4U6JA

Hsmetap in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6jA00
4HXXA 4MATA 1B6AA 1O0XA 1CHMA 2EVOA 1WBQA 2OAZA 4PV4A 4U6EA 3PKBA 4QR8A 1QXZA 4B28A 4FKCA 2GZ5A 2BHCA 4U76A 1XNZA 4S2RP 1MATA 2BH3A 2GGBA 3Q6DA 4S2TP 2OKNA 4A6VA 3CTZA 2EVCA 2V6CA 3RVAA 2GU5A 3PKCA 2EA4A 3FMRA 1XGSA 3PKDA 3PKAA 4U6CA 2V3XA 1WL9A 1BN5A 3S6BA 3D27A 2GG0A 2GG3A 4Z7MA 3L7GA 4U70A 4IKUA 4KM3A 1C27A 1YW7A 1W2MA 2BWSA 2B3LA 1QXYA 4A6WA 2BHAA 3IU8A 1A16A 4FLLA 3TAVA 4ZWUA 2BWVA 4IKTA 4U6JA 2P99A 1WN1A 2BWTA 2GG2A 2Q94A 1N51A 2Q92A 5D6FA 5CLSA 2IW2A 2NQ7A 1YJ3A 2ZSGA 3IG4A 4U6ZA 3CB5A 2B3KA 2BWYA 2BN7A 3MX6A 1JAWA 1WLRA 1C21A 2Q96A 2BB7A 2GG7A 4FLIA 5CNXA 1YVMA 1YW8A 2GGCA 3CB6A 1BOAA 2BWUA 2GTXA 1R5GA 3RORA 4RZZA 4IPAA 2BHBA 4S01A 1PV9A 1YW9A 5CDEA 1C22A 1KQ9A 2BHDA 2HOWA 4U6WA 4OOKA 5CDLA 1C23A 1WKMA 3PKEA 2GU4A 1WY2A 3BIPA 2Q95A 4FLJA 2GU7A 4IF7A 1R58A 2DFIA 2P9AA 4IECA 4ZWPA 2Q93A 5FCFA 2GA2A 1B59A 5CDVA 5JI6A 3FMQA 3IU7A 5JHUA 4PNCA 4ZWOA 1XGNA 4FO7A 4IKRA 2GG8A 2V3YA 1C24A 4U71A 1W7VA 4JUQA 1XGOA 4S00A 4IKSA 4RZYA 2V3ZA 4IDYA 2EA2A 5CE6A 3L24A 4IU6A 3TB5A 1Y1NA 4FLKA 5D6EA 1XGMA 3MR1A 4U1BA 2GU6A 1QXWA 4U69A 2NQ6A 2BWWA 1WL6A 3FM3A 5FCHA 2P98A 5CIKA 2MATA 1R5HA 2ADUA 3BITA 2Q8KA 2B3HA 4EGEA 4FUKA 2GG5A 1M35A 2BWXA 4FO8A 4U73A 5E5BA 2G6PA 3IU9A 1KQ0A 3BIQA 2EVMA 1QZYA 4RGZ1 4U75A 5JFRA 2GG9A 4ZNGA 4R60A 3MATA 1KP0A
chains in the Genus database with same CATH superfamily
4HXXA 4MATA 1B6AA 1O0XA 1CHMA 2EVOA 1WBQA 2OAZA 4PV4A 4U6EA 3PKBA 4QR8A 1QXZA 4B28A 4FKCA 2GZ5A 2BHCA 4U76A 1XNZA 4S2RP 1MATA 2BH3A 2GGBA 3Q6DA 4S2TP 2OKNA 4A6VA 3CTZA 2EVCA 2V6CA 3RVAA 2GU5A 3PKCA 2EA4A 3FMRA 1XGSA 3PKDA 3PKAA 4U6CA 2V3XA 1WL9A 1BN5A 3S6BA 3D27A 2GG0A 2GG3A 4Z7MA 3L7GA 4U70A 4IKUA 4KM3A 1C27A 1YW7A 1W2MA 2BWSA 2B3LA 1QXYA 4A6WA 2BHAA 3IU8A 1A16A 4FLLA 3TAVA 4ZWUA 2BWVA 4IKTA 4U6JA 2P99A 1WN1A 2BWTA 2GG2A 2Q94A 1N51A 2Q92A 5D6FA 5CLSA 2IW2A 2NQ7A 1YJ3A 2ZSGA 3IG4A 4U6ZA 3CB5A 2B3KA 2BWYA 2BN7A 3MX6A 1JAWA 1WLRA 1C21A 2Q96A 2BB7A 2GG7A 4FLIA 5CNXA 