4U6JA

Hsmetap in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6jA00
3FMRA 1R58A 4IECA 4R60A 2EA2A 3Q6DA 3PKCA 2BN7A 1W2MA 3L7GA 4IU6A 1XGOA 4FLJA 1WKMA 2V6CA 2GG7A 1WY2A 2GA2A 2GGBA 2V3ZA 3FMQA 2BH3A 4U69A 4A6WA 1C22A 4U6JA 5CE6A 4IKRA 3CTZA 3FM3A 3S6BA 4U6ZA 4FO8A 3IU8A 5CLSA 2DFIA 2B3KA 2OKNA 3CB5A 3PKDA 1YW8A 2GG9A 5D6FA 1WN1A 3BITA 1WBQA 2P98A 1PV9A 2IW2A 3BIQA 5JI6A 2GU7A 4FUKA 2BHDA 2GG0A 4FO7A 2Q8KA 1XNZA 4OOKA 2BWVA 1YVMA 2BWXA 2P9AA 2P99A 1WLRA 1QXYA 2EVMA 2GU4A 1A16A 2V3XA 4U71A 1KQ9A 4QR8A 2G6PA 2Q94A 4ZWPA 2GG2A 4B28A 4S01A 1YJ3A 4U75A 1QZYA 4IF7A 5D6EA 1BN5A 1W7VA 1B6AA 4HXXA 2BHCA 4U73A 2EA4A 2BHBA 2GU5A 2Q92A 3IU9A 3TAVA 1QXWA 1O0XA 2Q93A 3MX6A 2OAZA 4IDYA 3CB6A 4ZNGA 4PV4A 1JAWA 2BWYA 1XGSA 1YW9A 1BOAA 2GTXA 4IKUA 2NQ6A 1KP0A 1XGNA 4MATA 2GU6A 5CDEA 3RORA 3MR1A 2NQ7A 3L24A 3PKBA 1CHMA 1C24A 1XGMA 2Q95A 4FLIA 4IKTA 1C27A 1M35A 2BB7A 3D27A 4S00A 4FLKA 2GG3A 4Z7MA 1B59A 2ADUA 1R5GA 2B3LA 2GG5A 4PNCA 5JHUA 2MATA 4RZYA 1MATA 4FLLA 2HOWA 2Q96A 5FCFA 2GZ5A 1C23A 1R5HA 1YW7A 4JUQA 1N51A 4FKCA 1WL6A 4IKSA 5CDLA 4S2RP 2GG8A 4KM3A 4ZWUA 2BWWA 4RZZA 4EGEA 1KQ0A 1WL9A 2EVOA 2V3YA 3RVAA 4IPAA 3IU7A 1Y1NA 5CDVA 2BWUA 3MATA 4U6CA 3BIPA 4A6VA 2BWSA 2BWTA 2EVCA 1C21A 4U1BA 3PKAA 3IG4A 2B3HA 2BHAA 2GGCA 4S2TP 4ZWOA 5FCHA 4RGZ1 5E5BA 3TB5A 5CNXA 1QXZA 4U6EA 2ZSGA 4U6WA 4U70A 4U76A 5CIKA 3PKEA 5JFRA
chains in the Genus database with same CATH superfamily
3FMRA 1R58A 4IECA 4R60A 2EA2A 3Q6DA 3PKCA 2BN7A 1W2MA 3L7GA 4IU6A 1XGOA 4FLJA 1WKMA 2V6CA 2GG7A 1WY2A 2GA2A 2GGBA 2V3ZA 3FMQA 2BH3A 4U69A 4A6WA 1C22A 4U6JA 5CE6A 4IKRA 3CTZA 3FM3A 3S6BA 4U6ZA 4FO8A 3IU8A 5CLSA 2DFIA 2B3KA 2OKNA 3CB5A 3PKDA 1YW8A 2GG9A 5D6FA 1WN1A 3BITA 1WBQA 2P98A 1PV9A 2IW2A 3BIQA 5JI6A 2GU7A 4FUKA 2BHDA 2GG0A 4FO7A 2Q8KA 1XNZA 4OOKA 2BWVA 1YVMA 2BWXA 2P9AA 2P99A 1WLRA 1QXYA 2EVMA 2GU4A 1A16A 2V3XA 4U71A 1KQ9A 4QR8A 2G6PA 2Q94A 4ZWPA 2GG2A 4B28A 4S01A 1YJ3A 4U75A 1QZYA 4IF7A 5D6EA 1BN5A 1W7VA 1B6AA 4HXXA 2BHCA 4U73A 2EA4A 2BHBA 2GU5A 2Q92A 3IU9A 