4U75A

Hsmetap (f309m) in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u75A00
1KQ0A 1M35A 4IECA 2GGCA 5CDVA 3L7GA 3FM3A 1YW8A 4IKUA 2ADUA 1R58A 2GU4A 2NQ7A 5CE6A 2V3YA 4FLKA 2EVCA 1C22A 4S00A 2GZ5A 3BIQA 1WL6A 4R60A 5CNXA 4A6VA 4U6ZA 2BWTA 4U1BA 2EVMA 2OKNA 1WLRA 2B3LA 1B59A 2V6CA 4U76A 4RZZA 1WKMA 2B3HA 2DFIA 4U69A 4S01A 4MATA 3TB5A 1A16A 2GA2A 2GG8A 3Q6DA 4IPAA 3IG4A 2Q95A 3MATA 2BHBA 2Q93A 1BOAA 4PV4A 2V3XA 4IU6A 4Z7MA 2BWSA 1QZYA 2NQ6A 4U70A 2EA4A 2GGBA 4U6JA 5D6EA 4FUKA 2BHCA 3FMQA 3IU9A 4ZWOA 4B28A 4U73A 1XGSA 1XNZA 1C23A 1XGMA 5FCHA 1R5GA 3PKAA 1R5HA 1YJ3A 4U6CA 5JHUA 1KQ9A 2GG3A 2GTXA 4QR8A 2BWVA 5D6FA 3MX6A 4IKRA 3PKBA 4OOKA 1C27A 1XGOA 2GG7A 2P98A 3IU8A 2ZSGA 2BWWA 4PNCA 4S2TP 2BHDA 4IKTA 5CLSA 4ZWPA 2EA2A 3CTZA 4KM3A 1YW7A 4FLIA 2GU5A 2MATA 2OAZA 3S6BA 5JFRA 1O0XA 3D27A 5CDEA 3IU7A 2BH3A 4HXXA 1W7VA 1YVMA 5CIKA 2BWXA 1WL9A 2G6PA 3TAVA 1BN5A 4U75A 2BB7A 2BWYA 4FO8A 1MATA 2GG9A 3CB5A 4U6EA 2HOWA 2GU6A 2EVOA 5JI6A 1WY2A 2P99A 2Q8KA 2IW2A 4U71A 1C24A 5FCFA 1C21A 4IKSA 2Q96A 3BITA 1QXZA 1B6AA 4EGEA 2Q94A 2V3ZA 4RZYA 4S2RP 4RGZ1 3RORA 4IDYA 1JAWA 2GG2A 4FKCA 2BHAA 3MR1A 1XGNA 1WBQA 2BWUA 1CHMA 4JUQA 2BN7A 5CDLA 2P9AA 1W2MA 3FMRA 2GU7A 3PKCA 3RVAA 3PKEA 1N51A 4A6WA 4FLJA 2Q92A 1KP0A 2B3KA 4FO7A 1YW9A 3CB6A 3PKDA 5E5BA 1QXWA 2GG5A 4ZNGA 1Y1NA 4ZWUA 3L24A 1PV9A 1QXYA 4FLLA 4U6WA 1WN1A 4IF7A 2GG0A 3BIPA
chains in the Genus database with same CATH superfamily
1KQ0A 1M35A 4IECA 2GGCA 5CDVA 3L7GA 3FM3A 1YW8A 4IKUA 2ADUA 1R58A 2GU4A 2NQ7A 5CE6A 2V3YA 4FLKA 2EVCA 1C22A 4S00A 2GZ5A 3BIQA 1WL6A 4R60A 5CNXA 4A6VA 4U6ZA 2BWTA 4U1BA 2EVMA 2OKNA 1WLRA 2B3LA 1B59A 2V6CA 4U76A 4RZZA 1WKMA 2B3HA 2DFIA 4U69A 4S01A 4MATA 3TB5A 1A16A 2GA2A 2GG8A 3Q6DA 4IPAA 3IG4A 2Q95A 3MATA 2BHBA 2Q93A 1BOAA 4PV4A 2V3XA 4IU6A 4Z7MA 2BWSA 1QZYA 2NQ6A 4U70A 2EA4A 2GGBA 4U6JA 5D6EA 4FUKA 2BHCA 3FMQA 3IU9A 4ZWOA 4B28A 4U73A 1XGSA 1XNZA 1C23A 1XGMA 5FCHA 1R5GA 3PKAA 1R5HA 1YJ3A 4U6CA 5JHUA 1KQ9A 2GG3A 2GTXA 4QR8A 2BWVA 5D6FA 3MX6A 4IKRA 3PKBA 4OOKA 