4U6JA

Hsmetap in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6jA00
2P99A 2P9AA 1XGNA 2BB7A 4QR8A 2BWVA 3FMQA 1WY2A 2GGBA 4IKTA 1KQ0A 5D6EA 2IW2A 4RGZ1 2BHBA 2Q95A 1BOAA 1C24A 1YW9A 4U73A 4A6VA 2EVOA 2GG7A 1QZYA 1W7VA 3L24A 2BH3A 2NQ6A 1WLRA 1JAWA 2GG3A 4RZZA 5E5BA 2BN7A 5CDVA 2V3ZA 2GU5A 3S6BA 2P98A 3D27A 3TAVA 1B59A 2EVMA 2B3KA 4FLLA 1R58A 3PKEA 4U6JA 1R5GA 1CHMA 4MATA 1C27A 2DFIA 2BWWA 2V3XA 1YW7A 4S01A 1XNZA 3CTZA 1WL9A 5CE6A 4FUKA 4FO7A 2GG0A 2GTXA 1A16A 4OOKA 1B6AA 3BIQA 2B3LA 4ZNGA 4PV4A 1W2MA 4IF7A 2BWSA 4A6WA 3PKCA 3CB5A 4FKCA 2GU6A 4U75A 4U71A 2GU4A 4RZYA 2Q94A 2V3YA 3IU8A 1C22A 3MR1A 2OKNA 1BN5A 1QXWA 4IU6A 2BHCA 5D6FA 5CDEA 4IKSA 4B28A 5CIKA 5JI6A 4PNCA 1O0XA 3RORA 2Q93A 4ZWUA 4IECA 2NQ7A 1MATA 2GG9A 2EVCA 1M35A 4U6ZA 2BWYA 2HOWA 1XGSA 4FLJA 2BWXA 2GGCA 1R5HA 3PKDA 2EA4A 4U6EA 5FCHA 5CNXA 3RVAA 4KM3A 2OAZA 2Q92A 2GA2A 4JUQA 5JHUA 1C21A 1XGMA 4S00A 1C23A 1WBQA 5JFRA 2V6CA 1YJ3A 3FMRA 4FLKA 4R60A 3PKBA 4FLIA 4FO8A 1Y1NA 3TB5A 1WL6A 3IG4A 4ZWPA 1YVMA 3IU9A 2GG5A 3PKAA 4Z7MA 2Q8KA 2ADUA 2BHAA 1PV9A 2GU7A 5CDLA 2EA2A 4IDYA 1QXYA 4U69A 5CLSA 2BWUA 1WKMA 4S2TP 1YW8A 3IU7A 4EGEA 4U1BA 4HXXA 5FCFA 2GG2A 2GG8A 4IKUA 2BHDA 1N51A 3MX6A 1WN1A 4ZWOA 4U6WA 3Q6DA 4U6CA 2G6PA 1QXZA 4U76A 4S2RP 1XGOA 3MATA 3FM3A 2Q96A 4IPAA 3BITA 3L7GA 4U70A 2MATA 3BIPA 2B3HA 1KP0A 4IKRA 1KQ9A 2GZ5A 3CB6A 2ZSGA 2BWTA
chains in the Genus database with same CATH superfamily
2P99A 2P9AA 1XGNA 2BB7A 4QR8A 2BWVA 3FMQA 1WY2A 2GGBA 4IKTA 1KQ0A 5D6EA 2IW2A 4RGZ1 2BHBA 2Q95A 1BOAA 1C24A 1YW9A 4U73A 4A6VA 2EVOA 2GG7A 1QZYA 1W7VA 3L24A 2BH3A 2NQ6A 1WLRA 1JAWA 2GG3A 4RZZA 5E5BA 2BN7A 5CDVA 2V3ZA 2GU5A 3S6BA 2P98A 3D27A 3TAVA 1B59A 2EVMA 2B3KA 4FLLA 1R58A 3PKEA 4U6JA 1R5GA 1CHMA 4MATA 1C27A 2DFIA 2BWWA 2V3XA 1YW7A 4S01A 1XNZA 3CTZA 1WL9A 5CE6A 4FUKA 4FO7A 2GG0A 2GTXA 1A16A 4OOKA 1B6AA 3BIQA 2B3LA 4ZNGA 4PV4A 1W2MA 4IF7A 2BWSA 4A6WA 3PKCA 3CB5A 4FKCA 2GU6A 4U75A 4U71A 2GU4A 4RZYA 2Q94A 2V3YA 3IU8A 1C22A 3MR1A 2OKNA 1BN5A 1QXWA 4IU6A 2BHCA 5D6FA 