2GG9A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 86
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg9A00
3BIPA 4S2RP 4U76A 3S6BA 3IU9A 2MATA 1BOAA 1BN5A 1XGSA 1KQ9A 1R58A 2P99A 3IU8A 4ZWPA 2BHBA 4IKSA 2HOWA 1QXYA 3L24A 1JAWA 4HXXA 5CLSA 4PNCA 4U6EA 1B6AA 1C21A 5CDVA 4B28A 3IU7A 2GU5A 5CIKA 2EVOA 1M35A 2P98A 4Z7MA 2GG5A 5D6EA 4QR8A 2IW2A 2BWSA 4U73A 4A6VA 4FLJA 4U70A 3BIQA 1XGNA 2V6CA 1O0XA 4S00A 4EGEA 5CDEA 2NQ7A 5CDLA 2BWUA 2EVCA 2Q93A 2BWVA 2BWTA 1YW8A 2Q94A 1N51A 5JHUA 2EA2A 5E5BA 3PKAA 2B3LA 2DFIA 2BWWA 4R60A 1R5GA 1A16A 3FMRA 4U69A 1B59A 4A6WA 4U6CA 5JFRA 5FCHA 1W2MA 1YJ3A 1YVMA 3L7GA 3MATA 4IPAA 2BN7A 2GG2A 4S01A 1QXWA 2GTXA 4FUKA 2OKNA 4FLKA 2EA4A 2G6PA 4RGZ1 3TAVA 1MATA 4U6WA 4U1BA 1C22A 3D27A 4FKCA 5D6FA 1XGMA 1WKMA 2Q96A 2GG3A 5FCFA 4FLLA 4U75A 4JUQA 2BHAA 5CE6A 1CHMA 1W7VA 3PKDA 2BWXA 5JI6A 3MR1A 1YW9A 2EVMA 1C23A 4IKUA 2BHCA 2BWYA 1YW7A 2Q95A 2OAZA 4MATA 4U6JA 2GG9A 2GGBA 2GU4A 2GGCA 2GU6A 1QXZA 3MX6A 4S2TP 4OOKA 3FM3A 2V3XA 2V3YA 1C27A 4ZWOA 4ZWUA 4IDYA 3PKBA 4U71A 1WY2A 1QZYA 1KQ0A 3CB5A 4IU6A 3CB6A 1Y1NA 2Q8KA 2BHDA 4IKTA 1R5HA 4RZZA 4ZNGA 1C24A 4RZYA 2GZ5A 1KP0A 3RORA 1WBQA 5CNXA 3RVAA 1XNZA 3IG4A 1WLRA 2BB7A 2B3KA 3CTZA 4KM3A 4FO7A 1XGOA 4FO8A 4PV4A 2BH3A 2GG0A 4U6ZA 2GG8A 2GA2A 3TB5A 4IECA 1WL9A 2Q92A 2NQ6A 2V3ZA 4IF7A 4IKRA 1WN1A 3BITA 1PV9A 2ADUA 2ZSGA 3PKEA 4FLIA 3PKCA 2P9AA 2GU7A 3FMQA 1WL6A 2GG7A 3Q6DA 2B3HA
chains in the Genus database with same CATH superfamily
3BIPA 4S2RP 4U76A 3S6BA 3IU9A 2MATA 1BOAA 1BN5A 1XGSA 1KQ9A 1R58A 2P99A 3IU8A 4ZWPA 2BHBA 4IKSA 2HOWA 1QXYA 3L24A 1JAWA 4HXXA 5CLSA 4PNCA 4U6EA 1B6AA 1C21A 5CDVA 4B28A 3IU7A 2GU5A 5CIKA 2EVOA 1M35A 2P98A 4Z7MA 2GG5A 5D6EA 4QR8A 2IW2A 2BWSA 4U73A 4A6VA 4FLJA 4U70A 3BIQA 1XGNA 2V6CA 1O0XA 4S00A 4EGEA 5CDEA 2NQ7A 5CDLA 2BWUA 2EVCA 2Q93A 2BWVA 2BWTA 1YW8A 2Q94A 1N51A 5JHUA 2EA2A 5E5BA 3PKAA 2B3LA 2DFIA 2BWWA 4R60A 1R5GA 1A16A 3FMRA 4U69A 1B59A 4A6WA 4U6CA 5JFRA 5FCHA 1W2MA 1YJ3A 1YVMA 3L7GA 3MATA 4IPAA 2BN7A 2GG2A 4S01A 1QXWA 2GTXA 