3TAVA 1QXWA 1O0XA 2Q93A 3MX6A 2OAZA 4IDYA 3CB6A 4ZNGA 4PV4A 1JAWA 2BWYA 1XGSA 1YW9A 1BOAA 2GTXA 4IKUA 2NQ6A 1KP0A 1XGNA 4MATA 2GU6A 5CDEA 3RORA 3MR1A 2NQ7A 3L24A 3PKBA 1CHMA 1C24A 1XGMA 2Q95A 4FLIA 4IKTA 1C27A 1M35A 2BB7A 3D27A 4S00A 4FLKA 2GG3A 4Z7MA 1B59A 2ADUA 1R5GA 2B3LA 2GG5A 4PNCA 5JHUA 2MATA 4RZYA 1MATA 4FLLA 2HOWA 2Q96A 5FCFA 2GZ5A 1C23A 1R5HA 1YW7A 4JUQA 1N51A 4FKCA 1WL6A 4IKSA 5CDLA 4S2RP 2GG8A 4KM3A 4ZWUA 2BWWA 4RZZA 4EGEA 1KQ0A 1WL9A 2EVOA 2V3YA 3RVAA 4IPAA 3IU7A 1Y1NA 5CDVA 2BWUA 3MATA 4U6CA 3BIPA 4A6VA 2BWSA 2BWTA 2EVCA 1C21A 4U1BA 3PKAA 3IG4A 2B3HA 2BHAA 2GGCA 4S2TP 4ZWOA 5FCHA 4RGZ1 5E5BA 3TB5A 5CNXA 1QXZA 4U6EA 2ZSGA 4U6WA 4U70A 4U76A 5CIKA 3PKEA 5JFRA
chains in the Genus database with same CATH topology
3FMRA 1R58A 4IECA 4R60A 2EA2A 3Q6DA 3PKCA 2BN7A 1W2MA 3L7GA 4IU6A 1XGOA 4FLJA 1WKMA 2V6CA 2GG7A 1WY2A 2GA2A 2GGBA 2V3ZA 3FMQA 2BH3A 4U69A 4A6WA 1C22A 4U6JA 5CE6A 4IKRA 3CTZA 3FM3A 3S6BA 4U6ZA 4FO8A 3IU8A 5CLSA 2DFIA 2B3KA 2OKNA 3CB5A 3PKDA 1YW8A 2GG9A 5D6FA 1WN1A 3BITA 1WBQA 2P98A 1PV9A 2IW2A 3BIQA 5JI6A 2GU7A 4FUKA 2BHDA 2GG0A 4FO7A 2Q8KA 1XNZA 4OOKA 2BWVA 1YVMA 2BWXA 2P9AA 2P99A 1WLRA 1QXYA 2EVMA 2GU4A 1A16A 2V3XA 4U71A 1KQ9A 4QR8A 2G6PA 2Q94A 4ZWPA 2GG2A 4B28A 4S01A 1YJ3A 4U75A 1QZYA 4IF7A 5D6EA 1BN5A 1W7VA 1B6AA 4HXXA 2BHCA 4U73A 2EA4A 2BHBA 2GU5A 2Q92A 3IU9A 3TAVA 1QXWA 1O0XA 2Q93A 3MX6A 2OAZA 4IDYA 3CB6A 4ZNGA 4PV4A 1JAWA 2BWYA 1XGSA 1YW9A 1BOAA 2GTXA 4IKUA 2NQ6A 1KP0A 1XGNA 4MATA 2GU6A 5CDEA 3RORA 3MR1A 2NQ7A 3L24A 3PKBA 1CHMA 1C24A 1XGMA 2Q95A 4FLIA 4IKTA 1C27A 1M35A 2BB7A 3D27A 4S00A 4FLKA 2GG3A 4Z7MA 1B59A 2ADUA 1R5GA 2B3LA 2GG5A 4PNCA 5JHUA 2MATA 4RZYA 1MATA 4FLLA 2HOWA 2Q96A 5FCFA 2GZ5A 1C23A 1R5HA 1YW7A 4JUQA 1N51A 4FKCA 1WL6A 4IKSA 5CDLA 4S2RP 2GG8A 4KM3A 4ZWUA 2BWWA 4RZZA 4EGEA 1KQ0A 1WL9A 2EVOA 2V3YA 3RVAA 4IPAA 3IU7A 1Y1NA 5CDVA 2BWUA 3MATA 4U6CA 3BIPA 4A6VA 2BWSA 2BWTA 2EVCA 1C21A 4U1BA 3PKAA 3IG4A 2B3HA 2BHAA 2GGCA 4S2TP 4ZWOA 5FCHA 4RGZ1 5E5BA 3TB5A 5CNXA 1QXZA 4U6EA 2ZSGA 4U6WA 