2GG9A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 86
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg9A00
3TB5A 4U70A 2OAZA 2B3HA 3IG4A 2V3XA 4IKRA 2P9AA 5CLSA 3PKBA 2EVMA 2EVCA 4RZZA 3L7GA 3PKEA 2Q92A 2GZ5A 3CB5A 4A6VA 2GG8A 2GTXA 3BIPA 2BHCA 4U73A 4B28A 3IU9A 1M35A 2GGCA 2NQ7A 2V6CA 4ZNGA 3MX6A 1QXYA 2B3KA 4MATA 2EVOA 1C22A 3RVAA 4S2TP 1KQ0A 2BWUA 4S00A 1B59A 4ZWUA 2NQ6A 4HXXA 2P99A 1WN1A 4FO8A 1R5GA 1WL9A 1XGNA 2GG5A 2B3LA 1XGMA 4KM3A 1WKMA 2BHDA 4JUQA 1WBQA 5D6EA 2GG0A 3FM3A 2DFIA 1Y1NA 5CDEA 4U75A 4IKUA 4FLJA 1XNZA 2GU6A 4QR8A 2OKNA 3IU7A 4FLIA 4ZWOA 2GG9A 4FLKA 4RGZ1 5CNXA 1BN5A 4A6WA 2HOWA 4PV4A 4U71A 2GG3A 2BWXA 3BIQA 4U1BA 4U6EA 2BWTA 5JI6A 1W2MA 4U6WA 5CIKA 5JHUA 4R60A 3FMQA 5CDVA 5JFRA 4FUKA 2V3YA 1QXZA 1R58A 4IKTA 1PV9A 2Q8KA 4IF7A 1KQ9A 3Q6DA 1C23A 4PNCA 1XGSA 3FMRA 2G6PA 4S2RP 1WY2A 1YW9A 4U69A 2BWWA 4U6ZA 2BH3A 4IECA 3RORA 2MATA 4EGEA 1W7VA 3D27A 1C27A 2BHBA 1QXWA 2GU7A 1MATA 1O0XA 2Q95A 1JAWA 4FLLA 4ZWPA 1XGOA 2GG2A 2GA2A 2EA2A 3TAVA 2BWVA 2BWSA 2GU5A 2GU4A 3IU8A 3CTZA 2BN7A 2BWYA 3PKAA 2BHAA 4IDYA 4U6CA 2ADUA 5D6FA 4S01A 1B6AA 4U76A 3BITA 3L24A 1YJ3A 1N51A 5FCHA 1YW8A 1QZYA 4U6JA 3PKDA 4RZYA 3PKCA 2Q96A 4FKCA 2BB7A 2V3ZA 5E5BA 5CE6A 1KP0A 2EA4A 1BOAA 1WLRA 1A16A 2Q93A 3MATA 2Q94A 2ZSGA 2IW2A 1YVMA 2P98A 1C24A 1C21A 3S6BA 5FCFA 2GGBA 4Z7MA 5CDLA 4IU6A 4IKSA 1YW7A 4FO7A 3CB6A 4OOKA 4IPAA 2GG7A 1CHMA 1WL6A 3MR1A 1R5HA
chains in the Genus database with same CATH superfamily
3TB5A 4U70A 2OAZA 2B3HA 3IG4A 2V3XA 4IKRA 2P9AA 5CLSA 3PKBA 2EVMA 2EVCA 4RZZA 3L7GA 3PKEA 2Q92A 2GZ5A 3CB5A 4A6VA 2GG8A 2GTXA 3BIPA 2BHCA 4U73A 4B28A 3IU9A 1M35A 2GGCA 2NQ7A 2V6CA 4ZNGA 3MX6A 1QXYA 2B3KA 4MATA 2EVOA 1C22A 3RVAA 4S2TP 1KQ0A 2BWUA 4S00A 1B59A 4ZWUA 2NQ6A 4HXXA 2P99A 1WN1A 4FO8A 1R5GA 1WL9A 1XGNA 2GG5A 2B3LA 1XGMA 4KM3A 1WKMA 2BHDA 4JUQA 1WBQA 5D6EA 2GG0A 3FM3A 2DFIA 1Y1NA 5CDEA 4U75A 4IKUA 4FLJA 1XNZA 2GU6A 4QR8A 2OKNA 3IU7A 4FLIA 4ZWOA 2GG9A 4FLKA 4RGZ1 5CNXA 1BN5A 4A6WA 2HOWA 4PV4A 4U71A 2GG3A 2BWXA 3BIQA 4U1BA 