1C27A 1XGOA 2GG7A 2P98A 3IU8A 2ZSGA 2BWWA 4PNCA 4S2TP 2BHDA 4IKTA 5CLSA 4ZWPA 2EA2A 3CTZA 4KM3A 1YW7A 4FLIA 2GU5A 2MATA 2OAZA 3S6BA 5JFRA 1O0XA 3D27A 5CDEA 3IU7A 2BH3A 4HXXA 1W7VA 1YVMA 5CIKA 2BWXA 1WL9A 2G6PA 3TAVA 1BN5A 4U75A 2BB7A 2BWYA 4FO8A 1MATA 2GG9A 3CB5A 4U6EA 2HOWA 2GU6A 2EVOA 5JI6A 1WY2A 2P99A 2Q8KA 2IW2A 4U71A 1C24A 5FCFA 1C21A 4IKSA 2Q96A 3BITA 1QXZA 1B6AA 4EGEA 2Q94A 2V3ZA 4RZYA 4S2RP 4RGZ1 3RORA 4IDYA 1JAWA 2GG2A 4FKCA 2BHAA 3MR1A 1XGNA 1WBQA 2BWUA 1CHMA 4JUQA 2BN7A 5CDLA 2P9AA 1W2MA 3FMRA 2GU7A 3PKCA 3RVAA 3PKEA 1N51A 4A6WA 4FLJA 2Q92A 1KP0A 2B3KA 4FO7A 1YW9A 3CB6A 3PKDA 5E5BA 1QXWA 2GG5A 4ZNGA 1Y1NA 4ZWUA 3L24A 1PV9A 1QXYA 4FLLA 4U6WA 1WN1A 4IF7A 2GG0A 3BIPA
chains in the Genus database with same CATH topology
1KQ0A 1M35A 4IECA 2GGCA 5CDVA 3L7GA 3FM3A 1YW8A 4IKUA 2ADUA 1R58A 2GU4A 2NQ7A 5CE6A 2V3YA 4FLKA 2EVCA 1C22A 4S00A 2GZ5A 3BIQA 1WL6A 4R60A 5CNXA 4A6VA 4U6ZA 2BWTA 4U1BA 2EVMA 2OKNA 1WLRA 2B3LA 1B59A 2V6CA 4U76A 4RZZA 1WKMA 2B3HA 2DFIA 4U69A 4S01A 4MATA 3TB5A 1A16A 2GA2A 2GG8A 3Q6DA 4IPAA 3IG4A 2Q95A 3MATA 2BHBA 2Q93A 1BOAA 4PV4A 2V3XA 4IU6A 4Z7MA 2BWSA 1QZYA 2NQ6A 4U70A 2EA4A 2GGBA 4U6JA 5D6EA 4FUKA 2BHCA 3FMQA 3IU9A 4ZWOA 4B28A 4U73A 1XGSA 1XNZA 1C23A 1XGMA 5FCHA 1R5GA 3PKAA 1R5HA 1YJ3A 4U6CA 5JHUA 1KQ9A 2GG3A 2GTXA 4QR8A 2BWVA 5D6FA 3MX6A 4IKRA 3PKBA 4OOKA 1C27A 1XGOA 2GG7A 2P98A 3IU8A 2ZSGA 2BWWA 4PNCA 4S2TP 2BHDA 4IKTA 5CLSA 4ZWPA 2EA2A 3CTZA 4KM3A 1YW7A 4FLIA 2GU5A 2MATA 2OAZA 3S6BA 5JFRA 1O0XA 3D27A 5CDEA 3IU7A 2BH3A 4HXXA 1W7VA 1YVMA 5CIKA 2BWXA 1WL9A 2G6PA 3TAVA 1BN5A 4U75A 2BB7A 2BWYA 4FO8A 1MATA 2GG9A 3CB5A 4U6EA 2HOWA 2GU6A 2EVOA 5JI6A 1WY2A 2P99A 2Q8KA 2IW2A 4U71A 1C24A 5FCFA 1C21A 4IKSA 2Q96A 3BITA 1QXZA 1B6AA 4EGEA 2Q94A 2V3ZA 4RZYA 4S2RP 4RGZ1 3RORA 4IDYA 1JAWA 2GG2A 4FKCA 2BHAA 3MR1A 1XGNA 1WBQA 2BWUA 1CHMA 4JUQA 2BN7A 5CDLA 2P9AA 1W2MA 3FMRA 2GU7A 3PKCA 3RVAA 3PKEA 1N51A 4A6WA 4FLJA 2Q92A 1KP0A 2B3KA 4FO7A 1YW9A 3CB6A 3PKDA 5E5BA 1QXWA 2GG5A 4ZNGA 1Y1NA 4ZWUA 3L24A 1PV9A 1QXYA 