4U70A 4U76A 5CIKA 3PKEA 5JFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMR A;  1R58 A;  4IEC A;  4R60 A;  2EA2 A;  3Q6D A;  3PKC A;  2BN7 A;  1W2M A;  3L7G A;  4IU6 A;  1XGO A;  4FLJ A;  1WKM A;  2V6C A;  2GG7 A;  1WY2 A;  2GA2 A;  2GGB A;  2V3Z A;  3FMQ A;  2BH3 A;  4U69 A;  4A6W A;  1C22 A;  4U6J A;  5CE6 A;  4IKR A;  3CTZ A;  3FM3 A;  3S6B A;  4U6Z A;  4FO8 A;  3IU8 A;  5CLS A;  2DFI A;  2B3K A;  2OKN A;  3CB5 A;  3PKD A;  1YW8 A;  2GG9 A;  5D6F A;  1WN1 A;  3BIT A;  1WBQ A;  2P98 A;  1PV9 A;  2IW2 A;  3BIQ A;  5JI6 A;  2GU7 A;  4FUK A;  2BHD A;  2GG0 A;  4FO7 A;  2Q8K A;  1XNZ A;  4OOK A;  2BWV A;  1YVM A;  2BWX A;  2P9A A;  2P99 A;  1WLR A;  1QXY A;  2EVM A;  2GU4 A;  1A16 A;  2V3X A;  4U71 A;  1KQ9 A;  4QR8 A;  2G6P A;  2Q94 A;  4ZWP A;  2GG2 A;  4B28 A;  4S01 A;  1YJ3 A;  4U75 A;  1QZY A;  4IF7 A;  5D6E A;  1BN5 A;  1W7V A;  1B6A A;  4HXX A;  2BHC A;  4U73 A;  2EA4 A;  2BHB A;  2GU5 A;  2Q92 A;  3IU9 A;  3TAV A;  1QXW A;  1O0X A;  2Q93 A;  3MX6 A;  2OAZ A;  4IDY A;  3CB6 A;  4ZNG A;  4PV4 A;  1JAW A;  2BWY A;  1XGS A;  1YW9 A;  1BOA A;  2GTX A;  4IKU A;  2NQ6 A;  1KP0 A;  1XGN A;  4MAT A;  2GU6 A;  5CDE A;  3ROR A;  3MR1 A;  2NQ7 A;  3L24 A;  3PKB A;  1CHM A;  1C24 A;  1XGM A;  2Q95 A;  4FLI A;  4IKT A;  1C27 A;  1M35 A;  2BB7 A;  3D27 A;  4S00 A;  4FLK A;  2GG3 A;  4Z7M A;  1B59 A;  2ADU A;  1R5G A;  2B3L A;  2GG5 A;  4PNC A;  5JHU A;  2MAT A;  4RZY A;  1MAT A;  4FLL A;  2HOW A;  2Q96 A;  5FCF A;  2GZ5 A;  1C23 A;  1R5H A;  1YW7 A;  4JUQ A;  1N51 A;  4FKC A;  1WL6 A;  4IKS A;  5CDL A;  4S2R P;  2GG8 A;  4KM3 A;  4ZWU A;  2BWW A;  4RZZ A;  4EGE A;  1KQ0 A;  1WL9 A;  2EVO A;  2V3Y A;  3RVA A;  4IPA A;  3IU7 A;  1Y1N A;  5CDV A;  2BWU A;  3MAT A;  4U6C A;  3BIP A;  4A6V A;  2BWS A;  2BWT A;  2EVC A;  1C21 A;  4U1B A;  3PKA A;  3IG4 A;  2B3H A;  2BHA A;  2GGC A;  4S2T P;  4ZWO A;  5FCH A;  4RGZ 1;  5E5B A;  3TB5 A;  5CNX A;  1QXZ A;  4U6E A;  2ZSG A;  4U6W A;  4U70 A;  4U76 A;  5CIK A;  3PKE A;  5JFR A; 