4FUKA 2OKNA 4FLKA 2EA4A 2G6PA 4RGZ1 3TAVA 1MATA 4U6WA 4U1BA 1C22A 3D27A 4FKCA 5D6FA 1XGMA 1WKMA 2Q96A 2GG3A 5FCFA 4FLLA 4U75A 4JUQA 2BHAA 5CE6A 1CHMA 1W7VA 3PKDA 2BWXA 5JI6A 3MR1A 1YW9A 2EVMA 1C23A 4IKUA 2BHCA 2BWYA 1YW7A 2Q95A 2OAZA 4MATA 4U6JA 2GG9A 2GGBA 2GU4A 2GGCA 2GU6A 1QXZA 3MX6A 4S2TP 4OOKA 3FM3A 2V3XA 2V3YA 1C27A 4ZWOA 4ZWUA 4IDYA 3PKBA 4U71A 1WY2A 1QZYA 1KQ0A 3CB5A 4IU6A 3CB6A 1Y1NA 2Q8KA 2BHDA 4IKTA 1R5HA 4RZZA 4ZNGA 1C24A 4RZYA 2GZ5A 1KP0A 3RORA 1WBQA 5CNXA 3RVAA 1XNZA 3IG4A 1WLRA 2BB7A 2B3KA 3CTZA 4KM3A 4FO7A 1XGOA 4FO8A 4PV4A 2BH3A 2GG0A 4U6ZA 2GG8A 2GA2A 3TB5A 4IECA 1WL9A 2Q92A 2NQ6A 2V3ZA 4IF7A 4IKRA 1WN1A 3BITA 1PV9A 2ADUA 2ZSGA 3PKEA 4FLIA 3PKCA 2P9AA 2GU7A 3FMQA 1WL6A 2GG7A 3Q6DA 2B3HA
chains in the Genus database with same CATH topology
3BIPA 4S2RP 4U76A 3S6BA 3IU9A 2MATA 1BOAA 1BN5A 1XGSA 1KQ9A 1R58A 2P99A 3IU8A 4ZWPA 2BHBA 4IKSA 2HOWA 1QXYA 3L24A 1JAWA 4HXXA 5CLSA 4PNCA 4U6EA 1B6AA 1C21A 5CDVA 4B28A 3IU7A 2GU5A 5CIKA 2EVOA 1M35A 2P98A 4Z7MA 2GG5A 5D6EA 4QR8A 2IW2A 2BWSA 4U73A 4A6VA 4FLJA 4U70A 3BIQA 1XGNA 2V6CA 1O0XA 4S00A 4EGEA 5CDEA 2NQ7A 5CDLA 2BWUA 2EVCA 2Q93A 2BWVA 2BWTA 1YW8A 2Q94A 1N51A 5JHUA 2EA2A 5E5BA 3PKAA 2B3LA 2DFIA 2BWWA 4R60A 1R5GA 1A16A 3FMRA 4U69A 1B59A 4A6WA 4U6CA 5JFRA 5FCHA 1W2MA 1YJ3A 1YVMA 3L7GA 3MATA 4IPAA 2BN7A 2GG2A 4S01A 1QXWA 2GTXA 4FUKA 2OKNA 4FLKA 2EA4A 2G6PA 4RGZ1 3TAVA 1MATA 4U6WA 4U1BA 1C22A 3D27A 4FKCA 5D6FA 1XGMA 1WKMA 2Q96A 2GG3A 5FCFA 4FLLA 4U75A 4JUQA 2BHAA 5CE6A 1CHMA 1W7VA 3PKDA 2BWXA 5JI6A 3MR1A 1YW9A 2EVMA 1C23A 4IKUA 2BHCA 2BWYA 1YW7A 2Q95A 2OAZA 4MATA 4U6JA 2GG9A 2GGBA 2GU4A 2GGCA 2GU6A 1QXZA 3MX6A 4S2TP 4OOKA 3FM3A 2V3XA 2V3YA 1C27A 4ZWOA 4ZWUA 4IDYA 3PKBA 4U71A 1WY2A 1QZYA 1KQ0A 3CB5A 4IU6A 3CB6A 1Y1NA 2Q8KA 2BHDA 4IKTA 1R5HA 4RZZA 4ZNGA 1C24A 4RZYA 2GZ5A 1KP0A 3RORA 1WBQA 5CNXA 3RVAA 1XNZA 3IG4A 1WLRA 2BB7A 2B3KA 3CTZA 4KM3A 4FO7A 1XGOA 4FO8A 4PV4A 2BH3A 2GG0A 4U6ZA 2GG8A 2GA2A 3TB5A 4IECA 1WL9A 2Q92A 2NQ6A 2V3ZA 4IF7A 4IKRA 1WN1A 3BITA 1PV9A 2ADUA 2ZSGA 3PKEA 