4U6JA

Hsmetap in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6jA00
4ZWOA 1C27A 5E5BA 3TAVA 2GG5A 4S2TP 5CDVA 5JFRA 4FLKA 3CTZA 4IKTA 4RZYA 5CIKA 2V3YA 2V3ZA 2OKNA 5CE6A 4FUKA 2B3KA 1YJ3A 3FMRA 4IECA 2EA4A 2EA2A 4Z7MA 2BWYA 1YW8A 1C23A 2BHBA 3MX6A 1W7VA 2BN7A 2BWTA 4U6EA 2BWWA 1WL6A 4S00A 1YW9A 1C21A 5CLSA 1N51A 2BWXA 1WKMA 1XGOA 4IKRA 2BWUA 3IU9A 3PKBA 1WY2A 2B3LA 5CNXA 1XGNA 3BIPA 1R5GA 4ZWPA 2P99A 3TB5A 2GU4A 2Q92A 2GU5A 4MATA 3L7GA 4R60A 2IW2A 2GG7A 4U6WA 2V6CA 4U1BA 2P98A 1KQ9A 4RZZA 2GU7A 2Q94A 3MR1A 1Y1NA 2Q96A 1QXWA 5JI6A 2Q8KA 2DFIA 1KP0A 4IPAA 3Q6DA 4U76A 1XNZA 2BHDA 2GG8A 2GTXA 1C24A 2BWVA 4A6WA 1QZYA 4FLLA 1CHMA 4PNCA 2BHAA 2GG3A 4U6ZA 4B28A 4U6JA 2EVOA 4IDYA 2NQ6A 1WLRA 4FO8A 2EVCA 4S01A 2BHCA 3PKCA 3S6BA 3IU7A 2Q95A 2GU6A 5CDLA 2GG2A 1YW7A 1YVMA 1A16A 4EGEA 4QR8A 4U75A 4IKSA 2V3XA 2BB7A 3IG4A 2ZSGA 4FLIA 2GG0A 5JHUA 3CB5A 3L24A 4IKUA 2MATA 2GGBA 1B6AA 2GZ5A 4ZWUA 5CDEA 3RORA 3FM3A 1WBQA 2BH3A 4PV4A 2P9AA 1WL9A 2GGCA 4FO7A 2OAZA 4ZNGA 2Q93A 4JUQA 2ADUA 3PKDA 4OOKA 3PKEA 3IU8A 1W2MA 1XGMA 2GG9A 3FMQA 4FKCA 2HOWA 4RGZ1 3MATA 4A6VA 4IF7A 2NQ7A 4U70A 2EVMA 1PV9A 3BITA 4U69A 5FCFA 1XGSA 4HXXA 5D6FA 4U6CA 1R58A 2BWSA 3PKAA 1BOAA 2GA2A 3BIQA 1QXZA 3CB6A 3RVAA 4U71A 1WN1A 1M35A 1JAWA 2G6PA 4FLJA 3D27A 1R5HA 1MATA 1C22A 2B3HA 4KM3A 1O0XA 1QXYA 5D6EA 1BN5A 1B59A 4IU6A 4S2RP 5FCHA 4U73A 1KQ0A
chains in the Genus database with same CATH superfamily
4ZWOA 1C27A 5E5BA 3TAVA 2GG5A 4S2TP 5CDVA 5JFRA 4FLKA 3CTZA 4IKTA 4RZYA 5CIKA 2V3YA 2V3ZA 2OKNA 5CE6A 4FUKA 2B3KA 1YJ3A 3FMRA 4IECA 2EA4A 2EA2A 4Z7MA 2BWYA 1YW8A 1C23A 2BHBA 3MX6A 1W7VA 2BN7A 2BWTA 4U6EA 2BWWA 1WL6A 4S00A 1YW9A 1C21A 5CLSA 1N51A 2BWXA 1WKMA 1XGOA 4IKRA 2BWUA 3IU9A 3PKBA 1WY2A 2B3LA 5CNXA 1XGNA 3BIPA 1R5GA 4ZWPA 2P99A 3TB5A 2GU4A 2Q92A 2GU5A 4MATA 3L7GA 4R60A 2IW2A 2GG7A 4U6WA 2V6CA 4U1BA 2P98A 1KQ9A 4RZZA 2GU7A 2Q94A 3MR1A 1Y1NA 2Q96A 1QXWA 5JI6A 2Q8KA 2DFIA 1KP0A 4IPAA 3Q6DA 4U76A 1XNZA 2BHDA 2GG8A 2GTXA 1C24A 2BWVA 4A6WA 1QZYA 4FLLA 1CHMA 4PNCA 