#chains in the Genus database with same CATH topology
 3FMR A;  1R58 A;  4IEC A;  4R60 A;  2EA2 A;  3Q6D A;  3PKC A;  2BN7 A;  1W2M A;  3L7G A;  4IU6 A;  1XGO A;  4FLJ A;  1WKM A;  2V6C A;  2GG7 A;  1WY2 A;  2GA2 A;  2GGB A;  2V3Z A;  3FMQ A;  2BH3 A;  4U69 A;  4A6W A;  1C22 A;  4U6J A;  5CE6 A;  4IKR A;  3CTZ A;  3FM3 A;  3S6B A;  4U6Z A;  4FO8 A;  3IU8 A;  5CLS A;  2DFI A;  2B3K A;  2OKN A;  3CB5 A;  3PKD A;  1YW8 A;  2GG9 A;  5D6F A;  1WN1 A;  3BIT A;  1WBQ A;  2P98 A;  1PV9 A;  2IW2 A;  3BIQ A;  5JI6 A;  2GU7 A;  4FUK A;  2BHD A;  2GG0 A;  4FO7 A;  2Q8K A;  1XNZ A;  4OOK A;  2BWV A;  1YVM A;  2BWX A;  2P9A A;  2P99 A;  1WLR A;  1QXY A;  2EVM A;  2GU4 A;  1A16 A;  2V3X A;  4U71 A;  1KQ9 A;  4QR8 A;  2G6P A;  2Q94 A;  4ZWP A;  2GG2 A;  4B28 A;  4S01 A;  1YJ3 A;  4U75 A;  1QZY A;  4IF7 A;  5D6E A;  1BN5 A;  1W7V A;  1B6A A;  4HXX A;  2BHC A;  4U73 A;  2EA4 A;  2BHB A;  2GU5 A;  2Q92 A;  3IU9 A;  3TAV A;  1QXW A;  1O0X A;  2Q93 A;  3MX6 A;  2OAZ A;  4IDY A;  3CB6 A;  4ZNG A;  4PV4 A;  1JAW A;  2BWY A;  1XGS A;  1YW9 A;  1BOA A;  2GTX A;  4IKU A;  2NQ6 A;  1KP0 A;  1XGN A;  4MAT A;  2GU6 A;  5CDE A;  3ROR A;  3MR1 A;  2NQ7 A;  3L24 A;  3PKB A;  1CHM A;  1C24 A;  1XGM A;  2Q95 A;  4FLI A;  4IKT A;  1C27 A;  1M35 A;  2BB7 A;  3D27 A;  4S00 A;  4FLK A;  2GG3 A;  4Z7M A;  1B59 A;  2ADU A;  1R5G A;  2B3L A;  2GG5 A;  4PNC A;  5JHU A;  2MAT A;  4RZY A;  1MAT A;  4FLL A;  2HOW A;  2Q96 A;  5FCF A;  2GZ5 A;  1C23 A;  1R5H A;  1YW7 A;  4JUQ A;  1N51 A;  4FKC A;  1WL6 A;  4IKS A;  5CDL A;  4S2R P;  2GG8 A;  4KM3 A;  4ZWU A;  2BWW A;  4RZZ A;  4EGE A;  1KQ0 A;  1WL9 A;  2EVO A;  2V3Y A;  3RVA A;  4IPA A;  3IU7 A;  1Y1N A;  5CDV A;  2BWU A;  3MAT A;  4U6C A;  3BIP A;  4A6V A;  2BWS A;  2BWT A;  2EVC A;  1C21 A;  4U1B A;  3PKA A;  3IG4 A;  2B3H A;  2BHA A;  2GGC A;  4S2T P;  4ZWO A;  5FCH A;  4RGZ 1;  5E5B A;  3TB5 A;  5CNX A;  1QXZ A;  4U6E A;  2ZSG A;  4U6W A;  4U70 A;  4U76 A;  5CIK A;  3PKE A;  5JFR A; 