5CDEA 4IKSA 4B28A 5CIKA 5JI6A 4PNCA 1O0XA 3RORA 2Q93A 4ZWUA 4IECA 2NQ7A 1MATA 2GG9A 2EVCA 1M35A 4U6ZA 2BWYA 2HOWA 1XGSA 4FLJA 2BWXA 2GGCA 1R5HA 3PKDA 2EA4A 4U6EA 5FCHA 5CNXA 3RVAA 4KM3A 2OAZA 2Q92A 2GA2A 4JUQA 5JHUA 1C21A 1XGMA 4S00A 1C23A 1WBQA 5JFRA 2V6CA 1YJ3A 3FMRA 4FLKA 4R60A 3PKBA 4FLIA 4FO8A 1Y1NA 3TB5A 1WL6A 3IG4A 4ZWPA 1YVMA 3IU9A 2GG5A 3PKAA 4Z7MA 2Q8KA 2ADUA 2BHAA 1PV9A 2GU7A 5CDLA 2EA2A 4IDYA 1QXYA 4U69A 5CLSA 2BWUA 1WKMA 4S2TP 1YW8A 3IU7A 4EGEA 4U1BA 4HXXA 5FCFA 2GG2A 2GG8A 4IKUA 2BHDA 1N51A 3MX6A 1WN1A 4ZWOA 4U6WA 3Q6DA 4U6CA 2G6PA 1QXZA 4U76A 4S2RP 1XGOA 3MATA 3FM3A 2Q96A 4IPAA 3BITA 3L7GA 4U70A 2MATA 3BIPA 2B3HA 1KP0A 4IKRA 1KQ9A 2GZ5A 3CB6A 2ZSGA 2BWTA
chains in the Genus database with same CATH topology
2P99A 2P9AA 1XGNA 2BB7A 4QR8A 2BWVA 3FMQA 1WY2A 2GGBA 4IKTA 1KQ0A 5D6EA 2IW2A 4RGZ1 2BHBA 2Q95A 1BOAA 1C24A 1YW9A 4U73A 4A6VA 2EVOA 2GG7A 1QZYA 1W7VA 3L24A 2BH3A 2NQ6A 1WLRA 1JAWA 2GG3A 4RZZA 5E5BA 2BN7A 5CDVA 2V3ZA 2GU5A 3S6BA 2P98A 3D27A 3TAVA 1B59A 2EVMA 2B3KA 4FLLA 1R58A 3PKEA 4U6JA 1R5GA 1CHMA 4MATA 1C27A 2DFIA 2BWWA 2V3XA 1YW7A 4S01A 1XNZA 3CTZA 1WL9A 5CE6A 4FUKA 4FO7A 2GG0A 2GTXA 1A16A 4OOKA 1B6AA 3BIQA 2B3LA 4ZNGA 4PV4A 1W2MA 4IF7A 2BWSA 4A6WA 3PKCA 3CB5A 4FKCA 2GU6A 4U75A 4U71A 2GU4A 4RZYA 2Q94A 2V3YA 3IU8A 1C22A 3MR1A 2OKNA 1BN5A 1QXWA 4IU6A 2BHCA 5D6FA 5CDEA 4IKSA 4B28A 5CIKA 5JI6A 4PNCA 1O0XA 3RORA 2Q93A 4ZWUA 4IECA 2NQ7A 1MATA 2GG9A 2EVCA 1M35A 4U6ZA 2BWYA 2HOWA 1XGSA 4FLJA 2BWXA 2GGCA 1R5HA 3PKDA 2EA4A 4U6EA 5FCHA 5CNXA 3RVAA 4KM3A 2OAZA 2Q92A 2GA2A 4JUQA 5JHUA 1C21A 1XGMA 4S00A 1C23A 1WBQA 5JFRA 2V6CA 1YJ3A 3FMRA 4FLKA 4R60A 3PKBA 4FLIA 4FO8A 1Y1NA 3TB5A 1WL6A 3IG4A 4ZWPA 1YVMA 3IU9A 2GG5A 3PKAA 4Z7MA 2Q8KA 2ADUA 2BHAA 1PV9A 2GU7A 5CDLA 2EA2A 4IDYA 1QXYA 4U69A 5CLSA 2BWUA 1WKMA 4S2TP 1YW8A 3IU7A 4EGEA 4U1BA 4HXXA 5FCFA 2GG2A 2GG8A 4IKUA 2BHDA 1N51A 3MX6A 1WN1A 4ZWOA 4U6WA 3Q6DA 4U6CA 2G6PA 1QXZA 4U76A 4S2RP 1XGOA 3MATA 3FM3A 2Q96A 4IPAA 3BITA 3L7GA 4U70A 2MATA 3BIPA 2B3HA 1KP0A 4IKRA 