2BHAA 2GG3A 4U6ZA 4B28A 4U6JA 2EVOA 4IDYA 2NQ6A 1WLRA 4FO8A 2EVCA 4S01A 2BHCA 3PKCA 3S6BA 3IU7A 2Q95A 2GU6A 5CDLA 2GG2A 1YW7A 1YVMA 1A16A 4EGEA 4QR8A 4U75A 4IKSA 2V3XA 2BB7A 3IG4A 2ZSGA 4FLIA 2GG0A 5JHUA 3CB5A 3L24A 4IKUA 2MATA 2GGBA 1B6AA 2GZ5A 4ZWUA 5CDEA 3RORA 3FM3A 1WBQA 2BH3A 4PV4A 2P9AA 1WL9A 2GGCA 4FO7A 2OAZA 4ZNGA 2Q93A 4JUQA 2ADUA 3PKDA 4OOKA 3PKEA 3IU8A 1W2MA 1XGMA 2GG9A 3FMQA 4FKCA 2HOWA 4RGZ1 3MATA 4A6VA 4IF7A 2NQ7A 4U70A 2EVMA 1PV9A 3BITA 4U69A 5FCFA 1XGSA 4HXXA 5D6FA 4U6CA 1R58A 2BWSA 3PKAA 1BOAA 2GA2A 3BIQA 1QXZA 3CB6A 3RVAA 4U71A 1WN1A 1M35A 1JAWA 2G6PA 4FLJA 3D27A 1R5HA 1MATA 1C22A 2B3HA 4KM3A 1O0XA 1QXYA 5D6EA 1BN5A 1B59A 4IU6A 4S2RP 5FCHA 4U73A 1KQ0A
chains in the Genus database with same CATH topology
4ZWOA 1C27A 5E5BA 3TAVA 2GG5A 4S2TP 5CDVA 5JFRA 4FLKA 3CTZA 4IKTA 4RZYA 5CIKA 2V3YA 2V3ZA 2OKNA 5CE6A 4FUKA 2B3KA 1YJ3A 3FMRA 4IECA 2EA4A 2EA2A 4Z7MA 2BWYA 1YW8A 1C23A 2BHBA 3MX6A 1W7VA 2BN7A 2BWTA 4U6EA 2BWWA 1WL6A 4S00A 1YW9A 1C21A 5CLSA 1N51A 2BWXA 1WKMA 1XGOA 4IKRA 2BWUA 3IU9A 3PKBA 1WY2A 2B3LA 5CNXA 1XGNA 3BIPA 1R5GA 4ZWPA 2P99A 3TB5A 2GU4A 2Q92A 2GU5A 4MATA 3L7GA 4R60A 2IW2A 2GG7A 4U6WA 2V6CA 4U1BA 2P98A 1KQ9A 4RZZA 2GU7A 2Q94A 3MR1A 1Y1NA 2Q96A 1QXWA 5JI6A 2Q8KA 2DFIA 1KP0A 4IPAA 3Q6DA 4U76A 1XNZA 2BHDA 2GG8A 2GTXA 1C24A 2BWVA 4A6WA 1QZYA 4FLLA 1CHMA 4PNCA 2BHAA 2GG3A 4U6ZA 4B28A 4U6JA 2EVOA 4IDYA 2NQ6A 1WLRA 4FO8A 2EVCA 4S01A 2BHCA 3PKCA 3S6BA 3IU7A 2Q95A 2GU6A 5CDLA 2GG2A 1YW7A 1YVMA 1A16A 4EGEA 4QR8A 4U75A 4IKSA 2V3XA 2BB7A 3IG4A 2ZSGA 4FLIA 2GG0A 5JHUA 3CB5A 3L24A 4IKUA 2MATA 2GGBA 1B6AA 2GZ5A 4ZWUA 5CDEA 3RORA 3FM3A 1WBQA 2BH3A 4PV4A 2P9AA 1WL9A 2GGCA 4FO7A 2OAZA 4ZNGA 2Q93A 4JUQA 2ADUA 3PKDA 4OOKA 3PKEA 3IU8A 1W2MA 1XGMA 2GG9A 3FMQA 4FKCA 2HOWA 4RGZ1 3MATA 4A6VA 4IF7A 2NQ7A 4U70A 2EVMA 1PV9A 3BITA 4U69A 5FCFA 1XGSA 4HXXA 5D6FA 4U6CA 1R58A 2BWSA 3PKAA 1BOAA 2GA2A 3BIQA 1QXZA 3CB6A 3RVAA 4U71A 1WN1A 1M35A 1JAWA 2G6PA 4FLJA 3D27A 1R5HA 1MATA 1C22A 2B3HA 4KM3A 1O0XA 1QXYA 5D6EA 1BN5A 1B59A 