1YVMA 1YW8A 2GGCA 3CB6A 1BOAA 2BWUA 2GTXA 1R5GA 3RORA 4RZZA 4IPAA 2BHBA 4S01A 1PV9A 1YW9A 5CDEA 1C22A 1KQ9A 2BHDA 2HOWA 4U6WA 4OOKA 5CDLA 1C23A 1WKMA 3PKEA 2GU4A 1WY2A 3BIPA 2Q95A 4FLJA 2GU7A 4IF7A 1R58A 2DFIA 2P9AA 4IECA 4ZWPA 2Q93A 5FCFA 2GA2A 1B59A 5CDVA 5JI6A 3FMQA 3IU7A 5JHUA 4PNCA 4ZWOA 1XGNA 4FO7A 4IKRA 2GG8A 2V3YA 1C24A 4U71A 1W7VA 4JUQA 1XGOA 4S00A 4IKSA 4RZYA 2V3ZA 4IDYA 2EA2A 5CE6A 3L24A 4IU6A 3TB5A 1Y1NA 4FLKA 5D6EA 1XGMA 3MR1A 4U1BA 2GU6A 1QXWA 4U69A 2NQ6A 2BWWA 1WL6A 3FM3A 5FCHA 2P98A 5CIKA 2MATA 1R5HA 2ADUA 3BITA 2Q8KA 2B3HA 4EGEA 4FUKA 2GG5A 1M35A 2BWXA 4FO8A 4U73A 5E5BA 2G6PA 3IU9A 1KQ0A 3BIQA 2EVMA 1QZYA 4RGZ1 4U75A 5JFRA 2GG9A 4ZNGA 4R60A 3MATA 1KP0A
chains in the Genus database with same CATH topology
4HXXA 4MATA 1B6AA 1O0XA 1CHMA 2EVOA 1WBQA 2OAZA 4PV4A 4U6EA 3PKBA 4QR8A 1QXZA 4B28A 4FKCA 2GZ5A 2BHCA 4U76A 1XNZA 4S2RP 1MATA 2BH3A 2GGBA 3Q6DA 4S2TP 2OKNA 4A6VA 3CTZA 2EVCA 2V6CA 3RVAA 2GU5A 3PKCA 2EA4A 3FMRA 1XGSA 3PKDA 3PKAA 4U6CA 2V3XA 1WL9A 1BN5A 3S6BA 3D27A 2GG0A 2GG3A 4Z7MA 3L7GA 4U70A 4IKUA 4KM3A 1C27A 1YW7A 1W2MA 2BWSA 2B3LA 1QXYA 4A6WA 2BHAA 3IU8A 1A16A 4FLLA 3TAVA 4ZWUA 2BWVA 4IKTA 4U6JA 2P99A 1WN1A 2BWTA 2GG2A 2Q94A 1N51A 2Q92A 5D6FA 5CLSA 2IW2A 2NQ7A 1YJ3A 2ZSGA 3IG4A 4U6ZA 3CB5A 2B3KA 2BWYA 2BN7A 3MX6A 1JAWA 1WLRA 1C21A 2Q96A 2BB7A 2GG7A 4FLIA 5CNXA 1YVMA 1YW8A 2GGCA 3CB6A 1BOAA 2BWUA 2GTXA 1R5GA 3RORA 4RZZA 4IPAA 2BHBA 4S01A 1PV9A 1YW9A 5CDEA 1C22A 1KQ9A 2BHDA 2HOWA 4U6WA 4OOKA 5CDLA 1C23A 1WKMA 3PKEA 2GU4A 1WY2A 3BIPA 2Q95A 4FLJA 2GU7A 4IF7A 1R58A 2DFIA 2P9AA 4IECA 4ZWPA 2Q93A 5FCFA 2GA2A 1B59A 5CDVA 5JI6A 3FMQA 3IU7A 5JHUA 4PNCA 4ZWOA 1XGNA 4FO7A 4IKRA 2GG8A 2V3YA 1C24A 4U71A 1W7VA 4JUQA 1XGOA 4S00A 4IKSA 4RZYA 2V3ZA 4IDYA 2EA2A 5CE6A 3L24A 4IU6A 3TB5A 1Y1NA 4FLKA 5D6EA 1XGMA 3MR1A 4U1BA 2GU6A 1QXWA 4U69A 2NQ6A 2BWWA 1WL6A 3FM3A 5FCHA 2P98A 5CIKA 2MATA 1R5HA 2ADUA 3BITA 2Q8KA 2B3HA 4EGEA 4FUKA 2GG5A 1M35A 2BWXA 4FO8A 4U73A 5E5BA 2G6PA 3IU9A 1KQ0A 3BIQA 2EVMA 1QZYA 4RGZ1 4U75A 5JFRA 