4U6JA

Hsmetap in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6jA00
4FLJA 4ZWPA 1WL6A 1CHMA 3MX6A 1KQ0A 4IKRA 4U73A 1WY2A 2Q8KA 4U6ZA 2BWTA 1YVMA 2EVOA 5FCFA 4IF7A 3FMRA 2GU4A 3IU7A 4U69A 1C22A 3IU8A 3S6BA 1B6AA 4S2RP 3TB5A 1R5GA 3PKCA 2B3HA 2GG2A 2B3LA 1B59A 4Z7MA 3MATA 2DFIA 3PKEA 2GG0A 4FO8A 4PV4A 5CLSA 1YW9A 2P99A 1BOAA 2GTXA 5CIKA 5CE6A 3TAVA 1QXYA 2V3XA 4U6JA 1XGNA 5CDVA 5JFRA 1W7VA 2BWSA 1C24A 3CB5A 1WKMA 4IECA 1QZYA 2ZSGA 4FLLA 1XGMA 1R58A 2BHDA 1XGOA 2OAZA 2BHCA 1QXWA 2GG5A 4IKUA 3BITA 2GU7A 2G6PA 2EA2A 3L24A 4S01A 1QXZA 4U1BA 3RORA 2BWUA 1YW8A 2GU5A 4U6CA 4A6VA 5E5BA 3PKDA 3BIQA 1KQ9A 4KM3A 4ZWOA 4ZWUA 4RGZ1 2V3YA 1O0XA 3PKBA 4U76A 2GG7A 4R60A 2GG8A 2BWWA 3IU9A 4U71A 1WBQA 2GG3A 2MATA 1Y1NA 2Q94A 4A6WA 4MATA 2OKNA 1KP0A 1W2MA 1PV9A 2GZ5A 3BIPA 3CB6A 2BHBA 4RZYA 4RZZA 2Q92A 5D6EA 3CTZA 4PNCA 2EA4A 2BWYA 2ADUA 4U6EA 3D27A 2GU6A 4FLKA 4U75A 4FKCA 3PKAA 2BB7A 3RVAA 3IG4A 4IDYA 4S00A 1C21A 2NQ6A 2HOWA 1WL9A 4FO7A 4IPAA 1A16A 4IKSA 4U6WA 4IKTA 3Q6DA 1C23A 5D6FA 5JHUA 2BWVA 4QR8A 4IU6A 5CDLA 1C27A 1R5HA 2BHAA 3L7GA 4ZNGA 2BH3A 5FCHA 5CNXA 2BN7A 4FUKA 2BWXA 2GG9A 1WN1A 3MR1A 2P98A 1N51A 3FM3A 4FLIA 2GGCA 2GA2A 2P9AA 2V3ZA 4OOKA 2V6CA 2GGBA 1WLRA 1XNZA 2B3KA 2NQ7A 1MATA 1YJ3A 2EVMA 5CDEA 4S2TP 1JAWA 2EVCA 4U70A 5JI6A 1BN5A 1XGSA 2Q95A 2Q96A 4JUQA 4HXXA 4B28A 1M35A 1YW7A 2Q93A 3FMQA 4EGEA 2IW2A
chains in the Genus database with same CATH superfamily
4FLJA 4ZWPA 1WL6A 1CHMA 3MX6A 1KQ0A 4IKRA 4U73A 1WY2A 2Q8KA 4U6ZA 2BWTA 1YVMA 2EVOA 5FCFA 4IF7A 3FMRA 2GU4A 3IU7A 4U69A 1C22A 3IU8A 3S6BA 1B6AA 4S2RP 3TB5A 1R5GA 3PKCA 2B3HA 2GG2A 2B3LA 1B59A 4Z7MA 3MATA 2DFIA 3PKEA 2GG0A 4FO8A 4PV4A 5CLSA 1YW9A 2P99A 1BOAA 2GTXA 5CIKA 5CE6A 3TAVA 1QXYA 2V3XA 4U6JA 1XGNA 5CDVA 5JFRA 1W7VA 2BWSA 1C24A 3CB5A 1WKMA 4IECA 1QZYA 2ZSGA 4FLLA 1XGMA 1R58A 2BHDA 1XGOA 2OAZA 2BHCA 1QXWA 2GG5A 4IKUA 3BITA 2GU7A 2G6PA 2EA2A 3L24A 4S01A 1QXZA 4U1BA 3RORA 2BWUA 1YW8A 2GU5A 4U6CA 4A6VA 5E5BA 3PKDA 3BIQA 1KQ9A 4KM3A 4ZWOA 4ZWUA 4RGZ1 2V3YA 1O0XA 