4IU6A 4S2RP 5FCHA 4U73A 1KQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWO A;  1C27 A;  5E5B A;  3TAV A;  2GG5 A;  4S2T P;  5CDV A;  5JFR A;  4FLK A;  3CTZ A;  4IKT A;  4RZY A;  5CIK A;  2V3Y A;  2V3Z A;  2OKN A;  5CE6 A;  4FUK A;  2B3K A;  1YJ3 A;  3FMR A;  4IEC A;  2EA4 A;  2EA2 A;  4Z7M A;  2BWY A;  1YW8 A;  1C23 A;  2BHB A;  3MX6 A;  1W7V A;  2BN7 A;  2BWT A;  4U6E A;  2BWW A;  1WL6 A;  4S00 A;  1YW9 A;  1C21 A;  5CLS A;  1N51 A;  2BWX A;  1WKM A;  1XGO A;  4IKR A;  2BWU A;  3IU9 A;  3PKB A;  1WY2 A;  2B3L A;  5CNX A;  1XGN A;  3BIP A;  1R5G A;  4ZWP A;  2P99 A;  3TB5 A;  2GU4 A;  2Q92 A;  2GU5 A;  4MAT A;  3L7G A;  4R60 A;  2IW2 A;  2GG7 A;  4U6W A;  2V6C A;  4U1B A;  2P98 A;  1KQ9 A;  4RZZ A;  2GU7 A;  2Q94 A;  3MR1 A;  1Y1N A;  2Q96 A;  1QXW A;  5JI6 A;  2Q8K A;  2DFI A;  1KP0 A;  4IPA A;  3Q6D A;  4U76 A;  1XNZ A;  2BHD A;  2GG8 A;  2GTX A;  1C24 A;  2BWV A;  4A6W A;  1QZY A;  4FLL A;  1CHM A;  4PNC A;  2BHA A;  2GG3 A;  4U6Z A;  4B28 A;  4U6J A;  2EVO A;  4IDY A;  2NQ6 A;  1WLR A;  4FO8 A;  2EVC A;  4S01 A;  2BHC A;  3PKC A;  3S6B A;  3IU7 A;  2Q95 A;  2GU6 A;  5CDL A;  2GG2 A;  1YW7 A;  1YVM A;  1A16 A;  4EGE A;  4QR8 A;  4U75 A;  4IKS A;  2V3X A;  2BB7 A;  3IG4 A;  2ZSG A;  4FLI A;  2GG0 A;  5JHU A;  3CB5 A;  3L24 A;  4IKU A;  2MAT A;  2GGB A;  1B6A A;  2GZ5 A;  4ZWU A;  5CDE A;  3ROR A;  3FM3 A;  1WBQ A;  2BH3 A;  4PV4 A;  2P9A A;  1WL9 A;  2GGC A;  4FO7 A;  2OAZ A;  4ZNG A;  2Q93 A;  4JUQ A;  2ADU A;  3PKD A;  4OOK A;  3PKE A;  3IU8 A;  1W2M A;  1XGM A;  2GG9 A;  3FMQ A;  4FKC A;  2HOW A;  4RGZ 1;  3MAT A;  4A6V A;  4IF7 A;  2NQ7 A;  4U70 A;  2EVM A;  1PV9 A;  3BIT A;  4U69 A;  5FCF A;  1XGS A;  4HXX A;  5D6F A;  4U6C A;  1R58 A;  2BWS A;  3PKA A;  1BOA A;  2GA2 A;  3BIQ A;  1QXZ A;  3CB6 A;  3RVA A;  4U71 A;  1WN1 A;  1M35 A;  1JAW A;  2G6P A;  4FLJ A;  3D27 A;  1R5H A;  1MAT A;  1C22 A;  2B3H A;  4KM3 A;  1O0X A;  1QXY A;  5D6E A;  1BN5 A;  1B59 A;  4IU6 A;  4S2R P;  5FCH A;  4U73 A;  1KQ0 A; 