2GG9A 4ZNGA 4R60A 3MATA 1KP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXX A;  4MAT A;  1B6A A;  1O0X A;  1CHM A;  2EVO A;  1WBQ A;  2OAZ A;  4PV4 A;  4U6E A;  3PKB A;  4QR8 A;  1QXZ A;  4B28 A;  4FKC A;  2GZ5 A;  2BHC A;  4U76 A;  1XNZ A;  4S2R P;  1MAT A;  2BH3 A;  2GGB A;  3Q6D A;  4S2T P;  2OKN A;  4A6V A;  3CTZ A;  2EVC A;  2V6C A;  3RVA A;  2GU5 A;  3PKC A;  2EA4 A;  3FMR A;  1XGS A;  3PKD A;  3PKA A;  4U6C A;  2V3X A;  1WL9 A;  1BN5 A;  3S6B A;  3D27 A;  2GG0 A;  2GG3 A;  4Z7M A;  3L7G A;  4U70 A;  4IKU A;  4KM3 A;  1C27 A;  1YW7 A;  1W2M A;  2BWS A;  2B3L A;  1QXY A;  4A6W A;  2BHA A;  3IU8 A;  1A16 A;  4FLL A;  3TAV A;  4ZWU A;  2BWV A;  4IKT A;  4U6J A;  2P99 A;  1WN1 A;  2BWT A;  2GG2 A;  2Q94 A;  1N51 A;  2Q92 A;  5D6F A;  5CLS A;  2IW2 A;  2NQ7 A;  1YJ3 A;  2ZSG A;  3IG4 A;  4U6Z A;  3CB5 A;  2B3K A;  2BWY A;  2BN7 A;  3MX6 A;  1JAW A;  1WLR A;  1C21 A;  2Q96 A;  2BB7 A;  2GG7 A;  4FLI A;  5CNX A;  1YVM A;  1YW8 A;  2GGC A;  3CB6 A;  1BOA A;  2BWU A;  2GTX A;  1R5G A;  3ROR A;  4RZZ A;  4IPA A;  2BHB A;  4S01 A;  1PV9 A;  1YW9 A;  5CDE A;  1C22 A;  1KQ9 A;  2BHD A;  2HOW A;  4U6W A;  4OOK A;  5CDL A;  1C23 A;  1WKM A;  3PKE A;  2GU4 A;  1WY2 A;  3BIP A;  2Q95 A;  4FLJ A;  2GU7 A;  4IF7 A;  1R58 A;  2DFI A;  2P9A A;  4IEC A;  4ZWP A;  2Q93 A;  5FCF A;  2GA2 A;  1B59 A;  5CDV A;  5JI6 A;  3FMQ A;  3IU7 A;  5JHU A;  4PNC A;  4ZWO A;  1XGN A;  4FO7 A;  4IKR A;  2GG8 A;  2V3Y A;  1C24 A;  4U71 A;  1W7V A;  4JUQ A;  1XGO A;  4S00 A;  4IKS A;  4RZY A;  2V3Z A;  4IDY A;  2EA2 A;  5CE6 A;  3L24 A;  4IU6 A;  3TB5 A;  1Y1N A;  4FLK A;  5D6E A;  1XGM A;  3MR1 A;  4U1B A;  2GU6 A;  1QXW A;  4U69 A;  2NQ6 A;  2BWW A;  1WL6 A;  3FM3 A;  5FCH A;  2P98 A;  5CIK A;  2MAT A;  1R5H A;  2ADU A;  3BIT A;  2Q8K A;  2B3H A;  4EGE A;  4FUK A;  2GG5 A;  1M35 A;  2BWX A;  4FO8 A;  4U73 A;  5E5B A;  2G6P A;  3IU9 A;  1KQ0 A;  3BIQ A;  2EVM A;  1QZY A;  4RGZ 1;  4U75 A;  5JFR A;  2GG9 A;  4ZNG A;  4R60 A;  3MAT A;  1KP0 A; 