3PKBA 4U76A 2GG7A 4R60A 2GG8A 2BWWA 3IU9A 4U71A 1WBQA 2GG3A 2MATA 1Y1NA 2Q94A 4A6WA 4MATA 2OKNA 1KP0A 1W2MA 1PV9A 2GZ5A 3BIPA 3CB6A 2BHBA 4RZYA 4RZZA 2Q92A 5D6EA 3CTZA 4PNCA 2EA4A 2BWYA 2ADUA 4U6EA 3D27A 2GU6A 4FLKA 4U75A 4FKCA 3PKAA 2BB7A 3RVAA 3IG4A 4IDYA 4S00A 1C21A 2NQ6A 2HOWA 1WL9A 4FO7A 4IPAA 1A16A 4IKSA 4U6WA 4IKTA 3Q6DA 1C23A 5D6FA 5JHUA 2BWVA 4QR8A 4IU6A 5CDLA 1C27A 1R5HA 2BHAA 3L7GA 4ZNGA 2BH3A 5FCHA 5CNXA 2BN7A 4FUKA 2BWXA 2GG9A 1WN1A 3MR1A 2P98A 1N51A 3FM3A 4FLIA 2GGCA 2GA2A 2P9AA 2V3ZA 4OOKA 2V6CA 2GGBA 1WLRA 1XNZA 2B3KA 2NQ7A 1MATA 1YJ3A 2EVMA 5CDEA 4S2TP 1JAWA 2EVCA 4U70A 5JI6A 1BN5A 1XGSA 2Q95A 2Q96A 4JUQA 4HXXA 4B28A 1M35A 1YW7A 2Q93A 3FMQA 4EGEA 2IW2A
chains in the Genus database with same CATH topology
4FLJA 4ZWPA 1WL6A 1CHMA 3MX6A 1KQ0A 4IKRA 4U73A 1WY2A 2Q8KA 4U6ZA 2BWTA 1YVMA 2EVOA 5FCFA 4IF7A 3FMRA 2GU4A 3IU7A 4U69A 1C22A 3IU8A 3S6BA 1B6AA 4S2RP 3TB5A 1R5GA 3PKCA 2B3HA 2GG2A 2B3LA 1B59A 4Z7MA 3MATA 2DFIA 3PKEA 2GG0A 4FO8A 4PV4A 5CLSA 1YW9A 2P99A 1BOAA 2GTXA 5CIKA 5CE6A 3TAVA 1QXYA 2V3XA 4U6JA 1XGNA 5CDVA 5JFRA 1W7VA 2BWSA 1C24A 3CB5A 1WKMA 4IECA 1QZYA 2ZSGA 4FLLA 1XGMA 1R58A 2BHDA 1XGOA 2OAZA 2BHCA 1QXWA 2GG5A 4IKUA 3BITA 2GU7A 2G6PA 2EA2A 3L24A 4S01A 1QXZA 4U1BA 3RORA 2BWUA 1YW8A 2GU5A 4U6CA 4A6VA 5E5BA 3PKDA 3BIQA 1KQ9A 4KM3A 4ZWOA 4ZWUA 4RGZ1 2V3YA 1O0XA 3PKBA 4U76A 2GG7A 4R60A 2GG8A 2BWWA 3IU9A 4U71A 1WBQA 2GG3A 2MATA 1Y1NA 2Q94A 4A6WA 4MATA 2OKNA 1KP0A 1W2MA 1PV9A 2GZ5A 3BIPA 3CB6A 2BHBA 4RZYA 4RZZA 2Q92A 5D6EA 3CTZA 4PNCA 2EA4A 2BWYA 2ADUA 4U6EA 3D27A 2GU6A 4FLKA 4U75A 4FKCA 3PKAA 2BB7A 3RVAA 3IG4A 4IDYA 4S00A 1C21A 2NQ6A 2HOWA 1WL9A 4FO7A 4IPAA 1A16A 4IKSA 4U6WA 4IKTA 3Q6DA 1C23A 5D6FA 5JHUA 2BWVA 4QR8A 4IU6A 5CDLA 1C27A 1R5HA 2BHAA 3L7GA 4ZNGA 2BH3A 5FCHA 5CNXA 2BN7A 4FUKA 2BWXA 2GG9A 1WN1A 3MR1A 2P98A 1N51A 3FM3A 4FLIA 2GGCA 2GA2A 2P9AA 2V3ZA 4OOKA 2V6CA 2GGBA 1WLRA 1XNZA 2B3KA 2NQ7A 1MATA 1YJ3A 2EVMA 5CDEA 4S2TP 1JAWA 2EVCA 4U70A 5JI6A 1BN5A 1XGSA 2Q95A 2Q96A 4JUQA 4HXXA 4B28A 1M35A 