#chains in the Genus database with same CATH topology
 4ZWO A;  1C27 A;  5E5B A;  3TAV A;  2GG5 A;  4S2T P;  5CDV A;  5JFR A;  4FLK A;  3CTZ A;  4IKT A;  4RZY A;  5CIK A;  2V3Y A;  2V3Z A;  2OKN A;  5CE6 A;  4FUK A;  2B3K A;  1YJ3 A;  3FMR A;  4IEC A;  2EA4 A;  2EA2 A;  4Z7M A;  2BWY A;  1YW8 A;  1C23 A;  2BHB A;  3MX6 A;  1W7V A;  2BN7 A;  2BWT A;  4U6E A;  2BWW A;  1WL6 A;  4S00 A;  1YW9 A;  1C21 A;  5CLS A;  1N51 A;  2BWX A;  1WKM A;  1XGO A;  4IKR A;  2BWU A;  3IU9 A;  3PKB A;  1WY2 A;  2B3L A;  5CNX A;  1XGN A;  3BIP A;  1R5G A;  4ZWP A;  2P99 A;  3TB5 A;  2GU4 A;  2Q92 A;  2GU5 A;  4MAT A;  3L7G A;  4R60 A;  2IW2 A;  2GG7 A;  4U6W A;  2V6C A;  4U1B A;  2P98 A;  1KQ9 A;  4RZZ A;  2GU7 A;  2Q94 A;  3MR1 A;  1Y1N A;  2Q96 A;  1QXW A;  5JI6 A;  2Q8K A;  2DFI A;  1KP0 A;  4IPA A;  3Q6D A;  4U76 A;  1XNZ A;  2BHD A;  2GG8 A;  2GTX A;  1C24 A;  2BWV A;  4A6W A;  1QZY A;  4FLL A;  1CHM A;  4PNC A;  2BHA A;  2GG3 A;  4U6Z A;  4B28 A;  4U6J A;  2EVO A;  4IDY A;  2NQ6 A;  1WLR A;  4FO8 A;  2EVC A;  4S01 A;  2BHC A;  3PKC A;  3S6B A;  3IU7 A;  2Q95 A;  2GU6 A;  5CDL A;  2GG2 A;  1YW7 A;  1YVM A;  1A16 A;  4EGE A;  4QR8 A;  4U75 A;  4IKS A;  2V3X A;  2BB7 A;  3IG4 A;  2ZSG A;  4FLI A;  2GG0 A;  5JHU A;  3CB5 A;  3L24 A;  4IKU A;  2MAT A;  2GGB A;  1B6A A;  2GZ5 A;  4ZWU A;  5CDE A;  3ROR A;  3FM3 A;  1WBQ A;  2BH3 A;  4PV4 A;  2P9A A;  1WL9 A;  2GGC A;  4FO7 A;  2OAZ A;  4ZNG A;  2Q93 A;  4JUQ A;  2ADU A;  3PKD A;  4OOK A;  3PKE A;  3IU8 A;  1W2M A;  1XGM A;  2GG9 A;  3FMQ A;  4FKC A;  2HOW A;  4RGZ 1;  3MAT A;  4A6V A;  4IF7 A;  2NQ7 A;  4U70 A;  2EVM A;  1PV9 A;  3BIT A;  4U69 A;  5FCF A;  1XGS A;  4HXX A;  5D6F A;  4U6C A;  1R58 A;  2BWS A;  3PKA A;  1BOA A;  2GA2 A;  3BIQ A;  1QXZ A;  3CB6 A;  3RVA A;  4U71 A;  1WN1 A;  1M35 A;  1JAW A;  2G6P A;  4FLJ A;  3D27 A;  1R5H A;  1MAT A;  1C22 A;  2B3H A;  4KM3 A;  1O0X A;  1QXY A;  5D6E A;  1BN5 A;  1B59 A;  4IU6 A;  4S2R P;  5FCH A;  4U73 A;  1KQ0 A; 