4FLLA 4U6WA 1WN1A 4IF7A 2GG0A 3BIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ0 A;  1M35 A;  4IEC A;  2GGC A;  5CDV A;  3L7G A;  3FM3 A;  1YW8 A;  4IKU A;  2ADU A;  1R58 A;  2GU4 A;  2NQ7 A;  5CE6 A;  2V3Y A;  4FLK A;  2EVC A;  1C22 A;  4S00 A;  2GZ5 A;  3BIQ A;  1WL6 A;  4R60 A;  5CNX A;  4A6V A;  4U6Z A;  2BWT A;  4U1B A;  2EVM A;  2OKN A;  1WLR A;  2B3L A;  1B59 A;  2V6C A;  4U76 A;  4RZZ A;  1WKM A;  2B3H A;  2DFI A;  4U69 A;  4S01 A;  4MAT A;  3TB5 A;  1A16 A;  2GA2 A;  2GG8 A;  3Q6D A;  4IPA A;  3IG4 A;  2Q95 A;  3MAT A;  2BHB A;  2Q93 A;  1BOA A;  4PV4 A;  2V3X A;  4IU6 A;  4Z7M A;  2BWS A;  1QZY A;  2NQ6 A;  4U70 A;  2EA4 A;  2GGB A;  4U6J A;  5D6E A;  4FUK A;  2BHC A;  3FMQ A;  3IU9 A;  4ZWO A;  4B28 A;  4U73 A;  1XGS A;  1XNZ A;  1C23 A;  1XGM A;  5FCH A;  1R5G A;  3PKA A;  1R5H A;  1YJ3 A;  4U6C A;  5JHU A;  1KQ9 A;  2GG3 A;  2GTX A;  4QR8 A;  2BWV A;  5D6F A;  3MX6 A;  4IKR A;  3PKB A;  4OOK A;  1C27 A;  1XGO A;  2GG7 A;  2P98 A;  3IU8 A;  2ZSG A;  2BWW A;  4PNC A;  4S2T P;  2BHD A;  4IKT A;  5CLS A;  4ZWP A;  2EA2 A;  3CTZ A;  4KM3 A;  1YW7 A;  4FLI A;  2GU5 A;  2MAT A;  2OAZ A;  3S6B A;  5JFR A;  1O0X A;  3D27 A;  5CDE A;  3IU7 A;  2BH3 A;  4HXX A;  1W7V A;  1YVM A;  5CIK A;  2BWX A;  1WL9 A;  2G6P A;  3TAV A;  1BN5 A;  4U75 A;  2BB7 A;  2BWY A;  4FO8 A;  1MAT A;  2GG9 A;  3CB5 A;  4U6E A;  2HOW A;  2GU6 A;  2EVO A;  5JI6 A;  1WY2 A;  2P99 A;  2Q8K A;  2IW2 A;  4U71 A;  1C24 A;  5FCF A;  1C21 A;  4IKS A;  2Q96 A;  3BIT A;  1QXZ A;  1B6A A;  4EGE A;  2Q94 A;  2V3Z A;  4RZY A;  4S2R P;  4RGZ 1;  3ROR A;  4IDY A;  1JAW A;  2GG2 A;  4FKC A;  2BHA A;  3MR1 A;  1XGN A;  1WBQ A;  2BWU A;  1CHM A;  4JUQ A;  2BN7 A;  5CDL A;  2P9A A;  1W2M A;  3FMR A;  2GU7 A;  3PKC A;  3RVA A;  3PKE A;  1N51 A;  4A6W A;  4FLJ A;  2Q92 A;  1KP0 A;  2B3K A;  4FO7 A;  1YW9 A;  3CB6 A;  3PKD A;  5E5B A;  1QXW A;  2GG5 A;  4ZNG A;  1Y1N A;  4ZWU A;  3L24 A;  1PV9 A;  1QXY A;  4FLL A;  4U6W A;  1WN1 A;  4IF7 A;  2GG0 A;  3BIP A; 