4U6EA 2BWTA 5JI6A 1W2MA 4U6WA 5CIKA 5JHUA 4R60A 3FMQA 5CDVA 5JFRA 4FUKA 2V3YA 1QXZA 1R58A 4IKTA 1PV9A 2Q8KA 4IF7A 1KQ9A 3Q6DA 1C23A 4PNCA 1XGSA 3FMRA 2G6PA 4S2RP 1WY2A 1YW9A 4U69A 2BWWA 4U6ZA 2BH3A 4IECA 3RORA 2MATA 4EGEA 1W7VA 3D27A 1C27A 2BHBA 1QXWA 2GU7A 1MATA 1O0XA 2Q95A 1JAWA 4FLLA 4ZWPA 1XGOA 2GG2A 2GA2A 2EA2A 3TAVA 2BWVA 2BWSA 2GU5A 2GU4A 3IU8A 3CTZA 2BN7A 2BWYA 3PKAA 2BHAA 4IDYA 4U6CA 2ADUA 5D6FA 4S01A 1B6AA 4U76A 3BITA 3L24A 1YJ3A 1N51A 5FCHA 1YW8A 1QZYA 4U6JA 3PKDA 4RZYA 3PKCA 2Q96A 4FKCA 2BB7A 2V3ZA 5E5BA 5CE6A 1KP0A 2EA4A 1BOAA 1WLRA 1A16A 2Q93A 3MATA 2Q94A 2ZSGA 2IW2A 1YVMA 2P98A 1C24A 1C21A 3S6BA 5FCFA 2GGBA 4Z7MA 5CDLA 4IU6A 4IKSA 1YW7A 4FO7A 3CB6A 4OOKA 4IPAA 2GG7A 1CHMA 1WL6A 3MR1A 1R5HA
chains in the Genus database with same CATH topology
3TB5A 4U70A 2OAZA 2B3HA 3IG4A 2V3XA 4IKRA 2P9AA 5CLSA 3PKBA 2EVMA 2EVCA 4RZZA 3L7GA 3PKEA 2Q92A 2GZ5A 3CB5A 4A6VA 2GG8A 2GTXA 3BIPA 2BHCA 4U73A 4B28A 3IU9A 1M35A 2GGCA 2NQ7A 2V6CA 4ZNGA 3MX6A 1QXYA 2B3KA 4MATA 2EVOA 1C22A 3RVAA 4S2TP 1KQ0A 2BWUA 4S00A 1B59A 4ZWUA 2NQ6A 4HXXA 2P99A 1WN1A 4FO8A 1R5GA 1WL9A 1XGNA 2GG5A 2B3LA 1XGMA 4KM3A 1WKMA 2BHDA 4JUQA 1WBQA 5D6EA 2GG0A 3FM3A 2DFIA 1Y1NA 5CDEA 4U75A 4IKUA 4FLJA 1XNZA 2GU6A 4QR8A 2OKNA 3IU7A 4FLIA 4ZWOA 2GG9A 4FLKA 4RGZ1 5CNXA 1BN5A 4A6WA 2HOWA 4PV4A 4U71A 2GG3A 2BWXA 3BIQA 4U1BA 4U6EA 2BWTA 5JI6A 1W2MA 4U6WA 5CIKA 5JHUA 4R60A 3FMQA 5CDVA 5JFRA 4FUKA 2V3YA 1QXZA 1R58A 4IKTA 1PV9A 2Q8KA 4IF7A 1KQ9A 3Q6DA 1C23A 4PNCA 1XGSA 3FMRA 2G6PA 4S2RP 1WY2A 1YW9A 4U69A 2BWWA 4U6ZA 2BH3A 4IECA 3RORA 2MATA 4EGEA 1W7VA 3D27A 1C27A 2BHBA 1QXWA 2GU7A 1MATA 1O0XA 2Q95A 1JAWA 4FLLA 4ZWPA 1XGOA 2GG2A 2GA2A 2EA2A 3TAVA 2BWVA 2BWSA 2GU5A 2GU4A 3IU8A 3CTZA 2BN7A 2BWYA 3PKAA 2BHAA 4IDYA 4U6CA 2ADUA 5D6FA 4S01A 1B6AA 4U76A 3BITA 3L24A 1YJ3A 1N51A 5FCHA 1YW8A 1QZYA 4U6JA 3PKDA 4RZYA 3PKCA 2Q96A 4FKCA 2BB7A 2V3ZA 5E5BA 5CE6A 1KP0A 2EA4A 1BOAA 1WLRA 1A16A 2Q93A 3MATA 2Q94A 2ZSGA 2IW2A 1YVMA 2P98A 1C24A 1C21A 3S6BA 5FCFA 2GGBA 4Z7MA 5CDLA 4IU6A 4IKSA 1YW7A 