1KQ9A 2GZ5A 3CB6A 2ZSGA 2BWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P99 A;  2P9A A;  1XGN A;  2BB7 A;  4QR8 A;  2BWV A;  3FMQ A;  1WY2 A;  2GGB A;  4IKT A;  1KQ0 A;  5D6E A;  2IW2 A;  4RGZ 1;  2BHB A;  2Q95 A;  1BOA A;  1C24 A;  1YW9 A;  4U73 A;  4A6V A;  2EVO A;  2GG7 A;  1QZY A;  1W7V A;  3L24 A;  2BH3 A;  2NQ6 A;  1WLR A;  1JAW A;  2GG3 A;  4RZZ A;  5E5B A;  2BN7 A;  5CDV A;  2V3Z A;  2GU5 A;  3S6B A;  2P98 A;  3D27 A;  3TAV A;  1B59 A;  2EVM A;  2B3K A;  4FLL A;  1R58 A;  3PKE A;  4U6J A;  1R5G A;  1CHM A;  4MAT A;  1C27 A;  2DFI A;  2BWW A;  2V3X A;  1YW7 A;  4S01 A;  1XNZ A;  3CTZ A;  1WL9 A;  5CE6 A;  4FUK A;  4FO7 A;  2GG0 A;  2GTX A;  1A16 A;  4OOK A;  1B6A A;  3BIQ A;  2B3L A;  4ZNG A;  4PV4 A;  1W2M A;  4IF7 A;  2BWS A;  4A6W A;  3PKC A;  3CB5 A;  4FKC A;  2GU6 A;  4U75 A;  4U71 A;  2GU4 A;  4RZY A;  2Q94 A;  2V3Y A;  3IU8 A;  1C22 A;  3MR1 A;  2OKN A;  1BN5 A;  1QXW A;  4IU6 A;  2BHC A;  5D6F A;  5CDE A;  4IKS A;  4B28 A;  5CIK A;  5JI6 A;  4PNC A;  1O0X A;  3ROR A;  2Q93 A;  4ZWU A;  4IEC A;  2NQ7 A;  1MAT A;  2GG9 A;  2EVC A;  1M35 A;  4U6Z A;  2BWY A;  2HOW A;  1XGS A;  4FLJ A;  2BWX A;  2GGC A;  1R5H A;  3PKD A;  2EA4 A;  4U6E A;  5FCH A;  5CNX A;  3RVA A;  4KM3 A;  2OAZ A;  2Q92 A;  2GA2 A;  4JUQ A;  5JHU A;  1C21 A;  1XGM A;  4S00 A;  1C23 A;  1WBQ A;  5JFR A;  2V6C A;  1YJ3 A;  3FMR A;  4FLK A;  4R60 A;  3PKB A;  4FLI A;  4FO8 A;  1Y1N A;  3TB5 A;  1WL6 A;  3IG4 A;  4ZWP A;  1YVM A;  3IU9 A;  2GG5 A;  3PKA A;  4Z7M A;  2Q8K A;  2ADU A;  2BHA A;  1PV9 A;  2GU7 A;  5CDL A;  2EA2 A;  4IDY A;  1QXY A;  4U69 A;  5CLS A;  2BWU A;  1WKM A;  4S2T P;  1YW8 A;  3IU7 A;  4EGE A;  4U1B A;  4HXX A;  5FCF A;  2GG2 A;  2GG8 A;  4IKU A;  2BHD A;  1N51 A;  3MX6 A;  1WN1 A;  4ZWO A;  4U6W A;  3Q6D A;  4U6C A;  2G6P A;  1QXZ A;  4U76 A;  4S2R P;  1XGO A;  3MAT A;  3FM3 A;  2Q96 A;  4IPA A;  3BIT A;  3L7G A;  4U70 A;  2MAT A;  3BIP A;  2B3H A;  1KP0 A;  4IKR A;  1KQ9 A;  2GZ5 A;  3CB6 A;  2ZSG A;  2BWT A; 
