2GG9A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 86
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg9A00
1WL9A 4RZYA 1YVMA 4PNCA 4S2RP 4IECA 2P9AA 1JAWA 2P98A 5CDEA 2EVCA 4QR8A 2GU6A 2G6PA 2V6CA 3RORA 5CDVA 1BN5A 2MATA 5CDLA 1Y1NA 2BH3A 4IF7A 1B59A 2BWVA 2BN7A 4IU6A 3TB5A 4FLKA 5CE6A 5FCHA 2GG2A 3Q6DA 2BHBA 2V3ZA 2IW2A 4U6CA 1WN1A 1XGMA 4Z7MA 2EVOA 4IKTA 4U1BA 3BITA 3PKBA 3FMQA 2GU4A 4U6WA 4KM3A 5E5BA 1BOAA 4IDYA 5CNXA 1YW9A 4FO7A 2GGBA 2NQ6A 4EGEA 3L7GA 2BHAA 4ZWPA 3S6BA 1WLRA 4FLLA 4U6JA 3IU7A 2BB7A 3PKDA 2GU5A 1MATA 3MX6A 2BHCA 4FO8A 1M35A 2GG0A 5CIKA 2EA2A 2HOWA 2BWWA 5D6EA 1C23A 1YJ3A 4U71A 3RVAA 3IG4A 2GTXA 2P99A 1WKMA 4FUKA 2V3YA 3FMRA 5JFRA 3IU9A 2BHDA 2GGCA 2GZ5A 4IKRA 1B6AA 2OKNA 1XGSA 1QZYA 3PKCA 1R5GA 1CHMA 4B28A 2Q96A 4U6EA 4S2TP 3CB5A 4U73A 4A6VA 2BWXA 1WBQA 4HXXA 4FLIA 1WL6A 1C24A 4U70A 2Q92A 4RGZ1 2GG3A 1A16A 4ZNGA 3CTZA 4U6ZA 1PV9A 4U75A 2GA2A 1W7VA 2Q95A 1WY2A 2EA4A 1QXYA 5D6FA 2OAZA 3BIQA 2GG9A 1KQ0A 2GG5A 4S00A 2Q8KA 1C21A 4MATA 2ZSGA 2Q93A 2B3HA 3TAVA 2GG8A 1QXWA 1R5HA 2GG7A 2NQ7A 4S01A 3PKEA 4ZWOA 3IU8A 3L24A 2B3LA 2B3KA 3CB6A 1C22A 2EVMA 3MATA 4FLJA 4IKUA 4RZZA 2BWUA 2Q94A 1KQ9A 2BWYA 4U69A 2DFIA 3BIPA 5CLSA 1QXZA 2BWTA 5FCFA 2V3XA 3MR1A 4R60A 1YW8A 2GU7A 1XGNA 1N51A 1O0XA 1W2MA 3FM3A 2BWSA 4IPAA 1R58A 4ZWUA 3PKAA 4U76A 4FKCA 1YW7A 2ADUA 1C27A 1XGOA 4IKSA 1KP0A 5JI6A 4JUQA 3D27A 4PV4A 4OOKA 4A6WA 5JHUA 1XNZA
chains in the Genus database with same CATH superfamily
1WL9A 4RZYA 1YVMA 4PNCA 4S2RP 4IECA 2P9AA 1JAWA 2P98A 5CDEA 2EVCA 4QR8A 2GU6A 2G6PA 2V6CA 3RORA 5CDVA 1BN5A 2MATA 5CDLA 1Y1NA 2BH3A 4IF7A 1B59A 2BWVA 2BN7A 4IU6A 3TB5A 4FLKA 5CE6A 5FCHA 2GG2A 3Q6DA 2BHBA 2V3ZA 2IW2A 4U6CA 1WN1A 1XGMA 4Z7MA 2EVOA 4IKTA 4U1BA 3BITA 3PKBA 3FMQA 2GU4A 4U6WA 4KM3A 5E5BA 1BOAA 4IDYA 5CNXA 1YW9A 4FO7A 2GGBA 2NQ6A 4EGEA 3L7GA 2BHAA 4ZWPA 3S6BA 1WLRA 4FLLA 4U6JA 3IU7A 2BB7A 3PKDA 2GU5A 1MATA 3MX6A 2BHCA 4FO8A 1M35A 2GG0A 5CIKA 2EA2A 2HOWA 2BWWA 5D6EA 1C23A 1YJ3A 4U71A 3RVAA 3IG4A 2GTXA 2P99A 1WKMA 4FUKA 