2GG9A

Novel bacterial methionine aminopeptidase inhibitors
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 86
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2gg9A00
4ZWOA 2GG5A 4U6CA 5D6FA 2IW2A 4U73A 4FUKA 1B59A 3FMRA 1C23A 2ZSGA 2GG9A 2BHAA 2P99A 4U69A 4U75A 4ZNGA 1YW8A 4FLKA 2OKNA 2BWUA 2BWTA 1WY2A 2BB7A 2GU7A 2GG8A 3CB6A 1KQ0A 1PV9A 1QXYA 2Q95A 2Q8KA 3TB5A 4U1BA 4PV4A 2V3ZA 2V3YA 3L7GA 1N51A 1O0XA 2GU5A 1YJ3A 4FLLA 1R5HA 4KM3A 5FCHA 2Q96A 4FO7A 2B3LA 4JUQA 2B3KA 2P98A 1A16A 1WKMA 5FCFA 3TAVA 3MX6A 2BHBA 2EA2A 4S00A 3L24A 3PKCA 4S2RP 4U76A 5JI6A 1C22A 2BH3A 1XGOA 2EVCA 4IECA 1YW7A 4QR8A 5E5BA 1WL9A 2BWYA 5CNXA 1CHMA 4RGZ1 5JFRA 2GG7A 2HOWA 1W7VA 2P9AA 4IF7A 1QXWA 5CE6A 3FMQA 2Q94A 2BHDA 4IKRA 4FLIA 2Q92A 5CIKA 2OAZA 4U6ZA 2GGCA 4RZZA 4RZYA 2B3HA 4PNCA 3PKBA 2BWXA 5CDLA 2BN7A 2GU6A 1XGMA 1Y1NA 1KP0A 5D6EA 4EGEA 1BN5A 4U71A 1XNZA 2ADUA 2GU4A 4U6EA 5CDEA 2Q93A 3IG4A 3RVAA 2EVOA 3BIPA 2GG2A 3FM3A 2NQ6A 4FLJA 1YVMA 3S6BA 4B28A 4S01A 3MR1A 3MATA 2BWWA 2EVMA 4HXXA 3IU7A 2GG3A 4MATA 4A6VA 2MATA 2GG0A 2V6CA 4ZWPA 4R60A 2NQ7A 4OOKA 3CB5A 4IKSA 4U6JA 4FKCA 1JAWA 4IU6A 2EA4A 1C27A 3D27A 1QZYA 2GGBA 1WL6A 1C21A 4IKTA 3BIQA 5CDVA 2BWSA 2BHCA 3Q6DA 2DFIA 1R58A 2GA2A 1W2MA 2GTXA 2G6PA 1B6AA 3IU9A 4U6WA 1MATA 4IKUA 1C24A 1WBQA 3CTZA 4IPAA 4U70A 5CLSA 3BITA 1M35A 2V3XA 4FO8A 1XGNA 3PKDA 1WLRA 4ZWUA 3RORA 1QXZA 1XGSA 1YW9A 3PKEA 1R5GA 4A6WA 1KQ9A 2BWVA 3PKAA 4S2TP 5JHUA 4IDYA 3IU8A 2GZ5A 1WN1A 4Z7MA 1BOAA
chains in the Genus database with same CATH superfamily
4ZWOA 2GG5A 4U6CA 5D6FA 2IW2A 4U73A 4FUKA 1B59A 3FMRA 1C23A 2ZSGA 2GG9A 2BHAA 2P99A 4U69A 4U75A 4ZNGA 1YW8A 4FLKA 2OKNA 2BWUA 2BWTA 1WY2A 2BB7A 2GU7A 2GG8A 3CB6A 1KQ0A 1PV9A 1QXYA 2Q95A 2Q8KA 3TB5A 4U1BA 4PV4A 2V3ZA 2V3YA 3L7GA 1N51A 1O0XA 2GU5A 1YJ3A 4FLLA 1R5HA 4KM3A 5FCHA 2Q96A 4FO7A 2B3LA 4JUQA 2B3KA 2P98A 1A16A 1WKMA 5FCFA 3TAVA 3MX6A 2BHBA 2EA2A 4S00A 3L24A 3PKCA 4S2RP 4U76A 5JI6A 1C22A 2BH3A 1XGOA 2EVCA 4IECA 1YW7A 4QR8A 5E5BA 1WL9A 2BWYA 5CNXA 1CHMA 4RGZ1 5JFRA 2GG7A 2HOWA 