#chains in the Genus database with same CATH topology
 1KQ0 A;  1M35 A;  4IEC A;  2GGC A;  5CDV A;  3L7G A;  3FM3 A;  1YW8 A;  4IKU A;  2ADU A;  1R58 A;  2GU4 A;  2NQ7 A;  5CE6 A;  2V3Y A;  4FLK A;  2EVC A;  1C22 A;  4S00 A;  2GZ5 A;  3BIQ A;  1WL6 A;  4R60 A;  5CNX A;  4A6V A;  4U6Z A;  2BWT A;  4U1B A;  2EVM A;  2OKN A;  1WLR A;  2B3L A;  1B59 A;  2V6C A;  4U76 A;  4RZZ A;  1WKM A;  2B3H A;  2DFI A;  4U69 A;  4S01 A;  4MAT A;  3TB5 A;  1A16 A;  2GA2 A;  2GG8 A;  3Q6D A;  4IPA A;  3IG4 A;  2Q95 A;  3MAT A;  2BHB A;  2Q93 A;  1BOA A;  4PV4 A;  2V3X A;  4IU6 A;  4Z7M A;  2BWS A;  1QZY A;  2NQ6 A;  4U70 A;  2EA4 A;  2GGB A;  4U6J A;  5D6E A;  4FUK A;  2BHC A;  3FMQ A;  3IU9 A;  4ZWO A;  4B28 A;  4U73 A;  1XGS A;  1XNZ A;  1C23 A;  1XGM A;  5FCH A;  1R5G A;  3PKA A;  1R5H A;  1YJ3 A;  4U6C A;  5JHU A;  1KQ9 A;  2GG3 A;  2GTX A;  4QR8 A;  2BWV A;  5D6F A;  3MX6 A;  4IKR A;  3PKB A;  4OOK A;  1C27 A;  1XGO A;  2GG7 A;  2P98 A;  3IU8 A;  2ZSG A;  2BWW A;  4PNC A;  4S2T P;  2BHD A;  4IKT A;  5CLS A;  4ZWP A;  2EA2 A;  3CTZ A;  4KM3 A;  1YW7 A;  4FLI A;  2GU5 A;  2MAT A;  2OAZ A;  3S6B A;  5JFR A;  1O0X A;  3D27 A;  5CDE A;  3IU7 A;  2BH3 A;  4HXX A;  1W7V A;  1YVM A;  5CIK A;  2BWX A;  1WL9 A;  2G6P A;  3TAV A;  1BN5 A;  4U75 A;  2BB7 A;  2BWY A;  4FO8 A;  1MAT A;  2GG9 A;  3CB5 A;  4U6E A;  2HOW A;  2GU6 A;  2EVO A;  5JI6 A;  1WY2 A;  2P99 A;  2Q8K A;  2IW2 A;  4U71 A;  1C24 A;  5FCF A;  1C21 A;  4IKS A;  2Q96 A;  3BIT A;  1QXZ A;  1B6A A;  4EGE A;  2Q94 A;  2V3Z A;  4RZY A;  4S2R P;  4RGZ 1;  3ROR A;  4IDY A;  1JAW A;  2GG2 A;  4FKC A;  2BHA A;  3MR1 A;  1XGN A;  1WBQ A;  2BWU A;  1CHM A;  4JUQ A;  2BN7 A;  5CDL A;  2P9A A;  1W2M A;  3FMR A;  2GU7 A;  3PKC A;  3RVA A;  3PKE A;  1N51 A;  4A6W A;  4FLJ A;  2Q92 A;  1KP0 A;  2B3K A;  4FO7 A;  1YW9 A;  3CB6 A;  3PKD A;  5E5B A;  1QXW A;  2GG5 A;  4ZNG A;  1Y1N A;  4ZWU A;  3L24 A;  1PV9 A;  1QXY A;  4FLL A;  4U6W A;  1WN1 A;  4IF7 A;  2GG0 A;  3BIP A; 
