;  2Q93 A;  2BWY A;  2EVC A;  3L24 A;  4S01 A;  3IU7 A;  4R60 A;  1N51 A;  2B3H A;  1C23 A;  2ADU A;  2OKN A;  3IU8 A;  2BB7 A;  1B59 A;  2BN7 A;  1YW8 A;  4A6W A;  2BWX A;  1C21 A;  4IEC A;  2GG7 A;  2P99 A;  2GZ5 A;  1CHM A;  1QXY A;  1XNZ A;  2GA2 A;  3CB5 A;  4FLI A;  4FLL A;  1W2M A;  1WBQ A;  2BWW A;  5CDV A;  4U73 A;  1B6A A;  4U6W A;  4U69 A;  2EA4 A;  1YVM A;  1WL9 A;  5FCH A;  1YW9 A;  4U6C A;  2V6C A;  1R5G A;  4A6V A;  5E5B A;  1KQ9 A;  2GGC A;  4U6J A;  1Y1N A;  1YJ3 A;  1WKM A;  2BH3 A;  2BWS A;  2Q95 A;  3MX6 A;  4FLJ A;  4U6Z A;  2V3Y A;  4IKU A;  4U6E A;  4U1B A;  1WL6 A;  2OAZ A;  3PKE A;  3RVA A;  1M35 A;  3FMQ A;  1PV9 A;  4RGZ 1;  3S6B A;  3TB5 A;  1XGO A;  2GG2 A;  2GU5 A;  2GU4 A;  1QXZ A;  2EVO A;  4IKT A;  4QR8 A;  1XGS A;  1WN1 A;  4IKS A;  2BHC A;  1WLR A;  2Q92 A;  2BWT A;  4JUQ A;  1BOA A;  4S2T P;  4HXX A;  2GTX A;  4FKC A;  5FCF A;  4IPA A;  3CB6 A;  1QXW A;  1YW7 A;  3PKD A;  3MR1 A;  3BIT A;  4B28 A;  2GG8 A;  5CDE A;  5JFR A;  3FMR A;  2P98 A;  2Q96 A;  2GU7 A;  2B3L A;  5JI6 A;  4PNC A;  2GGB A;  1WY2 A;  2G6P A;  3BIQ A;  3ROR A;  2GG3 A;  2BHB A;  1KP0 A;  2BHA A;  2NQ7 A;  4S2R P;  4U75 A;  2V3Z A;  2EVM A;  2GU6 A;  5CLS A;  4OOK A;  1C22 A;  4MAT A;  2GG9 A;  3Q6D A;  3L7G A;  1XGM A;  4RZZ A;  4KM3 A;  2GG5 A;  4ZNG A;  2Q8K A;  3IG4 A;  2B3K A;  5JHU A;  1KQ0 A;  2Q94 A;  5D6F A;  5CDL A;  3IU9 A;  4IF7 A;  2MAT A;  2DFI A;  2NQ6 A;  4ZWU A;  5D6E A;  1A16 A;  2BWU A;  5CE6 A;  1JAW A;  2BWV A;  4IU6 A;  2BHD A;  1C24 A;  4IKR A;  1BN5 A;  1XGN A;  3CTZ A;  3PKB A;  4U70 A;  4FUK A;  3BIP A;  4Z7M A;  5CIK A;  4EGE A;  4RZY A;  2V3X A;  3FM3 A;  2GG0 A;  4PV4 A;  4FLK A;  4FO7 A;  3D27 A;  4IDY A;  1R58 A;  1O0X A;  3MAT A;  5CNX A; 
#chains in the Genus database with same CATH homology
 1QZY A;  2EA2 A;  3TAV A;  1MAT A;  4ZWP A;  2P9A A;  4U71 A;  2IW2 A;  3PKA A;  3PKC A;  4ZWO A;  4S00 A;  1R5H A;  1C27 A;  1W7V A;  2HOW A;  2ZSG A;  4FO8 A;  4U76 A;  2Q93 A;  2BWY A;  2EVC A;  3L24 A;  4S01 A;  3IU7 A;  4R60 A;  1N51 A;  2B3H A;  1C23 A;  2ADU A;  2OKN A;  3IU8 A;  2BB7 A;  1B59 A;  2BN7 A;  1YW8 A;  4A6W A;  2BWX A;  1C21 A;  4IEC A;  2GG7 A;  2P99 A;  2GZ5 A;  1CHM A;  1QXY A;  1XNZ A;  2GA2 A;  3CB5 A;  4FLI A;  4FLL A;  1W2M A;  1WBQ A;  2BWW A;  5CDV A;  4U73 A;  1B6A A;  4U6W A;  4U69 A;  2EA4 A;  1YVM A;  1WL9 A;  5FCH A;  1YW9 A;  4U6C A;  2V6C A;  1R5G A;  4A6V A;  5E5B A;  1KQ9 A;  2GGC A;  4U6J A;  1Y1N A;  1YJ3 A;  1WKM A;  2BH3 A;  2BWS A;  2Q95 A;  3MX6 A;  4FLJ A;  4U6Z A;  2V3Y A;  4IKU A;  4U6E A;  4U1B A;  1WL6 A;  2OAZ A;  3PKE A;  3RVA A;  1M35 A;  3FMQ A;  1PV9 A;  4RGZ 1;  3S6B A;  3TB5 A;  1XGO A;  2GG2 A;  2GU5 A;  2GU4 A;  1QXZ A;  2EVO A;  4IKT A;  4QR8 A;  1XGS A;  1WN1 A;  4IKS A;  2BHC A;  1WLR A;  2Q92 A;  2BWT A;  4JUQ A;  1BOA A;  4S2T P;  4HXX A;  2GTX A;  4FKC A;  5FCF A;  4IPA A;  3CB6 A;  1QXW A;  1YW7 A;  3PKD A;  3MR1 A;  3BIT A;  4B28 A;  2GG8 A;  5CDE A;  5JFR A;  3FMR A;  2P98 A;  2Q96 A;  2GU7 A;  2B3L A;  5JI6 A;  4PNC A;  2GGB A;  1WY2 A;  2G6P A;  3BIQ A;  3ROR A;  2GG3 A;  2BHB A;  1KP0 A;  2BHA A;  2NQ7 A;  4S2R P;  4U75 A;  2V3Z A;  2EVM A;  2GU6 A;  5CLS A;  4OOK A;  1C22 A;  4MAT A;  2GG9 A;  3Q6D A;  3L7G A;  1XGM A;  4RZZ A;  4KM3 A;  2GG5 A;  4ZNG A;  2Q8K A;  3IG4 A;  2B3K A;  5JHU A;  1KQ0 A;  2Q94 A;  5D6F A;  5CDL A;  3IU9 A;  4IF7 A;  2MAT A;  2DFI A;  2NQ6 A;  4ZWU A;  5D6E A;  1A16 A;  2BWU A;  5CE6 A;  1JAW A;  2BWV A;  4IU6 A;  2BHD A;  1C24 A;  4IKR A;  1BN5 A;  1XGN A;  3CTZ A;  3PKB A;  4U70 A;  4FUK A;  3BIP A;  4Z7M A;  5CIK A;  4EGE A;  4RZY A;  2V3X A;  3FM3 A;  2GG0 A;  4PV4 A;  4FLK A;  4FO7 A;  3D27 A;  4IDY A;  1R58 A;  1O0X A;  3MAT A;  5CNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...