1W7VA 2P9AA 4IF7A 1QXWA 5CE6A 3FMQA 2Q94A 2BHDA 4IKRA 4FLIA 2Q92A 5CIKA 2OAZA 4U6ZA 2GGCA 4RZZA 4RZYA 2B3HA 4PNCA 3PKBA 2BWXA 5CDLA 2BN7A 2GU6A 1XGMA 1Y1NA 1KP0A 5D6EA 4EGEA 1BN5A 4U71A 1XNZA 2ADUA 2GU4A 4U6EA 5CDEA 2Q93A 3IG4A 3RVAA 2EVOA 3BIPA 2GG2A 3FM3A 2NQ6A 4FLJA 1YVMA 3S6BA 4B28A 4S01A 3MR1A 3MATA 2BWWA 2EVMA 4HXXA 3IU7A 2GG3A 4MATA 4A6VA 2MATA 2GG0A 2V6CA 4ZWPA 4R60A 2NQ7A 4OOKA 3CB5A 4IKSA 4U6JA 4FKCA 1JAWA 4IU6A 2EA4A 1C27A 3D27A 1QZYA 2GGBA 1WL6A 1C21A 4IKTA 3BIQA 5CDVA 2BWSA 2BHCA 3Q6DA 2DFIA 1R58A 2GA2A 1W2MA 2GTXA 2G6PA 1B6AA 3IU9A 4U6WA 1MATA 4IKUA 1C24A 1WBQA 3CTZA 4IPAA 4U70A 5CLSA 3BITA 1M35A 2V3XA 4FO8A 1XGNA 3PKDA 1WLRA 4ZWUA 3RORA 1QXZA 1XGSA 1YW9A 3PKEA 1R5GA 4A6WA 1KQ9A 2BWVA 3PKAA 4S2TP 5JHUA 4IDYA 3IU8A 2GZ5A 1WN1A 4Z7MA 1BOAA
chains in the Genus database with same CATH topology
4ZWOA 2GG5A 4U6CA 5D6FA 2IW2A 4U73A 4FUKA 1B59A 3FMRA 1C23A 2ZSGA 2GG9A 2BHAA 2P99A 4U69A 4U75A 4ZNGA 1YW8A 4FLKA 2OKNA 2BWUA 2BWTA 1WY2A 2BB7A 2GU7A 2GG8A 3CB6A 1KQ0A 1PV9A 1QXYA 2Q95A 2Q8KA 3TB5A 4U1BA 4PV4A 2V3ZA 2V3YA 3L7GA 1N51A 1O0XA 2GU5A 1YJ3A 4FLLA 1R5HA 4KM3A 5FCHA 2Q96A 4FO7A 2B3LA 4JUQA 2B3KA 2P98A 1A16A 1WKMA 5FCFA 3TAVA 3MX6A 2BHBA 2EA2A 4S00A 3L24A 3PKCA 4S2RP 4U76A 5JI6A 1C22A 2BH3A 1XGOA 2EVCA 4IECA 1YW7A 4QR8A 5E5BA 1WL9A 2BWYA 5CNXA 1CHMA 4RGZ1 5JFRA 2GG7A 2HOWA 1W7VA 2P9AA 4IF7A 1QXWA 5CE6A 3FMQA 2Q94A 2BHDA 4IKRA 4FLIA 2Q92A 5CIKA 2OAZA 4U6ZA 2GGCA 4RZZA 4RZYA 2B3HA 4PNCA 3PKBA 2BWXA 5CDLA 2BN7A 2GU6A 1XGMA 1Y1NA 1KP0A 5D6EA 4EGEA 1BN5A 4U71A 1XNZA 2ADUA 2GU4A 4U6EA 5CDEA 2Q93A 3IG4A 3RVAA 2EVOA 3BIPA 2GG2A 3FM3A 2NQ6A 4FLJA 1YVMA 3S6BA 4B28A 4S01A 3MR1A 3MATA 2BWWA 2EVMA 4HXXA 3IU7A 2GG3A 4MATA 4A6VA 2MATA 2GG0A 2V6CA 4ZWPA 4R60A 2NQ7A 4OOKA 3CB5A 4IKSA 4U6JA 4FKCA 1JAWA 4IU6A 2EA4A 1C27A 3D27A 1QZYA 2GGBA 1WL6A 1C21A 4IKTA 3BIQA 5CDVA 2BWSA 2BHCA 3Q6DA 2DFIA 1R58A 2GA2A 1W2MA 2GTXA 2G6PA 1B6AA 3IU9A 4U6WA 1MATA 4IKUA 1C24A 1WBQA 3CTZA 4IPAA 4U70A 5CLSA 3BITA 1M35A 2V3XA 4FO8A 1XGNA 3PKDA 1WLRA 4ZWUA 3RORA 1QXZA 1XGSA 