4FO7A 3CB6A 4OOKA 4IPAA 2GG7A 1CHMA 1WL6A 3MR1A 1R5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TB5 A;  4U70 A;  2OAZ A;  2B3H A;  3IG4 A;  2V3X A;  4IKR A;  2P9A A;  5CLS A;  3PKB A;  2EVM A;  2EVC A;  4RZZ A;  3L7G A;  3PKE A;  2Q92 A;  2GZ5 A;  3CB5 A;  4A6V A;  2GG8 A;  2GTX A;  3BIP A;  2BHC A;  4U73 A;  4B28 A;  3IU9 A;  1M35 A;  2GGC A;  2NQ7 A;  2V6C A;  4ZNG A;  3MX6 A;  1QXY A;  2B3K A;  4MAT A;  2EVO A;  1C22 A;  3RVA A;  4S2T P;  1KQ0 A;  2BWU A;  4S00 A;  1B59 A;  4ZWU A;  2NQ6 A;  4HXX A;  2P99 A;  1WN1 A;  4FO8 A;  1R5G A;  1WL9 A;  1XGN A;  2GG5 A;  2B3L A;  1XGM A;  4KM3 A;  1WKM A;  2BHD A;  4JUQ A;  1WBQ A;  5D6E A;  2GG0 A;  3FM3 A;  2DFI A;  1Y1N A;  5CDE A;  4U75 A;  4IKU A;  4FLJ A;  1XNZ A;  2GU6 A;  4QR8 A;  2OKN A;  3IU7 A;  4FLI A;  4ZWO A;  2GG9 A;  4FLK A;  4RGZ 1;  5CNX A;  1BN5 A;  4A6W A;  2HOW A;  4PV4 A;  4U71 A;  2GG3 A;  2BWX A;  3BIQ A;  4U1B A;  4U6E A;  2BWT A;  5JI6 A;  1W2M A;  4U6W A;  5CIK A;  5JHU A;  4R60 A;  3FMQ A;  5CDV A;  5JFR A;  4FUK A;  2V3Y A;  1QXZ A;  1R58 A;  4IKT A;  1PV9 A;  2Q8K A;  4IF7 A;  1KQ9 A;  3Q6D A;  1C23 A;  4PNC A;  1XGS A;  3FMR A;  2G6P A;  4S2R P;  1WY2 A;  1YW9 A;  4U69 A;  2BWW A;  4U6Z A;  2BH3 A;  4IEC A;  3ROR A;  2MAT A;  4EGE A;  1W7V A;  3D27 A;  1C27 A;  2BHB A;  1QXW A;  2GU7 A;  1MAT A;  1O0X A;  2Q95 A;  1JAW A;  4FLL A;  4ZWP A;  1XGO A;  2GG2 A;  2GA2 A;  2EA2 A;  3TAV A;  2BWV A;  2BWS A;  2GU5 A;  2GU4 A;  3IU8 A;  3CTZ A;  2BN7 A;  2BWY A;  3PKA A;  2BHA A;  4IDY A;  4U6C A;  2ADU A;  5D6F A;  4S01 A;  1B6A A;  4U76 A;  3BIT A;  3L24 A;  1YJ3 A;  1N51 A;  5FCH A;  1YW8 A;  1QZY A;  4U6J A;  3PKD A;  4RZY A;  3PKC A;  2Q96 A;  4FKC A;  2BB7 A;  2V3Z A;  5E5B A;  5CE6 A;  1KP0 A;  2EA4 A;  1BOA A;  1WLR A;  1A16 A;  2Q93 A;  3MAT A;  2Q94 A;  2ZSG A;  2IW2 A;  1YVM A;  2P98 A;  1C24 A;  1C21 A;  3S6B A;  5FCF A;  2GGB A;  4Z7M A;  5CDL A;  4IU6 A;  4IKS A;  1YW7 A;  4FO7 A;  3CB6 A;  4OOK A;  4IPA A;  2GG7 A;  1CHM A;  1WL6 A;  3MR1 A;  1R5H A; 