#chains in the Genus database with same CATH homology
 3FMR A;  1R58 A;  4IEC A;  4R60 A;  2EA2 A;  3Q6D A;  3PKC A;  2BN7 A;  1W2M A;  3L7G A;  4IU6 A;  1XGO A;  4FLJ A;  1WKM A;  2V6C A;  2GG7 A;  1WY2 A;  2GA2 A;  2GGB A;  2V3Z A;  3FMQ A;  2BH3 A;  4U69 A;  4A6W A;  1C22 A;  4U6J A;  5CE6 A;  4IKR A;  3CTZ A;  3FM3 A;  3S6B A;  4U6Z A;  4FO8 A;  3IU8 A;  5CLS A;  2DFI A;  2B3K A;  2OKN A;  3CB5 A;  3PKD A;  1YW8 A;  2GG9 A;  5D6F A;  1WN1 A;  3BIT A;  1WBQ A;  2P98 A;  1PV9 A;  2IW2 A;  3BIQ A;  5JI6 A;  2GU7 A;  4FUK A;  2BHD A;  2GG0 A;  4FO7 A;  2Q8K A;  1XNZ A;  4OOK A;  2BWV A;  1YVM A;  2BWX A;  2P9A A;  2P99 A;  1WLR A;  1QXY A;  2EVM A;  2GU4 A;  1A16 A;  2V3X A;  4U71 A;  1KQ9 A;  4QR8 A;  2G6P A;  2Q94 A;  4ZWP A;  2GG2 A;  4B28 A;  4S01 A;  1YJ3 A;  4U75 A;  1QZY A;  4IF7 A;  5D6E A;  1BN5 A;  1W7V A;  1B6A A;  4HXX A;  2BHC A;  4U73 A;  2EA4 A;  2BHB A;  2GU5 A;  2Q92 A;  3IU9 A;  3TAV A;  1QXW A;  1O0X A;  2Q93 A;  3MX6 A;  2OAZ A;  4IDY A;  3CB6 A;  4ZNG A;  4PV4 A;  1JAW A;  2BWY A;  1XGS A;  1YW9 A;  1BOA A;  2GTX A;  4IKU A;  2NQ6 A;  1KP0 A;  1XGN A;  4MAT A;  2GU6 A;  5CDE A;  3ROR A;  3MR1 A;  2NQ7 A;  3L24 A;  3PKB A;  1CHM A;  1C24 A;  1XGM A;  2Q95 A;  4FLI A;  4IKT A;  1C27 A;  1M35 A;  2BB7 A;  3D27 A;  4S00 A;  4FLK A;  2GG3 A;  4Z7M A;  1B59 A;  2ADU A;  1R5G A;  2B3L A;  2GG5 A;  4PNC A;  5JHU A;  2MAT A;  4RZY A;  1MAT A;  4FLL A;  2HOW A;  2Q96 A;  5FCF A;  2GZ5 A;  1C23 A;  1R5H A;  1YW7 A;  4JUQ A;  1N51 A;  4FKC A;  1WL6 A;  4IKS A;  5CDL A;  4S2R P;  2GG8 A;  4KM3 A;  4ZWU A;  2BWW A;  4RZZ A;  4EGE A;  1KQ0 A;  1WL9 A;  2EVO A;  2V3Y A;  3RVA A;  4IPA A;  3IU7 A;  1Y1N A;  5CDV A;  2BWU A;  3MAT A;  4U6C A;  3BIP A;  4A6V A;  2BWS A;  2BWT A;  2EVC A;  1C21 A;  4U1B A;  3PKA A;  3IG4 A;  2B3H A;  2BHA A;  2GGC A;  4S2T P;  4ZWO A;  5FCH A;  4RGZ 1;  5E5B A;  3TB5 A;  5CNX A;  1QXZ A;  4U6E A;  2ZSG A;  4U6W A;  4U70 A;  4U76 A;  5CIK A;  3PKE A;  5JFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...