1YW9A 3PKEA 1R5GA 4A6WA 1KQ9A 2BWVA 3PKAA 4S2TP 5JHUA 4IDYA 3IU8A 2GZ5A 1WN1A 4Z7MA 1BOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWO A;  2GG5 A;  4U6C A;  5D6F A;  2IW2 A;  4U73 A;  4FUK A;  1B59 A;  3FMR A;  1C23 A;  2ZSG A;  2GG9 A;  2BHA A;  2P99 A;  4U69 A;  4U75 A;  4ZNG A;  1YW8 A;  4FLK A;  2OKN A;  2BWU A;  2BWT A;  1WY2 A;  2BB7 A;  2GU7 A;  2GG8 A;  3CB6 A;  1KQ0 A;  1PV9 A;  1QXY A;  2Q95 A;  2Q8K A;  3TB5 A;  4U1B A;  4PV4 A;  2V3Z A;  2V3Y A;  3L7G A;  1N51 A;  1O0X A;  2GU5 A;  1YJ3 A;  4FLL A;  1R5H A;  4KM3 A;  5FCH A;  2Q96 A;  4FO7 A;  2B3L A;  4JUQ A;  2B3K A;  2P98 A;  1A16 A;  1WKM A;  5FCF A;  3TAV A;  3MX6 A;  2BHB A;  2EA2 A;  4S00 A;  3L24 A;  3PKC A;  4S2R P;  4U76 A;  5JI6 A;  1C22 A;  2BH3 A;  1XGO A;  2EVC A;  4IEC A;  1YW7 A;  4QR8 A;  5E5B A;  1WL9 A;  2BWY A;  5CNX A;  1CHM A;  4RGZ 1;  5JFR A;  2GG7 A;  2HOW A;  1W7V A;  2P9A A;  4IF7 A;  1QXW A;  5CE6 A;  3FMQ A;  2Q94 A;  2BHD A;  4IKR A;  4FLI A;  2Q92 A;  5CIK A;  2OAZ A;  4U6Z A;  2GGC A;  4RZZ A;  4RZY A;  2B3H A;  4PNC A;  3PKB A;  2BWX A;  5CDL A;  2BN7 A;  2GU6 A;  1XGM A;  1Y1N A;  1KP0 A;  5D6E A;  4EGE A;  1BN5 A;  4U71 A;  1XNZ A;  2ADU A;  2GU4 A;  4U6E A;  5CDE A;  2Q93 A;  3IG4 A;  3RVA A;  2EVO A;  3BIP A;  2GG2 A;  3FM3 A;  2NQ6 A;  4FLJ A;  1YVM A;  3S6B A;  4B28 A;  4S01 A;  3MR1 A;  3MAT A;  2BWW A;  2EVM A;  4HXX A;  3IU7 A;  2GG3 A;  4MAT A;  4A6V A;  2MAT A;  2GG0 A;  2V6C A;  4ZWP A;  4R60 A;  2NQ7 A;  4OOK A;  3CB5 A;  4IKS A;  4U6J A;  4FKC A;  1JAW A;  4IU6 A;  2EA4 A;  1C27 A;  3D27 A;  1QZY A;  2GGB A;  1WL6 A;  1C21 A;  4IKT A;  3BIQ A;  5CDV A;  2BWS A;  2BHC A;  3Q6D A;  2DFI A;  1R58 A;  2GA2 A;  1W2M A;  2GTX A;  2G6P A;  1B6A A;  3IU9 A;  4U6W A;  1MAT A;  4IKU A;  1C24 A;  1WBQ A;  3CTZ A;  4IPA A;  4U70 A;  5CLS A;  3BIT A;  1M35 A;  2V3X A;  4FO8 A;  1XGN A;  3PKD A;  1WLR A;  4ZWU A;  3ROR A;  1QXZ A;  1XGS A;  1YW9 A;  3PKE A;  1R5G A;  4A6W A;  1KQ9 A;  2BWV A;  3PKA A;  4S2T P;  5JHU A;  4IDY A;  3IU8 A;  2GZ5 A;  1WN1 A;  4Z7M A;  1BOA A; 