#chains in the Genus database with same CATH topology
 3TB5 A;  4U70 A;  2OAZ A;  2B3H A;  3IG4 A;  2V3X A;  4IKR A;  2P9A A;  5CLS A;  3PKB A;  2EVM A;  2EVC A;  4RZZ A;  3L7G A;  3PKE A;  2Q92 A;  2GZ5 A;  3CB5 A;  4A6V A;  2GG8 A;  2GTX A;  3BIP A;  2BHC A;  4U73 A;  4B28 A;  3IU9 A;  1M35 A;  2GGC A;  2NQ7 A;  2V6C A;  4ZNG A;  3MX6 A;  1QXY A;  2B3K A;  4MAT A;  2EVO A;  1C22 A;  3RVA A;  4S2T P;  1KQ0 A;  2BWU A;  4S00 A;  1B59 A;  4ZWU A;  2NQ6 A;  4HXX A;  2P99 A;  1WN1 A;  4FO8 A;  1R5G A;  1WL9 A;  1XGN A;  2GG5 A;  2B3L A;  1XGM A;  4KM3 A;  1WKM A;  2BHD A;  4JUQ A;  1WBQ A;  5D6E A;  2GG0 A;  3FM3 A;  2DFI A;  1Y1N A;  5CDE A;  4U75 A;  4IKU A;  4FLJ A;  1XNZ A;  2GU6 A;  4QR8 A;  2OKN A;  3IU7 A;  4FLI A;  4ZWO A;  2GG9 A;  4FLK A;  4RGZ 1;  5CNX A;  1BN5 A;  4A6W A;  2HOW A;  4PV4 A;  4U71 A;  2GG3 A;  2BWX A;  3BIQ A;  4U1B A;  4U6E A;  2BWT A;  5JI6 A;  1W2M A;  4U6W A;  5CIK A;  5JHU A;  4R60 A;  3FMQ A;  5CDV A;  5JFR A;  4FUK A;  2V3Y A;  1QXZ A;  1R58 A;  4IKT A;  1PV9 A;  2Q8K A;  4IF7 A;  1KQ9 A;  3Q6D A;  1C23 A;  4PNC A;  1XGS A;  3FMR A;  2G6P A;  4S2R P;  1WY2 A;  1YW9 A;  4U69 A;  2BWW A;  4U6Z A;  2BH3 A;  4IEC A;  3ROR A;  2MAT A;  4EGE A;  1W7V A;  3D27 A;  1C27 A;  2BHB A;  1QXW A;  2GU7 A;  1MAT A;  1O0X A;  2Q95 A;  1JAW A;  4FLL A;  4ZWP A;  1XGO A;  2GG2 A;  2GA2 A;  2EA2 A;  3TAV A;  2BWV A;  2BWS A;  2GU5 A;  2GU4 A;  3IU8 A;  3CTZ A;  2BN7 A;  2BWY A;  3PKA A;  2BHA A;  4IDY A;  4U6C A;  2ADU A;  5D6F A;  4S01 A;  1B6A A;  4U76 A;  3BIT A;  3L24 A;  1YJ3 A;  1N51 A;  5FCH A;  1YW8 A;  1QZY A;  4U6J A;  3PKD A;  4RZY A;  3PKC A;  2Q96 A;  4FKC A;  2BB7 A;  2V3Z A;  5E5B A;  5CE6 A;  1KP0 A;  2EA4 A;  1BOA A;  1WLR A;  1A16 A;  2Q93 A;  3MAT A;  2Q94 A;  2ZSG A;  2IW2 A;  1YVM A;  2P98 A;  1C24 A;  1C21 A;  3S6B A;  5FCF A;  2GGB A;  4Z7M A;  5CDL A;  4IU6 A;  4IKS A;  1YW7 A;  4FO7 A;  3CB6 A;  4OOK A;  4IPA A;  2GG7 A;  1CHM A;  1WL6 A;  3MR1 A;  1R5H A; 