#chains in the Genus database with same CATH homology
 1KQ0 A;  1M35 A;  4IEC A;  2GGC A;  5CDV A;  3L7G A;  3FM3 A;  1YW8 A;  4IKU A;  2ADU A;  1R58 A;  2GU4 A;  2NQ7 A;  5CE6 A;  2V3Y A;  4FLK A;  2EVC A;  1C22 A;  4S00 A;  2GZ5 A;  3BIQ A;  1WL6 A;  4R60 A;  5CNX A;  4A6V A;  4U6Z A;  2BWT A;  4U1B A;  2EVM A;  2OKN A;  1WLR A;  2B3L A;  1B59 A;  2V6C A;  4U76 A;  4RZZ A;  1WKM A;  2B3H A;  2DFI A;  4U69 A;  4S01 A;  4MAT A;  3TB5 A;  1A16 A;  2GA2 A;  2GG8 A;  3Q6D A;  4IPA A;  3IG4 A;  2Q95 A;  3MAT A;  2BHB A;  2Q93 A;  1BOA A;  4PV4 A;  2V3X A;  4IU6 A;  4Z7M A;  2BWS A;  1QZY A;  2NQ6 A;  4U70 A;  2EA4 A;  2GGB A;  4U6J A;  5D6E A;  4FUK A;  2BHC A;  3FMQ A;  3IU9 A;  4ZWO A;  4B28 A;  4U73 A;  1XGS A;  1XNZ A;  1C23 A;  1XGM A;  5FCH A;  1R5G A;  3PKA A;  1R5H A;  1YJ3 A;  4U6C A;  5JHU A;  1KQ9 A;  2GG3 A;  2GTX A;  4QR8 A;  2BWV A;  5D6F A;  3MX6 A;  4IKR A;  3PKB A;  4OOK A;  1C27 A;  1XGO A;  2GG7 A;  2P98 A;  3IU8 A;  2ZSG A;  2BWW A;  4PNC A;  4S2T P;  2BHD A;  4IKT A;  5CLS A;  4ZWP A;  2EA2 A;  3CTZ A;  4KM3 A;  1YW7 A;  4FLI A;  2GU5 A;  2MAT A;  2OAZ A;  3S6B A;  5JFR A;  1O0X A;  3D27 A;  5CDE A;  3IU7 A;  2BH3 A;  4HXX A;  1W7V A;  1YVM A;  5CIK A;  2BWX A;  1WL9 A;  2G6P A;  3TAV A;  1BN5 A;  4U75 A;  2BB7 A;  2BWY A;  4FO8 A;  1MAT A;  2GG9 A;  3CB5 A;  4U6E A;  2HOW A;  2GU6 A;  2EVO A;  5JI6 A;  1WY2 A;  2P99 A;  2Q8K A;  2IW2 A;  4U71 A;  1C24 A;  5FCF A;  1C21 A;  4IKS A;  2Q96 A;  3BIT A;  1QXZ A;  1B6A A;  4EGE A;  2Q94 A;  2V3Z A;  4RZY A;  4S2R P;  4RGZ 1;  3ROR A;  4IDY A;  1JAW A;  2GG2 A;  4FKC A;  2BHA A;  3MR1 A;  1XGN A;  1WBQ A;  2BWU A;  1CHM A;  4JUQ A;  2BN7 A;  5CDL A;  2P9A A;  1W2M A;  3FMR A;  2GU7 A;  3PKC A;  3RVA A;  3PKE A;  1N51 A;  4A6W A;  4FLJ A;  2Q92 A;  1KP0 A;  2B3K A;  4FO7 A;  1YW9 A;  3CB6 A;  3PKD A;  5E5B A;  1QXW A;  2GG5 A;  4ZNG A;  1Y1N A;  4ZWU A;  3L24 A;  1PV9 A;  1QXY A;  4FLL A;  4U6W A;  1WN1 A;  4IF7 A;  2GG0 A;  3BIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...