#chains in the Genus database with same CATH topology
 4ZWO A;  2GG5 A;  4U6C A;  5D6F A;  2IW2 A;  4U73 A;  4FUK A;  1B59 A;  3FMR A;  1C23 A;  2ZSG A;  2GG9 A;  2BHA A;  2P99 A;  4U69 A;  4U75 A;  4ZNG A;  1YW8 A;  4FLK A;  2OKN A;  2BWU A;  2BWT A;  1WY2 A;  2BB7 A;  2GU7 A;  2GG8 A;  3CB6 A;  1KQ0 A;  1PV9 A;  1QXY A;  2Q95 A;  2Q8K A;  3TB5 A;  4U1B A;  4PV4 A;  2V3Z A;  2V3Y A;  3L7G A;  1N51 A;  1O0X A;  2GU5 A;  1YJ3 A;  4FLL A;  1R5H A;  4KM3 A;  5FCH A;  2Q96 A;  4FO7 A;  2B3L A;  4JUQ A;  2B3K A;  2P98 A;  1A16 A;  1WKM A;  5FCF A;  3TAV A;  3MX6 A;  2BHB A;  2EA2 A;  4S00 A;  3L24 A;  3PKC A;  4S2R P;  4U76 A;  5JI6 A;  1C22 A;  2BH3 A;  1XGO A;  2EVC A;  4IEC A;  1YW7 A;  4QR8 A;  5E5B A;  1WL9 A;  2BWY A;  5CNX A;  1CHM A;  4RGZ 1;  5JFR A;  2GG7 A;  2HOW A;  1W7V A;  2P9A A;  4IF7 A;  1QXW A;  5CE6 A;  3FMQ A;  2Q94 A;  2BHD A;  4IKR A;  4FLI A;  2Q92 A;  5CIK A;  2OAZ A;  4U6Z A;  2GGC A;  4RZZ A;  4RZY A;  2B3H A;  4PNC A;  3PKB A;  2BWX A;  5CDL A;  2BN7 A;  2GU6 A;  1XGM A;  1Y1N A;  1KP0 A;  5D6E A;  4EGE A;  1BN5 A;  4U71 A;  1XNZ A;  2ADU A;  2GU4 A;  4U6E A;  5CDE A;  2Q93 A;  3IG4 A;  3RVA A;  2EVO A;  3BIP A;  2GG2 A;  3FM3 A;  2NQ6 A;  4FLJ A;  1YVM A;  3S6B A;  4B28 A;  4S01 A;  3MR1 A;  3MAT A;  2BWW A;  2EVM A;  4HXX A;  3IU7 A;  2GG3 A;  4MAT A;  4A6V A;  2MAT A;  2GG0 A;  2V6C A;  4ZWP A;  4R60 A;  2NQ7 A;  4OOK A;  3CB5 A;  4IKS A;  4U6J A;  4FKC A;  1JAW A;  4IU6 A;  2EA4 A;  1C27 A;  3D27 A;  1QZY A;  2GGB A;  1WL6 A;  1C21 A;  4IKT A;  3BIQ A;  5CDV A;  2BWS A;  2BHC A;  3Q6D A;  2DFI A;  1R58 A;  2GA2 A;  1W2M A;  2GTX A;  2G6P A;  1B6A A;  3IU9 A;  4U6W A;  1MAT A;  4IKU A;  1C24 A;  1WBQ A;  3CTZ A;  4IPA A;  4U70 A;  5CLS A;  3BIT A;  1M35 A;  2V3X A;  4FO8 A;  1XGN A;  3PKD A;  1WLR A;  4ZWU A;  3ROR A;  1QXZ A;  1XGS A;  1YW9 A;  3PKE A;  1R5G A;  4A6W A;  1KQ9 A;  2BWV A;  3PKA A;  4S2T P;  5JHU A;  4IDY A;  3IU8 A;  2GZ5 A;  1WN1 A;  4Z7M A;  1BOA A; 