2V3YA 3FMRA 5JFRA 3IU9A 2BHDA 2GGCA 2GZ5A 4IKRA 1B6AA 2OKNA 1XGSA 1QZYA 3PKCA 1R5GA 1CHMA 4B28A 2Q96A 4U6EA 4S2TP 3CB5A 4U73A 4A6VA 2BWXA 1WBQA 4HXXA 4FLIA 1WL6A 1C24A 4U70A 2Q92A 4RGZ1 2GG3A 1A16A 4ZNGA 3CTZA 4U6ZA 1PV9A 4U75A 2GA2A 1W7VA 2Q95A 1WY2A 2EA4A 1QXYA 5D6FA 2OAZA 3BIQA 2GG9A 1KQ0A 2GG5A 4S00A 2Q8KA 1C21A 4MATA 2ZSGA 2Q93A 2B3HA 3TAVA 2GG8A 1QXWA 1R5HA 2GG7A 2NQ7A 4S01A 3PKEA 4ZWOA 3IU8A 3L24A 2B3LA 2B3KA 3CB6A 1C22A 2EVMA 3MATA 4FLJA 4IKUA 4RZZA 2BWUA 2Q94A 1KQ9A 2BWYA 4U69A 2DFIA 3BIPA 5CLSA 1QXZA 2BWTA 5FCFA 2V3XA 3MR1A 4R60A 1YW8A 2GU7A 1XGNA 1N51A 1O0XA 1W2MA 3FM3A 2BWSA 4IPAA 1R58A 4ZWUA 3PKAA 4U76A 4FKCA 1YW7A 2ADUA 1C27A 1XGOA 4IKSA 1KP0A 5JI6A 4JUQA 3D27A 4PV4A 4OOKA 4A6WA 5JHUA 1XNZA
chains in the Genus database with same CATH topology
1WL9A 4RZYA 1YVMA 4PNCA 4S2RP 4IECA 2P9AA 1JAWA 2P98A 5CDEA 2EVCA 4QR8A 2GU6A 2G6PA 2V6CA 3RORA 5CDVA 1BN5A 2MATA 5CDLA 1Y1NA 2BH3A 4IF7A 1B59A 2BWVA 2BN7A 4IU6A 3TB5A 4FLKA 5CE6A 5FCHA 2GG2A 3Q6DA 2BHBA 2V3ZA 2IW2A 4U6CA 1WN1A 1XGMA 4Z7MA 2EVOA 4IKTA 4U1BA 3BITA 3PKBA 3FMQA 2GU4A 4U6WA 4KM3A 5E5BA 1BOAA 4IDYA 5CNXA 1YW9A 4FO7A 2GGBA 2NQ6A 4EGEA 3L7GA 2BHAA 4ZWPA 3S6BA 1WLRA 4FLLA 4U6JA 3IU7A 2BB7A 3PKDA 2GU5A 1MATA 3MX6A 2BHCA 4FO8A 1M35A 2GG0A 5CIKA 2EA2A 2HOWA 2BWWA 5D6EA 1C23A 1YJ3A 4U71A 3RVAA 3IG4A 2GTXA 2P99A 1WKMA 4FUKA 2V3YA 3FMRA 5JFRA 3IU9A 2BHDA 2GGCA 2GZ5A 4IKRA 1B6AA 2OKNA 1XGSA 1QZYA 3PKCA 1R5GA 1CHMA 4B28A 2Q96A 4U6EA 4S2TP 3CB5A 4U73A 4A6VA 2BWXA 1WBQA 4HXXA 4FLIA 1WL6A 1C24A 4U70A 2Q92A 4RGZ1 2GG3A 1A16A 4ZNGA 3CTZA 4U6ZA 1PV9A 4U75A 2GA2A 1W7VA 2Q95A 1WY2A 2EA4A 1QXYA 5D6FA 2OAZA 3BIQA 2GG9A 1KQ0A 2GG5A 4S00A 2Q8KA 1C21A 4MATA 2ZSGA 2Q93A 2B3HA 3TAVA 2GG8A 1QXWA 1R5HA 2GG7A 2NQ7A 4S01A 3PKEA 4ZWOA 3IU8A 3L24A 2B3LA 2B3KA 3CB6A 1C22A 2EVMA 3MATA 4FLJA 4IKUA 4RZZA 2BWUA 2Q94A 1KQ9A 2BWYA 4U69A 2DFIA 3BIPA 5CLSA 1QXZA 2BWTA 5FCFA 2V3XA 3MR1A 4R60A 1YW8A 2GU7A 1XGNA 1N51A 1O0XA 1W2MA 3FM3A 2BWSA 4IPAA 1R58A 4ZWUA 3PKAA 4U76A 4FKCA 1YW7A 2ADUA 1C27A 1XGOA 4IKSA 