#chains in the Genus database with same CATH topology
 4HXX A;  4MAT A;  1B6A A;  1O0X A;  1CHM A;  2EVO A;  1WBQ A;  2OAZ A;  4PV4 A;  4U6E A;  3PKB A;  4QR8 A;  1QXZ A;  4B28 A;  4FKC A;  2GZ5 A;  2BHC A;  4U76 A;  1XNZ A;  4S2R P;  1MAT A;  2BH3 A;  2GGB A;  3Q6D A;  4S2T P;  2OKN A;  4A6V A;  3CTZ A;  2EVC A;  2V6C A;  3RVA A;  2GU5 A;  3PKC A;  2EA4 A;  3FMR A;  1XGS A;  3PKD A;  3PKA A;  4U6C A;  2V3X A;  1WL9 A;  1BN5 A;  3S6B A;  3D27 A;  2GG0 A;  2GG3 A;  4Z7M A;  3L7G A;  4U70 A;  4IKU A;  4KM3 A;  1C27 A;  1YW7 A;  1W2M A;  2BWS A;  2B3L A;  1QXY A;  4A6W A;  2BHA A;  3IU8 A;  1A16 A;  4FLL A;  3TAV A;  4ZWU A;  2BWV A;  4IKT A;  4U6J A;  2P99 A;  1WN1 A;  2BWT A;  2GG2 A;  2Q94 A;  1N51 A;  2Q92 A;  5D6F A;  5CLS A;  2IW2 A;  2NQ7 A;  1YJ3 A;  2ZSG A;  3IG4 A;  4U6Z A;  3CB5 A;  2B3K A;  2BWY A;  2BN7 A;  3MX6 A;  1JAW A;  1WLR A;  1C21 A;  2Q96 A;  2BB7 A;  2GG7 A;  4FLI A;  5CNX A;  1YVM A;  1YW8 A;  2GGC A;  3CB6 A;  1BOA A;  2BWU A;  2GTX A;  1R5G A;  3ROR A;  4RZZ A;  4IPA A;  2BHB A;  4S01 A;  1PV9 A;  1YW9 A;  5CDE A;  1C22 A;  1KQ9 A;  2BHD A;  2HOW A;  4U6W A;  4OOK A;  5CDL A;  1C23 A;  1WKM A;  3PKE A;  2GU4 A;  1WY2 A;  3BIP A;  2Q95 A;  4FLJ A;  2GU7 A;  4IF7 A;  1R58 A;  2DFI A;  2P9A A;  4IEC A;  4ZWP A;  2Q93 A;  5FCF A;  2GA2 A;  1B59 A;  5CDV A;  5JI6 A;  3FMQ A;  3IU7 A;  5JHU A;  4PNC A;  4ZWO A;  1XGN A;  4FO7 A;  4IKR A;  2GG8 A;  2V3Y A;  1C24 A;  4U71 A;  1W7V A;  4JUQ A;  1XGO A;  4S00 A;  4IKS A;  4RZY A;  2V3Z A;  4IDY A;  2EA2 A;  5CE6 A;  3L24 A;  4IU6 A;  3TB5 A;  1Y1N A;  4FLK A;  5D6E A;  1XGM A;  3MR1 A;  4U1B A;  2GU6 A;  1QXW A;  4U69 A;  2NQ6 A;  2BWW A;  1WL6 A;  3FM3 A;  5FCH A;  2P98 A;  5CIK A;  2MAT A;  1R5H A;  2ADU A;  3BIT A;  2Q8K A;  2B3H A;  4EGE A;  4FUK A;  2GG5 A;  1M35 A;  2BWX A;  4FO8 A;  4U73 A;  5E5B A;  2G6P A;  3IU9 A;  1KQ0 A;  3BIQ A;  2EVM A;  1QZY A;  4RGZ 1;  4U75 A;  5JFR A;  2GG9 A;  4ZNG A;  4R60 A;  3MAT A;  1KP0 A; 