4FLIA 3PKCA 2P9AA 2GU7A 3FMQA 1WL6A 2GG7A 3Q6DA 2B3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIP A;  4S2R P;  4U76 A;  3S6B A;  3IU9 A;  2MAT A;  1BOA A;  1BN5 A;  1XGS A;  1KQ9 A;  1R58 A;  2P99 A;  3IU8 A;  4ZWP A;  2BHB A;  4IKS A;  2HOW A;  1QXY A;  3L24 A;  1JAW A;  4HXX A;  5CLS A;  4PNC A;  4U6E A;  1B6A A;  1C21 A;  5CDV A;  4B28 A;  3IU7 A;  2GU5 A;  5CIK A;  2EVO A;  1M35 A;  2P98 A;  4Z7M A;  2GG5 A;  5D6E A;  4QR8 A;  2IW2 A;  2BWS A;  4U73 A;  4A6V A;  4FLJ A;  4U70 A;  3BIQ A;  1XGN A;  2V6C A;  1O0X A;  4S00 A;  4EGE A;  5CDE A;  2NQ7 A;  5CDL A;  2BWU A;  2EVC A;  2Q93 A;  2BWV A;  2BWT A;  1YW8 A;  2Q94 A;  1N51 A;  5JHU A;  2EA2 A;  5E5B A;  3PKA A;  2B3L A;  2DFI A;  2BWW A;  4R60 A;  1R5G A;  1A16 A;  3FMR A;  4U69 A;  1B59 A;  4A6W A;  4U6C A;  5JFR A;  5FCH A;  1W2M A;  1YJ3 A;  1YVM A;  3L7G A;  3MAT A;  4IPA A;  2BN7 A;  2GG2 A;  4S01 A;  1QXW A;  2GTX A;  4FUK A;  2OKN A;  4FLK A;  2EA4 A;  2G6P A;  4RGZ 1;  3TAV A;  1MAT A;  4U6W A;  4U1B A;  1C22 A;  3D27 A;  4FKC A;  5D6F A;  1XGM A;  1WKM A;  2Q96 A;  2GG3 A;  5FCF A;  4FLL A;  4U75 A;  4JUQ A;  2BHA A;  5CE6 A;  1CHM A;  1W7V A;  3PKD A;  2BWX A;  5JI6 A;  3MR1 A;  1YW9 A;  2EVM A;  1C23 A;  4IKU A;  2BHC A;  2BWY A;  1YW7 A;  2Q95 A;  2OAZ A;  4MAT A;  4U6J A;  2GG9 A;  2GGB A;  2GU4 A;  2GGC A;  2GU6 A;  1QXZ A;  3MX6 A;  4S2T P;  4OOK A;  3FM3 A;  2V3X A;  2V3Y A;  1C27 A;  4ZWO A;  4ZWU A;  4IDY A;  3PKB A;  4U71 A;  1WY2 A;  1QZY A;  1KQ0 A;  3CB5 A;  4IU6 A;  3CB6 A;  1Y1N A;  2Q8K A;  2BHD A;  4IKT A;  1R5H A;  4RZZ A;  4ZNG A;  1C24 A;  4RZY A;  2GZ5 A;  1KP0 A;  3ROR A;  1WBQ A;  5CNX A;  3RVA A;  1XNZ A;  3IG4 A;  1WLR A;  2BB7 A;  2B3K A;  3CTZ A;  4KM3 A;  4FO7 A;  1XGO A;  4FO8 A;  4PV4 A;  2BH3 A;  2GG0 A;  4U6Z A;  2GG8 A;  2GA2 A;  3TB5 A;  4IEC A;  1WL9 A;  2Q92 A;  2NQ6 A;  2V3Z A;  4IF7 A;  4IKR A;  1WN1 A;  3BIT A;  1PV9 A;  2ADU A;  2ZSG A;  3PKE A;  4FLI A;  3PKC A;  2P9A A;  2GU7 A;  3FMQ A;  1WL6 A;  2GG7 A;  3Q6D A;  2B3H A; 