#chains in the Genus database with same CATH topology
 2P99 A;  2P9A A;  1XGN A;  2BB7 A;  4QR8 A;  2BWV A;  3FMQ A;  1WY2 A;  2GGB A;  4IKT A;  1KQ0 A;  5D6E A;  2IW2 A;  4RGZ 1;  2BHB A;  2Q95 A;  1BOA A;  1C24 A;  1YW9 A;  4U73 A;  4A6V A;  2EVO A;  2GG7 A;  1QZY A;  1W7V A;  3L24 A;  2BH3 A;  2NQ6 A;  1WLR A;  1JAW A;  2GG3 A;  4RZZ A;  5E5B A;  2BN7 A;  5CDV A;  2V3Z A;  2GU5 A;  3S6B A;  2P98 A;  3D27 A;  3TAV A;  1B59 A;  2EVM A;  2B3K A;  4FLL A;  1R58 A;  3PKE A;  4U6J A;  1R5G A;  1CHM A;  4MAT A;  1C27 A;  2DFI A;  2BWW A;  2V3X A;  1YW7 A;  4S01 A;  1XNZ A;  3CTZ A;  1WL9 A;  5CE6 A;  4FUK A;  4FO7 A;  2GG0 A;  2GTX A;  1A16 A;  4OOK A;  1B6A A;  3BIQ A;  2B3L A;  4ZNG A;  4PV4 A;  1W2M A;  4IF7 A;  2BWS A;  4A6W A;  3PKC A;  3CB5 A;  4FKC A;  2GU6 A;  4U75 A;  4U71 A;  2GU4 A;  4RZY A;  2Q94 A;  2V3Y A;  3IU8 A;  1C22 A;  3MR1 A;  2OKN A;  1BN5 A;  1QXW A;  4IU6 A;  2BHC A;  5D6F A;  5CDE A;  4IKS A;  4B28 A;  5CIK A;  5JI6 A;  4PNC A;  1O0X A;  3ROR A;  2Q93 A;  4ZWU A;  4IEC A;  2NQ7 A;  1MAT A;  2GG9 A;  2EVC A;  1M35 A;  4U6Z A;  2BWY A;  2HOW A;  1XGS A;  4FLJ A;  2BWX A;  2GGC A;  1R5H A;  3PKD A;  2EA4 A;  4U6E A;  5FCH A;  5CNX A;  3RVA A;  4KM3 A;  2OAZ A;  2Q92 A;  2GA2 A;  4JUQ A;  5JHU A;  1C21 A;  1XGM A;  4S00 A;  1C23 A;  1WBQ A;  5JFR A;  2V6C A;  1YJ3 A;  3FMR A;  4FLK A;  4R60 A;  3PKB A;  4FLI A;  4FO8 A;  1Y1N A;  3TB5 A;  1WL6 A;  3IG4 A;  4ZWP A;  1YVM A;  3IU9 A;  2GG5 A;  3PKA A;  4Z7M A;  2Q8K A;  2ADU A;  2BHA A;  1PV9 A;  2GU7 A;  5CDL A;  2EA2 A;  4IDY A;  1QXY A;  4U69 A;  5CLS A;  2BWU A;  1WKM A;  4S2T P;  1YW8 A;  3IU7 A;  4EGE A;  4U1B A;  4HXX A;  5FCF A;  2GG2 A;  2GG8 A;  4IKU A;  2BHD A;  1N51 A;  3MX6 A;  1WN1 A;  4ZWO A;  4U6W A;  3Q6D A;  4U6C A;  2G6P A;  1QXZ A;  4U76 A;  4S2R P;  1XGO A;  3MAT A;  3FM3 A;  2Q96 A;  4IPA A;  3BIT A;  3L7G A;  4U70 A;  2MAT A;  3BIP A;  2B3H A;  1KP0 A;  4IKR A;  1KQ9 A;  2GZ5 A;  3CB6 A;  2ZSG A;  2BWT A; 