#chains in the Genus database with same CATH homology
 4HXX A;  4MAT A;  1B6A A;  1O0X A;  1CHM A;  2EVO A;  1WBQ A;  2OAZ A;  4PV4 A;  4U6E A;  3PKB A;  4QR8 A;  1QXZ A;  4B28 A;  4FKC A;  2GZ5 A;  2BHC A;  4U76 A;  1XNZ A;  4S2R P;  1MAT A;  2BH3 A;  2GGB A;  3Q6D A;  4S2T P;  2OKN A;  4A6V A;  3CTZ A;  2EVC A;  2V6C A;  3RVA A;  2GU5 A;  3PKC A;  2EA4 A;  3FMR A;  1XGS A;  3PKD A;  3PKA A;  4U6C A;  2V3X A;  1WL9 A;  1BN5 A;  3S6B A;  3D27 A;  2GG0 A;  2GG3 A;  4Z7M A;  3L7G A;  4U70 A;  4IKU A;  4KM3 A;  1C27 A;  1YW7 A;  1W2M A;  2BWS A;  2B3L A;  1QXY A;  4A6W A;  2BHA A;  3IU8 A;  1A16 A;  4FLL A;  3TAV A;  4ZWU A;  2BWV A;  4IKT A;  4U6J A;  2P99 A;  1WN1 A;  2BWT A;  2GG2 A;  2Q94 A;  1N51 A;  2Q92 A;  5D6F A;  5CLS A;  2IW2 A;  2NQ7 A;  1YJ3 A;  2ZSG A;  3IG4 A;  4U6Z A;  3CB5 A;  2B3K A;  2BWY A;  2BN7 A;  3MX6 A;  1JAW A;  1WLR A;  1C21 A;  2Q96 A;  2BB7 A;  2GG7 A;  4FLI A;  5CNX A;  1YVM A;  1YW8 A;  2GGC A;  3CB6 A;  1BOA A;  2BWU A;  2GTX A;  1R5G A;  3ROR A;  4RZZ A;  4IPA A;  2BHB A;  4S01 A;  1PV9 A;  1YW9 A;  5CDE A;  1C22 A;  1KQ9 A;  2BHD A;  2HOW A;  4U6W A;  4OOK A;  5CDL A;  1C23 A;  1WKM A;  3PKE A;  2GU4 A;  1WY2 A;  3BIP A;  2Q95 A;  4FLJ A;  2GU7 A;  4IF7 A;  1R58 A;  2DFI A;  2P9A A;  4IEC A;  4ZWP A;  2Q93 A;  5FCF A;  2GA2 A;  1B59 A;  5CDV A;  5JI6 A;  3FMQ A;  3IU7 A;  5JHU A;  4PNC A;  4ZWO A;  1XGN A;  4FO7 A;  4IKR A;  2GG8 A;  2V3Y A;  1C24 A;  4U71 A;  1W7V A;  4JUQ A;  1XGO A;  4S00 A;  4IKS A;  4RZY A;  2V3Z A;  4IDY A;  2EA2 A;  5CE6 A;  3L24 A;  4IU6 A;  3TB5 A;  1Y1N A;  4FLK A;  5D6E A;  1XGM A;  3MR1 A;  4U1B A;  2GU6 A;  1QXW A;  4U69 A;  2NQ6 A;  2BWW A;  1WL6 A;  3FM3 A;  5FCH A;  2P98 A;  5CIK A;  2MAT A;  1R5H A;  2ADU A;  3BIT A;  2Q8K A;  2B3H A;  4EGE A;  4FUK A;  2GG5 A;  1M35 A;  2BWX A;  4FO8 A;  4U73 A;  5E5B A;  2G6P A;  3IU9 A;  1KQ0 A;  3BIQ A;  2EVM A;  1QZY A;  4RGZ 1;  4U75 A;  5JFR A;  2GG9 A;  4ZNG A;  4R60 A;  3MAT A;  1KP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...