#chains in the Genus database with same CATH homology
 4ZWO A;  2GG5 A;  4U6C A;  5D6F A;  2IW2 A;  4U73 A;  4FUK A;  1B59 A;  3FMR A;  1C23 A;  2ZSG A;  2GG9 A;  2BHA A;  2P99 A;  4U69 A;  4U75 A;  4ZNG A;  1YW8 A;  4FLK A;  2OKN A;  2BWU A;  2BWT A;  1WY2 A;  2BB7 A;  2GU7 A;  2GG8 A;  3CB6 A;  1KQ0 A;  1PV9 A;  1QXY A;  2Q95 A;  2Q8K A;  3TB5 A;  4U1B A;  4PV4 A;  2V3Z A;  2V3Y A;  3L7G A;  1N51 A;  1O0X A;  2GU5 A;  1YJ3 A;  4FLL A;  1R5H A;  4KM3 A;  5FCH A;  2Q96 A;  4FO7 A;  2B3L A;  4JUQ A;  2B3K A;  2P98 A;  1A16 A;  1WKM A;  5FCF A;  3TAV A;  3MX6 A;  2BHB A;  2EA2 A;  4S00 A;  3L24 A;  3PKC A;  4S2R P;  4U76 A;  5JI6 A;  1C22 A;  2BH3 A;  1XGO A;  2EVC A;  4IEC A;  1YW7 A;  4QR8 A;  5E5B A;  1WL9 A;  2BWY A;  5CNX A;  1CHM A;  4RGZ 1;  5JFR A;  2GG7 A;  2HOW A;  1W7V A;  2P9A A;  4IF7 A;  1QXW A;  5CE6 A;  3FMQ A;  2Q94 A;  2BHD A;  4IKR A;  4FLI A;  2Q92 A;  5CIK A;  2OAZ A;  4U6Z A;  2GGC A;  4RZZ A;  4RZY A;  2B3H A;  4PNC A;  3PKB A;  2BWX A;  5CDL A;  2BN7 A;  2GU6 A;  1XGM A;  1Y1N A;  1KP0 A;  5D6E A;  4EGE A;  1BN5 A;  4U71 A;  1XNZ A;  2ADU A;  2GU4 A;  4U6E A;  5CDE A;  2Q93 A;  3IG4 A;  3RVA A;  2EVO A;  3BIP A;  2GG2 A;  3FM3 A;  2NQ6 A;  4FLJ A;  1YVM A;  3S6B A;  4B28 A;  4S01 A;  3MR1 A;  3MAT A;  2BWW A;  2EVM A;  4HXX A;  3IU7 A;  2GG3 A;  4MAT A;  4A6V A;  2MAT A;  2GG0 A;  2V6C A;  4ZWP A;  4R60 A;  2NQ7 A;  4OOK A;  3CB5 A;  4IKS A;  4U6J A;  4FKC A;  1JAW A;  4IU6 A;  2EA4 A;  1C27 A;  3D27 A;  1QZY A;  2GGB A;  1WL6 A;  1C21 A;  4IKT A;  3BIQ A;  5CDV A;  2BWS A;  2BHC A;  3Q6D A;  2DFI A;  1R58 A;  2GA2 A;  1W2M A;  2GTX A;  2G6P A;  1B6A A;  3IU9 A;  4U6W A;  1MAT A;  4IKU A;  1C24 A;  1WBQ A;  3CTZ A;  4IPA A;  4U70 A;  5CLS A;  3BIT A;  1M35 A;  2V3X A;  4FO8 A;  1XGN A;  3PKD A;  1WLR A;  4ZWU A;  3ROR A;  1QXZ A;  1XGS A;  1YW9 A;  3PKE A;  1R5G A;  4A6W A;  1KQ9 A;  2BWV A;  3PKA A;  4S2T P;  5JHU A;  4IDY A;  3IU8 A;  2GZ5 A;  1WN1 A;  4Z7M A;  1BOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...