1KP0A 5JI6A 4JUQA 3D27A 4PV4A 4OOKA 4A6WA 5JHUA 1XNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WL9 A;  4RZY A;  1YVM A;  4PNC A;  4S2R P;  4IEC A;  2P9A A;  1JAW A;  2P98 A;  5CDE A;  2EVC A;  4QR8 A;  2GU6 A;  2G6P A;  2V6C A;  3ROR A;  5CDV A;  1BN5 A;  2MAT A;  5CDL A;  1Y1N A;  2BH3 A;  4IF7 A;  1B59 A;  2BWV A;  2BN7 A;  4IU6 A;  3TB5 A;  4FLK A;  5CE6 A;  5FCH A;  2GG2 A;  3Q6D A;  2BHB A;  2V3Z A;  2IW2 A;  4U6C A;  1WN1 A;  1XGM A;  4Z7M A;  2EVO A;  4IKT A;  4U1B A;  3BIT A;  3PKB A;  3FMQ A;  2GU4 A;  4U6W A;  4KM3 A;  5E5B A;  1BOA A;  4IDY A;  5CNX A;  1YW9 A;  4FO7 A;  2GGB A;  2NQ6 A;  4EGE A;  3L7G A;  2BHA A;  4ZWP A;  3S6B A;  1WLR A;  4FLL A;  4U6J A;  3IU7 A;  2BB7 A;  3PKD A;  2GU5 A;  1MAT A;  3MX6 A;  2BHC A;  4FO8 A;  1M35 A;  2GG0 A;  5CIK A;  2EA2 A;  2HOW A;  2BWW A;  5D6E A;  1C23 A;  1YJ3 A;  4U71 A;  3RVA A;  3IG4 A;  2GTX A;  2P99 A;  1WKM A;  4FUK A;  2V3Y A;  3FMR A;  5JFR A;  3IU9 A;  2BHD A;  2GGC A;  2GZ5 A;  4IKR A;  1B6A A;  2OKN A;  1XGS A;  1QZY A;  3PKC A;  1R5G A;  1CHM A;  4B28 A;  2Q96 A;  4U6E A;  4S2T P;  3CB5 A;  4U73 A;  4A6V A;  2BWX A;  1WBQ A;  4HXX A;  4FLI A;  1WL6 A;  1C24 A;  4U70 A;  2Q92 A;  4RGZ 1;  2GG3 A;  1A16 A;  4ZNG A;  3CTZ A;  4U6Z A;  1PV9 A;  4U75 A;  2GA2 A;  1W7V A;  2Q95 A;  1WY2 A;  2EA4 A;  1QXY A;  5D6F A;  2OAZ A;  3BIQ A;  2GG9 A;  1KQ0 A;  2GG5 A;  4S00 A;  2Q8K A;  1C21 A;  4MAT A;  2ZSG A;  2Q93 A;  2B3H A;  3TAV A;  2GG8 A;  1QXW A;  1R5H A;  2GG7 A;  2NQ7 A;  4S01 A;  3PKE A;  4ZWO A;  3IU8 A;  3L24 A;  2B3L A;  2B3K A;  3CB6 A;  1C22 A;  2EVM A;  3MAT A;  4FLJ A;  4IKU A;  4RZZ A;  2BWU A;  2Q94 A;  1KQ9 A;  2BWY A;  4U69 A;  2DFI A;  3BIP A;  5CLS A;  1QXZ A;  2BWT A;  5FCF A;  2V3X A;  3MR1 A;  4R60 A;  1YW8 A;  2GU7 A;  1XGN A;  1N51 A;  1O0X A;  1W2M A;  3FM3 A;  2BWS A;  4IPA A;  1R58 A;  4ZWU A;  3PKA A;  4U76 A;  4FKC A;  1YW7 A;  2ADU A;  1C27 A;  1XGO A;  4IKS A;  1KP0 A;  5JI6 A;  4JUQ A;  3D27 A;  4PV4 A;  4OOK A;  4A6W A;  5JHU A;  1XNZ A; 