1YW7A 2Q93A 3FMQA 4EGEA 2IW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLJ A;  4ZWP A;  1WL6 A;  1CHM A;  3MX6 A;  1KQ0 A;  4IKR A;  4U73 A;  1WY2 A;  2Q8K A;  4U6Z A;  2BWT A;  1YVM A;  2EVO A;  5FCF A;  4IF7 A;  3FMR A;  2GU4 A;  3IU7 A;  4U69 A;  1C22 A;  3IU8 A;  3S6B A;  1B6A A;  4S2R P;  3TB5 A;  1R5G A;  3PKC A;  2B3H A;  2GG2 A;  2B3L A;  1B59 A;  4Z7M A;  3MAT A;  2DFI A;  3PKE A;  2GG0 A;  4FO8 A;  4PV4 A;  5CLS A;  1YW9 A;  2P99 A;  1BOA A;  2GTX A;  5CIK A;  5CE6 A;  3TAV A;  1QXY A;  2V3X A;  4U6J A;  1XGN A;  5CDV A;  5JFR A;  1W7V A;  2BWS A;  1C24 A;  3CB5 A;  1WKM A;  4IEC A;  1QZY A;  2ZSG A;  4FLL A;  1XGM A;  1R58 A;  2BHD A;  1XGO A;  2OAZ A;  2BHC A;  1QXW A;  2GG5 A;  4IKU A;  3BIT A;  2GU7 A;  2G6P A;  2EA2 A;  3L24 A;  4S01 A;  1QXZ A;  4U1B A;  3ROR A;  2BWU A;  1YW8 A;  2GU5 A;  4U6C A;  4A6V A;  5E5B A;  3PKD A;  3BIQ A;  1KQ9 A;  4KM3 A;  4ZWO A;  4ZWU A;  4RGZ 1;  2V3Y A;  1O0X A;  3PKB A;  4U76 A;  2GG7 A;  4R60 A;  2GG8 A;  2BWW A;  3IU9 A;  4U71 A;  1WBQ A;  2GG3 A;  2MAT A;  1Y1N A;  2Q94 A;  4A6W A;  4MAT A;  2OKN A;  1KP0 A;  1W2M A;  1PV9 A;  2GZ5 A;  3BIP A;  3CB6 A;  2BHB A;  4RZY A;  4RZZ A;  2Q92 A;  5D6E A;  3CTZ A;  4PNC A;  2EA4 A;  2BWY A;  2ADU A;  4U6E A;  3D27 A;  2GU6 A;  4FLK A;  4U75 A;  4FKC A;  3PKA A;  2BB7 A;  3RVA A;  3IG4 A;  4IDY A;  4S00 A;  1C21 A;  2NQ6 A;  2HOW A;  1WL9 A;  4FO7 A;  4IPA A;  1A16 A;  4IKS A;  4U6W A;  4IKT A;  3Q6D A;  1C23 A;  5D6F A;  5JHU A;  2BWV A;  4QR8 A;  4IU6 A;  5CDL A;  1C27 A;  1R5H A;  2BHA A;  3L7G A;  4ZNG A;  2BH3 A;  5FCH A;  5CNX A;  2BN7 A;  4FUK A;  2BWX A;  2GG9 A;  1WN1 A;  3MR1 A;  2P98 A;  1N51 A;  3FM3 A;  4FLI A;  2GGC A;  2GA2 A;  2P9A A;  2V3Z A;  4OOK A;  2V6C A;  2GGB A;  1WLR A;  1XNZ A;  2B3K A;  2NQ7 A;  1MAT A;  1YJ3 A;  2EVM A;  5CDE A;  4S2T P;  1JAW A;  2EVC A;  4U70 A;  5JI6 A;  1BN5 A;  1XGS A;  2Q95 A;  2Q96 A;  4JUQ A;  4HXX A;  4B28 A;  1M35 A;  1YW7 A;  2Q93 A;  3FMQ A;  4EGE A;  2IW2 A; 