#chains in the Genus database with same CATH topology
 3BIP A;  4S2R P;  4U76 A;  3S6B A;  3IU9 A;  2MAT A;  1BOA A;  1BN5 A;  1XGS A;  1KQ9 A;  1R58 A;  2P99 A;  3IU8 A;  4ZWP A;  2BHB A;  4IKS A;  2HOW A;  1QXY A;  3L24 A;  1JAW A;  4HXX A;  5CLS A;  4PNC A;  4U6E A;  1B6A A;  1C21 A;  5CDV A;  4B28 A;  3IU7 A;  2GU5 A;  5CIK A;  2EVO A;  1M35 A;  2P98 A;  4Z7M A;  2GG5 A;  5D6E A;  4QR8 A;  2IW2 A;  2BWS A;  4U73 A;  4A6V A;  4FLJ A;  4U70 A;  3BIQ A;  1XGN A;  2V6C A;  1O0X A;  4S00 A;  4EGE A;  5CDE A;  2NQ7 A;  5CDL A;  2BWU A;  2EVC A;  2Q93 A;  2BWV A;  2BWT A;  1YW8 A;  2Q94 A;  1N51 A;  5JHU A;  2EA2 A;  5E5B A;  3PKA A;  2B3L A;  2DFI A;  2BWW A;  4R60 A;  1R5G A;  1A16 A;  3FMR A;  4U69 A;  1B59 A;  4A6W A;  4U6C A;  5JFR A;  5FCH A;  1W2M A;  1YJ3 A;  1YVM A;  3L7G A;  3MAT A;  4IPA A;  2BN7 A;  2GG2 A;  4S01 A;  1QXW A;  2GTX A;  4FUK A;  2OKN A;  4FLK A;  2EA4 A;  2G6P A;  4RGZ 1;  3TAV A;  1MAT A;  4U6W A;  4U1B A;  1C22 A;  3D27 A;  4FKC A;  5D6F A;  1XGM A;  1WKM A;  2Q96 A;  2GG3 A;  5FCF A;  4FLL A;  4U75 A;  4JUQ A;  2BHA A;  5CE6 A;  1CHM A;  1W7V A;  3PKD A;  2BWX A;  5JI6 A;  3MR1 A;  1YW9 A;  2EVM A;  1C23 A;  4IKU A;  2BHC A;  2BWY A;  1YW7 A;  2Q95 A;  2OAZ A;  4MAT A;  4U6J A;  2GG9 A;  2GGB A;  2GU4 A;  2GGC A;  2GU6 A;  1QXZ A;  3MX6 A;  4S2T P;  4OOK A;  3FM3 A;  2V3X A;  2V3Y A;  1C27 A;  4ZWO A;  4ZWU A;  4IDY A;  3PKB A;  4U71 A;  1WY2 A;  1QZY A;  1KQ0 A;  3CB5 A;  4IU6 A;  3CB6 A;  1Y1N A;  2Q8K A;  2BHD A;  4IKT A;  1R5H A;  4RZZ A;  4ZNG A;  1C24 A;  4RZY A;  2GZ5 A;  1KP0 A;  3ROR A;  1WBQ A;  5CNX A;  3RVA A;  1XNZ A;  3IG4 A;  1WLR A;  2BB7 A;  2B3K A;  3CTZ A;  4KM3 A;  4FO7 A;  1XGO A;  4FO8 A;  4PV4 A;  2BH3 A;  2GG0 A;  4U6Z A;  2GG8 A;  2GA2 A;  3TB5 A;  4IEC A;  1WL9 A;  2Q92 A;  2NQ6 A;  2V3Z A;  4IF7 A;  4IKR A;  1WN1 A;  3BIT A;  1PV9 A;  2ADU A;  2ZSG A;  3PKE A;  4FLI A;  3PKC A;  2P9A A;  2GU7 A;  3FMQ A;  1WL6 A;  2GG7 A;  3Q6D A;  2B3H A; 