#chains in the Genus database with same CATH topology
 1WL9 A;  4RZY A;  1YVM A;  4PNC A;  4S2R P;  4IEC A;  2P9A A;  1JAW A;  2P98 A;  5CDE A;  2EVC A;  4QR8 A;  2GU6 A;  2G6P A;  2V6C A;  3ROR A;  5CDV A;  1BN5 A;  2MAT A;  5CDL A;  1Y1N A;  2BH3 A;  4IF7 A;  1B59 A;  2BWV A;  2BN7 A;  4IU6 A;  3TB5 A;  4FLK A;  5CE6 A;  5FCH A;  2GG2 A;  3Q6D A;  2BHB A;  2V3Z A;  2IW2 A;  4U6C A;  1WN1 A;  1XGM A;  4Z7M A;  2EVO A;  4IKT A;  4U1B A;  3BIT A;  3PKB A;  3FMQ A;  2GU4 A;  4U6W A;  4KM3 A;  5E5B A;  1BOA A;  4IDY A;  5CNX A;  1YW9 A;  4FO7 A;  2GGB A;  2NQ6 A;  4EGE A;  3L7G A;  2BHA A;  4ZWP A;  3S6B A;  1WLR A;  4FLL A;  4U6J A;  3IU7 A;  2BB7 A;  3PKD A;  2GU5 A;  1MAT A;  3MX6 A;  2BHC A;  4FO8 A;  1M35 A;  2GG0 A;  5CIK A;  2EA2 A;  2HOW A;  2BWW A;  5D6E A;  1C23 A;  1YJ3 A;  4U71 A;  3RVA A;  3IG4 A;  2GTX A;  2P99 A;  1WKM A;  4FUK A;  2V3Y A;  3FMR A;  5JFR A;  3IU9 A;  2BHD A;  2GGC A;  2GZ5 A;  4IKR A;  1B6A A;  2OKN A;  1XGS A;  1QZY A;  3PKC A;  1R5G A;  1CHM A;  4B28 A;  2Q96 A;  4U6E A;  4S2T P;  3CB5 A;  4U73 A;  4A6V A;  2BWX A;  1WBQ A;  4HXX A;  4FLI A;  1WL6 A;  1C24 A;  4U70 A;  2Q92 A;  4RGZ 1;  2GG3 A;  1A16 A;  4ZNG A;  3CTZ A;  4U6Z A;  1PV9 A;  4U75 A;  2GA2 A;  1W7V A;  2Q95 A;  1WY2 A;  2EA4 A;  1QXY A;  5D6F A;  2OAZ A;  3BIQ A;  2GG9 A;  1KQ0 A;  2GG5 A;  4S00 A;  2Q8K A;  1C21 A;  4MAT A;  2ZSG A;  2Q93 A;  2B3H A;  3TAV A;  2GG8 A;  1QXW A;  1R5H A;  2GG7 A;  2NQ7 A;  4S01 A;  3PKE A;  4ZWO A;  3IU8 A;  3L24 A;  2B3L A;  2B3K A;  3CB6 A;  1C22 A;  2EVM A;  3MAT A;  4FLJ A;  4IKU A;  4RZZ A;  2BWU A;  2Q94 A;  1KQ9 A;  2BWY A;  4U69 A;  2DFI A;  3BIP A;  5CLS A;  1QXZ A;  2BWT A;  5FCF A;  2V3X A;  3MR1 A;  4R60 A;  1YW8 A;  2GU7 A;  1XGN A;  1N51 A;  1O0X A;  1W2M A;  3FM3 A;  2BWS A;  4IPA A;  1R58 A;  4ZWU A;  3PKA A;  4U76 A;  4FKC A;  1YW7 A;  2ADU A;  1C27 A;  1XGO A;  4IKS A;  1KP0 A;  5JI6 A;  4JUQ A;  3D27 A;  4PV4 A;  4OOK A;  4A6W A;  5JHU A;  1XNZ A; 