#chains in the Genus database with same CATH homology
 4ZWO A;  1C27 A;  5E5B A;  3TAV A;  2GG5 A;  4S2T P;  5CDV A;  5JFR A;  4FLK A;  3CTZ A;  4IKT A;  4RZY A;  5CIK A;  2V3Y A;  2V3Z A;  2OKN A;  5CE6 A;  4FUK A;  2B3K A;  1YJ3 A;  3FMR A;  4IEC A;  2EA4 A;  2EA2 A;  4Z7M A;  2BWY A;  1YW8 A;  1C23 A;  2BHB A;  3MX6 A;  1W7V A;  2BN7 A;  2BWT A;  4U6E A;  2BWW A;  1WL6 A;  4S00 A;  1YW9 A;  1C21 A;  5CLS A;  1N51 A;  2BWX A;  1WKM A;  1XGO A;  4IKR A;  2BWU A;  3IU9 A;  3PKB A;  1WY2 A;  2B3L A;  5CNX A;  1XGN A;  3BIP A;  1R5G A;  4ZWP A;  2P99 A;  3TB5 A;  2GU4 A;  2Q92 A;  2GU5 A;  4MAT A;  3L7G A;  4R60 A;  2IW2 A;  2GG7 A;  4U6W A;  2V6C A;  4U1B A;  2P98 A;  1KQ9 A;  4RZZ A;  2GU7 A;  2Q94 A;  3MR1 A;  1Y1N A;  2Q96 A;  1QXW A;  5JI6 A;  2Q8K A;  2DFI A;  1KP0 A;  4IPA A;  3Q6D A;  4U76 A;  1XNZ A;  2BHD A;  2GG8 A;  2GTX A;  1C24 A;  2BWV A;  4A6W A;  1QZY A;  4FLL A;  1CHM A;  4PNC A;  2BHA A;  2GG3 A;  4U6Z A;  4B28 A;  4U6J A;  2EVO A;  4IDY A;  2NQ6 A;  1WLR A;  4FO8 A;  2EVC A;  4S01 A;  2BHC A;  3PKC A;  3S6B A;  3IU7 A;  2Q95 A;  2GU6 A;  5CDL A;  2GG2 A;  1YW7 A;  1YVM A;  1A16 A;  4EGE A;  4QR8 A;  4U75 A;  4IKS A;  2V3X A;  2BB7 A;  3IG4 A;  2ZSG A;  4FLI A;  2GG0 A;  5JHU A;  3CB5 A;  3L24 A;  4IKU A;  2MAT A;  2GGB A;  1B6A A;  2GZ5 A;  4ZWU A;  5CDE A;  3ROR A;  3FM3 A;  1WBQ A;  2BH3 A;  4PV4 A;  2P9A A;  1WL9 A;  2GGC A;  4FO7 A;  2OAZ A;  4ZNG A;  2Q93 A;  4JUQ A;  2ADU A;  3PKD A;  4OOK A;  3PKE A;  3IU8 A;  1W2M A;  1XGM A;  2GG9 A;  3FMQ A;  4FKC A;  2HOW A;  4RGZ 1;  3MAT A;  4A6V A;  4IF7 A;  2NQ7 A;  4U70 A;  2EVM A;  1PV9 A;  3BIT A;  4U69 A;  5FCF A;  1XGS A;  4HXX A;  5D6F A;  4U6C A;  1R58 A;  2BWS A;  3PKA A;  1BOA A;  2GA2 A;  3BIQ A;  1QXZ A;  3CB6 A;  3RVA A;  4U71 A;  1WN1 A;  1M35 A;  1JAW A;  2G6P A;  4FLJ A;  3D27 A;  1R5H A;  1MAT A;  1C22 A;  2B3H A;  4KM3 A;  1O0X A;  1QXY A;  5D6E A;  1BN5 A;  1B59 A;  4IU6 A;  4S2R P;  5FCH A;  4U73 A;  1KQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...