#chains in the Genus database with same CATH homology
 2P99 A;  2P9A A;  1XGN A;  2BB7 A;  4QR8 A;  2BWV A;  3FMQ A;  1WY2 A;  2GGB A;  4IKT A;  1KQ0 A;  5D6E A;  2IW2 A;  4RGZ 1;  2BHB A;  2Q95 A;  1BOA A;  1C24 A;  1YW9 A;  4U73 A;  4A6V A;  2EVO A;  2GG7 A;  1QZY A;  1W7V A;  3L24 A;  2BH3 A;  2NQ6 A;  1WLR A;  1JAW A;  2GG3 A;  4RZZ A;  5E5B A;  2BN7 A;  5CDV A;  2V3Z A;  2GU5 A;  3S6B A;  2P98 A;  3D27 A;  3TAV A;  1B59 A;  2EVM A;  2B3K A;  4FLL A;  1R58 A;  3PKE A;  4U6J A;  1R5G A;  1CHM A;  4MAT A;  1C27 A;  2DFI A;  2BWW A;  2V3X A;  1YW7 A;  4S01 A;  1XNZ A;  3CTZ A;  1WL9 A;  5CE6 A;  4FUK A;  4FO7 A;  2GG0 A;  2GTX A;  1A16 A;  4OOK A;  1B6A A;  3BIQ A;  2B3L A;  4ZNG A;  4PV4 A;  1W2M A;  4IF7 A;  2BWS A;  4A6W A;  3PKC A;  3CB5 A;  4FKC A;  2GU6 A;  4U75 A;  4U71 A;  2GU4 A;  4RZY A;  2Q94 A;  2V3Y A;  3IU8 A;  1C22 A;  3MR1 A;  2OKN A;  1BN5 A;  1QXW A;  4IU6 A;  2BHC A;  5D6F A;  5CDE A;  4IKS A;  4B28 A;  5CIK A;  5JI6 A;  4PNC A;  1O0X A;  3ROR A;  2Q93 A;  4ZWU A;  4IEC A;  2NQ7 A;  1MAT A;  2GG9 A;  2EVC A;  1M35 A;  4U6Z A;  2BWY A;  2HOW A;  1XGS A;  4FLJ A;  2BWX A;  2GGC A;  1R5H A;  3PKD A;  2EA4 A;  4U6E A;  5FCH A;  5CNX A;  3RVA A;  4KM3 A;  2OAZ A;  2Q92 A;  2GA2 A;  4JUQ A;  5JHU A;  1C21 A;  1XGM A;  4S00 A;  1C23 A;  1WBQ A;  5JFR A;  2V6C A;  1YJ3 A;  3FMR A;  4FLK A;  4R60 A;  3PKB A;  4FLI A;  4FO8 A;  1Y1N A;  3TB5 A;  1WL6 A;  3IG4 A;  4ZWP A;  1YVM A;  3IU9 A;  2GG5 A;  3PKA A;  4Z7M A;  2Q8K A;  2ADU A;  2BHA A;  1PV9 A;  2GU7 A;  5CDL A;  2EA2 A;  4IDY A;  1QXY A;  4U69 A;  5CLS A;  2BWU A;  1WKM A;  4S2T P;  1YW8 A;  3IU7 A;  4EGE A;  4U1B A;  4HXX A;  5FCF A;  2GG2 A;  2GG8 A;  4IKU A;  2BHD A;  1N51 A;  3MX6 A;  1WN1 A;  4ZWO A;  4U6W A;  3Q6D A;  4U6C A;  2G6P A;  1QXZ A;  4U76 A;  4S2R P;  1XGO A;  3MAT A;  3FM3 A;  2Q96 A;  4IPA A;  3BIT A;  3L7G A;  4U70 A;  2MAT A;  3BIP A;  2B3H A;  1KP0 A;  4IKR A;  1KQ9 A;  2GZ5 A;  3CB6 A;  2ZSG A;  2BWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...