#chains in the Genus database with same CATH homology
 3TB5 A;  4U70 A;  2OAZ A;  2B3H A;  3IG4 A;  2V3X A;  4IKR A;  2P9A A;  5CLS A;  3PKB A;  2EVM A;  2EVC A;  4RZZ A;  3L7G A;  3PKE A;  2Q92 A;  2GZ5 A;  3CB5 A;  4A6V A;  2GG8 A;  2GTX A;  3BIP A;  2BHC A;  4U73 A;  4B28 A;  3IU9 A;  1M35 A;  2GGC A;  2NQ7 A;  2V6C A;  4ZNG A;  3MX6 A;  1QXY A;  2B3K A;  4MAT A;  2EVO A;  1C22 A;  3RVA A;  4S2T P;  1KQ0 A;  2BWU A;  4S00 A;  1B59 A;  4ZWU A;  2NQ6 A;  4HXX A;  2P99 A;  1WN1 A;  4FO8 A;  1R5G A;  1WL9 A;  1XGN A;  2GG5 A;  2B3L A;  1XGM A;  4KM3 A;  1WKM A;  2BHD A;  4JUQ A;  1WBQ A;  5D6E A;  2GG0 A;  3FM3 A;  2DFI A;  1Y1N A;  5CDE A;  4U75 A;  4IKU A;  4FLJ A;  1XNZ A;  2GU6 A;  4QR8 A;  2OKN A;  3IU7 A;  4FLI A;  4ZWO A;  2GG9 A;  4FLK A;  4RGZ 1;  5CNX A;  1BN5 A;  4A6W A;  2HOW A;  4PV4 A;  4U71 A;  2GG3 A;  2BWX A;  3BIQ A;  4U1B A;  4U6E A;  2BWT A;  5JI6 A;  1W2M A;  4U6W A;  5CIK A;  5JHU A;  4R60 A;  3FMQ A;  5CDV A;  5JFR A;  4FUK A;  2V3Y A;  1QXZ A;  1R58 A;  4IKT A;  1PV9 A;  2Q8K A;  4IF7 A;  1KQ9 A;  3Q6D A;  1C23 A;  4PNC A;  1XGS A;  3FMR A;  2G6P A;  4S2R P;  1WY2 A;  1YW9 A;  4U69 A;  2BWW A;  4U6Z A;  2BH3 A;  4IEC A;  3ROR A;  2MAT A;  4EGE A;  1W7V A;  3D27 A;  1C27 A;  2BHB A;  1QXW A;  2GU7 A;  1MAT A;  1O0X A;  2Q95 A;  1JAW A;  4FLL A;  4ZWP A;  1XGO A;  2GG2 A;  2GA2 A;  2EA2 A;  3TAV A;  2BWV A;  2BWS A;  2GU5 A;  2GU4 A;  3IU8 A;  3CTZ A;  2BN7 A;  2BWY A;  3PKA A;  2BHA A;  4IDY A;  4U6C A;  2ADU A;  5D6F A;  4S01 A;  1B6A A;  4U76 A;  3BIT A;  3L24 A;  1YJ3 A;  1N51 A;  5FCH A;  1YW8 A;  1QZY A;  4U6J A;  3PKD A;  4RZY A;  3PKC A;  2Q96 A;  4FKC A;  2BB7 A;  2V3Z A;  5E5B A;  5CE6 A;  1KP0 A;  2EA4 A;  1BOA A;  1WLR A;  1A16 A;  2Q93 A;  3MAT A;  2Q94 A;  2ZSG A;  2IW2 A;  1YVM A;  2P98 A;  1C24 A;  1C21 A;  3S6B A;  5FCF A;  2GGB A;  4Z7M A;  5CDL A;  4IU6 A;  4IKS A;  1YW7 A;  4FO7 A;  3CB6 A;  4OOK A;  4IPA A;  2GG7 A;  1CHM A;  1WL6 A;  3MR1 A;  1R5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...