#chains in the Genus database with same CATH homology
 1WL9 A;  4RZY A;  1YVM A;  4PNC A;  4S2R P;  4IEC A;  2P9A A;  1JAW A;  2P98 A;  5CDE A;  2EVC A;  4QR8 A;  2GU6 A;  2G6P A;  2V6C A;  3ROR A;  5CDV A;  1BN5 A;  2MAT A;  5CDL A;  1Y1N A;  2BH3 A;  4IF7 A;  1B59 A;  2BWV A;  2BN7 A;  4IU6 A;  3TB5 A;  4FLK A;  5CE6 A;  5FCH A;  2GG2 A;  3Q6D A;  2BHB A;  2V3Z A;  2IW2 A;  4U6C A;  1WN1 A;  1XGM A;  4Z7M A;  2EVO A;  4IKT A;  4U1B A;  3BIT A;  3PKB A;  3FMQ A;  2GU4 A;  4U6W A;  4KM3 A;  5E5B A;  1BOA A;  4IDY A;  5CNX A;  1YW9 A;  4FO7 A;  2GGB A;  2NQ6 A;  4EGE A;  3L7G A;  2BHA A;  4ZWP A;  3S6B A;  1WLR A;  4FLL A;  4U6J A;  3IU7 A;  2BB7 A;  3PKD A;  2GU5 A;  1MAT A;  3MX6 A;  2BHC A;  4FO8 A;  1M35 A;  2GG0 A;  5CIK A;  2EA2 A;  2HOW A;  2BWW A;  5D6E A;  1C23 A;  1YJ3 A;  4U71 A;  3RVA A;  3IG4 A;  2GTX A;  2P99 A;  1WKM A;  4FUK A;  2V3Y A;  3FMR A;  5JFR A;  3IU9 A;  2BHD A;  2GGC A;  2GZ5 A;  4IKR A;  1B6A A;  2OKN A;  1XGS A;  1QZY A;  3PKC A;  1R5G A;  1CHM A;  4B28 A;  2Q96 A;  4U6E A;  4S2T P;  3CB5 A;  4U73 A;  4A6V A;  2BWX A;  1WBQ A;  4HXX A;  4FLI A;  1WL6 A;  1C24 A;  4U70 A;  2Q92 A;  4RGZ 1;  2GG3 A;  1A16 A;  4ZNG A;  3CTZ A;  4U6Z A;  1PV9 A;  4U75 A;  2GA2 A;  1W7V A;  2Q95 A;  1WY2 A;  2EA4 A;  1QXY A;  5D6F A;  2OAZ A;  3BIQ A;  2GG9 A;  1KQ0 A;  2GG5 A;  4S00 A;  2Q8K A;  1C21 A;  4MAT A;  2ZSG A;  2Q93 A;  2B3H A;  3TAV A;  2GG8 A;  1QXW A;  1R5H A;  2GG7 A;  2NQ7 A;  4S01 A;  3PKE A;  4ZWO A;  3IU8 A;  3L24 A;  2B3L A;  2B3K A;  3CB6 A;  1C22 A;  2EVM A;  3MAT A;  4FLJ A;  4IKU A;  4RZZ A;  2BWU A;  2Q94 A;  1KQ9 A;  2BWY A;  4U69 A;  2DFI A;  3BIP A;  5CLS A;  1QXZ A;  2BWT A;  5FCF A;  2V3X A;  3MR1 A;  4R60 A;  1YW8 A;  2GU7 A;  1XGN A;  1N51 A;  1O0X A;  1W2M A;  3FM3 A;  2BWS A;  4IPA A;  1R58 A;  4ZWU A;  3PKA A;  4U76 A;  4FKC A;  1YW7 A;  2ADU A;  1C27 A;  1XGO A;  4IKS A;  1KP0 A;  5JI6 A;  4JUQ A;  3D27 A;  4PV4 A;  4OOK A;  4A6W A;  5JHU A;  1XNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...