#chains in the Genus database with same CATH homology
 3BIP A;  4S2R P;  4U76 A;  3S6B A;  3IU9 A;  2MAT A;  1BOA A;  1BN5 A;  1XGS A;  1KQ9 A;  1R58 A;  2P99 A;  3IU8 A;  4ZWP A;  2BHB A;  4IKS A;  2HOW A;  1QXY A;  3L24 A;  1JAW A;  4HXX A;  5CLS A;  4PNC A;  4U6E A;  1B6A A;  1C21 A;  5CDV A;  4B28 A;  3IU7 A;  2GU5 A;  5CIK A;  2EVO A;  1M35 A;  2P98 A;  4Z7M A;  2GG5 A;  5D6E A;  4QR8 A;  2IW2 A;  2BWS A;  4U73 A;  4A6V A;  4FLJ A;  4U70 A;  3BIQ A;  1XGN A;  2V6C A;  1O0X A;  4S00 A;  4EGE A;  5CDE A;  2NQ7 A;  5CDL A;  2BWU A;  2EVC A;  2Q93 A;  2BWV A;  2BWT A;  1YW8 A;  2Q94 A;  1N51 A;  5JHU A;  2EA2 A;  5E5B A;  3PKA A;  2B3L A;  2DFI A;  2BWW A;  4R60 A;  1R5G A;  1A16 A;  3FMR A;  4U69 A;  1B59 A;  4A6W A;  4U6C A;  5JFR A;  5FCH A;  1W2M A;  1YJ3 A;  1YVM A;  3L7G A;  3MAT A;  4IPA A;  2BN7 A;  2GG2 A;  4S01 A;  1QXW A;  2GTX A;  4FUK A;  2OKN A;  4FLK A;  2EA4 A;  2G6P A;  4RGZ 1;  3TAV A;  1MAT A;  4U6W A;  4U1B A;  1C22 A;  3D27 A;  4FKC A;  5D6F A;  1XGM A;  1WKM A;  2Q96 A;  2GG3 A;  5FCF A;  4FLL A;  4U75 A;  4JUQ A;  2BHA A;  5CE6 A;  1CHM A;  1W7V A;  3PKD A;  2BWX A;  5JI6 A;  3MR1 A;  1YW9 A;  2EVM A;  1C23 A;  4IKU A;  2BHC A;  2BWY A;  1YW7 A;  2Q95 A;  2OAZ A;  4MAT A;  4U6J A;  2GG9 A;  2GGB A;  2GU4 A;  2GGC A;  2GU6 A;  1QXZ A;  3MX6 A;  4S2T P;  4OOK A;  3FM3 A;  2V3X A;  2V3Y A;  1C27 A;  4ZWO A;  4ZWU A;  4IDY A;  3PKB A;  4U71 A;  1WY2 A;  1QZY A;  1KQ0 A;  3CB5 A;  4IU6 A;  3CB6 A;  1Y1N A;  2Q8K A;  2BHD A;  4IKT A;  1R5H A;  4RZZ A;  4ZNG A;  1C24 A;  4RZY A;  2GZ5 A;  1KP0 A;  3ROR A;  1WBQ A;  5CNX A;  3RVA A;  1XNZ A;  3IG4 A;  1WLR A;  2BB7 A;  2B3K A;  3CTZ A;  4KM3 A;  4FO7 A;  1XGO A;  4FO8 A;  4PV4 A;  2BH3 A;  2GG0 A;  4U6Z A;  2GG8 A;  2GA2 A;  3TB5 A;  4IEC A;  1WL9 A;  2Q92 A;  2NQ6 A;  2V3Z A;  4IF7 A;  4IKR A;  1WN1 A;  3BIT A;  1PV9 A;  2ADU A;  2ZSG A;  3PKE A;  4FLI A;  3PKC A;  2P9A A;  2GU7 A;  3FMQ A;  1WL6 A;  2GG7 A;  3Q6D A;  2B3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...