#chains in the Genus database with same CATH topology
 4FLJ A;  4ZWP A;  1WL6 A;  1CHM A;  3MX6 A;  1KQ0 A;  4IKR A;  4U73 A;  1WY2 A;  2Q8K A;  4U6Z A;  2BWT A;  1YVM A;  2EVO A;  5FCF A;  4IF7 A;  3FMR A;  2GU4 A;  3IU7 A;  4U69 A;  1C22 A;  3IU8 A;  3S6B A;  1B6A A;  4S2R P;  3TB5 A;  1R5G A;  3PKC A;  2B3H A;  2GG2 A;  2B3L A;  1B59 A;  4Z7M A;  3MAT A;  2DFI A;  3PKE A;  2GG0 A;  4FO8 A;  4PV4 A;  5CLS A;  1YW9 A;  2P99 A;  1BOA A;  2GTX A;  5CIK A;  5CE6 A;  3TAV A;  1QXY A;  2V3X A;  4U6J A;  1XGN A;  5CDV A;  5JFR A;  1W7V A;  2BWS A;  1C24 A;  3CB5 A;  1WKM A;  4IEC A;  1QZY A;  2ZSG A;  4FLL A;  1XGM A;  1R58 A;  2BHD A;  1XGO A;  2OAZ A;  2BHC A;  1QXW A;  2GG5 A;  4IKU A;  3BIT A;  2GU7 A;  2G6P A;  2EA2 A;  3L24 A;  4S01 A;  1QXZ A;  4U1B A;  3ROR A;  2BWU A;  1YW8 A;  2GU5 A;  4U6C A;  4A6V A;  5E5B A;  3PKD A;  3BIQ A;  1KQ9 A;  4KM3 A;  4ZWO A;  4ZWU A;  4RGZ 1;  2V3Y A;  1O0X A;  3PKB A;  4U76 A;  2GG7 A;  4R60 A;  2GG8 A;  2BWW A;  3IU9 A;  4U71 A;  1WBQ A;  2GG3 A;  2MAT A;  1Y1N A;  2Q94 A;  4A6W A;  4MAT A;  2OKN A;  1KP0 A;  1W2M A;  1PV9 A;  2GZ5 A;  3BIP A;  3CB6 A;  2BHB A;  4RZY A;  4RZZ A;  2Q92 A;  5D6E A;  3CTZ A;  4PNC A;  2EA4 A;  2BWY A;  2ADU A;  4U6E A;  3D27 A;  2GU6 A;  4FLK A;  4U75 A;  4FKC A;  3PKA A;  2BB7 A;  3RVA A;  3IG4 A;  4IDY A;  4S00 A;  1C21 A;  2NQ6 A;  2HOW A;  1WL9 A;  4FO7 A;  4IPA A;  1A16 A;  4IKS A;  4U6W A;  4IKT A;  3Q6D A;  1C23 A;  5D6F A;  5JHU A;  2BWV A;  4QR8 A;  4IU6 A;  5CDL A;  1C27 A;  1R5H A;  2BHA A;  3L7G A;  4ZNG A;  2BH3 A;  5FCH A;  5CNX A;  2BN7 A;  4FUK A;  2BWX A;  2GG9 A;  1WN1 A;  3MR1 A;  2P98 A;  1N51 A;  3FM3 A;  4FLI A;  2GGC A;  2GA2 A;  2P9A A;  2V3Z A;  4OOK A;  2V6C A;  2GGB A;  1WLR A;  1XNZ A;  2B3K A;  2NQ7 A;  1MAT A;  1YJ3 A;  2EVM A;  5CDE A;  4S2T P;  1JAW A;  2EVC A;  4U70 A;  5JI6 A;  1BN5 A;  1XGS A;  2Q95 A;  2Q96 A;  4JUQ A;  4HXX A;  4B28 A;  1M35 A;  1YW7 A;  2Q93 A;  3FMQ A;  4EGE A;  2IW2 A; 
#chains in the Genus database with same CATH homology
 4FLJ A;  4ZWP A;  1WL6 A;  1CHM A;  3MX6 A;  1KQ0 A;  4IKR A;  4U73 A;  1WY2 A;  2Q8K A;  4U6Z A;  2BWT A;  1YVM A;  2EVO A;  5FCF A;  4IF7 A;  3FMR A;  2GU4 A;  3IU7 A;  4U69 A;  1C22 A;  3IU8 A;  3S6B A;  1B6A A;  4S2R P;  3TB5 A;  1R5G A;  3PKC A;  2B3H A;  2GG2 A;  2B3L A;  1B59 A;  4Z7M A;  3MAT A;  2DFI A;  3PKE A;  2GG0 A;  4FO8 A;  4PV4 A;  5CLS A;  1YW9 A;  2P99 A;  1BOA A;  2GTX A;  5CIK A;  5CE6 A;  3TAV A;  1QXY A;  2V3X A;  4U6J A;  1XGN A;  5CDV A;  5JFR A;  1W7V A;  2BWS A;  1C24 A;  3CB5 A;  1WKM A;  4IEC A;  1QZY A;  2ZSG A;  4FLL A;  1XGM A;  1R58 A;  2BHD A;  1XGO A;  2OAZ A;  2BHC A;  1QXW A;  2GG5 A;  4IKU A;  3BIT A;  2GU7 A;  2G6P A;  2EA2 A;  3L24 A;  4S01 A;  1QXZ A;  4U1B A;  3ROR A;  2BWU A;  1YW8 A;  2GU5 A;  4U6C A;  4A6V A;  5E5B A;  3PKD A;  3BIQ A;  1KQ9 A;  4KM3 A;  4ZWO A;  4ZWU A;  4RGZ 1;  2V3Y A;  1O0X A;  3PKB A;  4U76 A;  2GG7 A;  4R60 A;  2GG8 A;  2BWW A;  3IU9 A;  4U71 A;  1WBQ A;  2GG3 A;  2MAT A;  1Y1N A;  2Q94 A;  4A6W A;  4MAT A;  2OKN A;  1KP0 A;  1W2M A;  1PV9 A;  2GZ5 A;  3BIP A;  3CB6 A;  2BHB A;  4RZY A;  4RZZ A;  2Q92 A;  5D6E A;  3CTZ A;  4PNC A;  2EA4 A;  2BWY A;  2ADU A;  4U6E A;  3D27 A;  2GU6 A;  4FLK A;  4U75 A;  4FKC A;  3PKA A;  2BB7 A;  3RVA A;  3IG4 A;  4IDY A;  4S00 A;  1C21 A;  2NQ6 A;  2HOW A;  1WL9 A;  4FO7 A;  4IPA A;  1A16 A;  4IKS A;  4U6W A;  4IKT A;  3Q6D A;  1C23 A;  5D6F A;  5JHU A;  2BWV A;  4QR8 A;  4IU6 A;  5CDL A;  1C27 A;  1R5H A;  2BHA A;  3L7G A;  4ZNG A;  2BH3 A;  5FCH A;  5CNX A;  2BN7 A;  4FUK A;  2BWX A;  2GG9 A;  1WN1 A;  3MR1 A;  2P98 A;  1N51 A;  3FM3 A;  4FLI A;  2GGC A;  2GA2 A;  2P9A A;  2V3Z A;  4OOK A;  2V6C A;  2GGB A;  1WLR A;  1XNZ A;  2B3K A;  2NQ7 A;  1MAT A;  1YJ3 A;  2EVM A;  5CDE A;  4S2T P;  1JAW A;  2EVC A;  4U70 A;  5JI6 A;  1BN5 A;  1XGS A;  2Q95 A;  2Q96 A;  4JUQ A;  4HXX A;  4B28 A;  1M35 A;  1YW7 A;  2Q93 A;  3FMQ A;  4EGE A;  2IW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...