4U6JA

Hsmetap in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
b'YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase 1
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6jA00
4R60A 4A6WA 4ZWUA 4ZNGA 5CDVA 2G6PA 4QR8A 1R5HA 1A16A 2Q93A 3BITA 1C21A 5CIKA 4FLKA 4IKUA 2GU5A 5D6FA 4IKRA 2BB7A 2P98A 4RZZA 4S00A 2GU6A 2DFIA 4U6ZA 2HOWA 4FLIA 2B3HA 2NQ6A 3CB6A 4ZWOA 3TAVA 2GU4A 2BHAA 2BHDA 2OKNA 1W2MA 1M35A 2GU7A 4FUKA 4RZYA 3PKDA 4MATA 1QZYA 3PKCA 4IPAA 2EVOA 5E5BA 5JFRA 1CHMA 4S2RP 2BWUA 4U6EA 2Q92A 1XNZA 1PV9A 1WKMA 1KP0A 4U71A 4U1BA 4ZWPA 4U6JA 4U70A 4FLLA 1WN1A 4U76A 2EVCA 2GZ5A 4FO7A 2GG8A 1YW8A 1WY2A 1YW9A 2BN7A 4FKCA 1C22A 2Q8KA 1XGNA 3FM3A 4JUQA 1BN5A 2GGCA 1B6AA 3IU9A 4IDYA 3MATA 2BWWA 3RVAA 3RORA 2BH3A 4Z7MA 1KQ0A 5CNXA 1QXYA 3PKEA 1WL9A 4U69A 3S6BA 1R5GA 2Q95A 1C24A 2GG5A 1C27A 5FCFA 3MX6A 1XGSA 2GG9A 2BWXA 4U6WA 3IU8A 2B3LA 2MATA 4S2TP 1YW7A 4IKTA 2NQ7A 4PNCA 2BWYA 5JHUA 3BIQA 1N51A 3D27A 1WL6A 2V3YA 5JI6A 3L24A 3CTZA 1WBQA 3PKBA 1YJ3A 3CB5A 2ADUA 1R58A 3TB5A 2B3KA 2GG2A 4RGZ1 1B59A 4PV4A 4B28A 1BOAA 2GGBA 2Q94A 4U75A 1O0XA 2EA2A 2P99A 1YVMA 4IF7A 4A6VA 1QXZA 5D6EA 3FMQA 2V3ZA 2P9AA 2ZSGA 2V6CA 2GTXA 4U73A 2GG3A 1Y1NA 1MATA 2V3XA 3Q6DA 4IKSA 4KM3A 1C23A 5CLSA 5CE6A 1W7VA 4EGEA 4IU6A 3L7GA 3IG4A 2BHCA 4S01A 4FLJA 2GA2A 2BWSA 2EVMA 2IW2A 4U6CA 1KQ9A 1QXWA 3IU7A 4HXXA 5CDLA 5CDEA 2EA4A 3PKAA 1XGMA 4FO8A 2GG7A 2Q96A 1WLRA 1XGOA 2BHBA 5FCHA 3BIPA 2OAZA 2BWVA 3MR1A 4IECA 2GG0A 3FMRA 1JAWA 2BWTA 4OOKA
chains in the Genus database with same CATH superfamily
4R60A 4A6WA 4ZWUA 4ZNGA 5CDVA 2G6PA 4QR8A 1R5HA 1A16A 2Q93A 3BITA 1C21A 5CIKA 4FLKA 4IKUA 2GU5A 5D6FA 4IKRA 2BB7A 2P98A 4RZZA 4S00A 2GU6A 2DFIA 4U6ZA 2HOWA 4FLIA 2B3HA 2NQ6A 3CB6A 4ZWOA 3TAVA 2GU4A 2BHAA 2BHDA 2OKNA 1W2MA 1M35A 2GU7A 4FUKA 4RZYA 3PKDA 4MATA 1QZYA 3PKCA 4IPAA 2EVOA 5E5BA 5JFRA 1CHMA 4S2RP 2BWUA 4U6EA 2Q92A 1XNZA 1PV9A 1WKMA 1KP0A 4U71A 4U1BA 4ZWPA 4U6JA 4U70A 4FLLA 1WN1A 4U76A 2EVCA 2GZ5A 4FO7A 2GG8A 1YW8A 1WY2A 1YW9A 2BN7A 4FKCA 1C22A 2Q8KA 1XGNA 3FM3A 4JUQA 1BN5A 2GGCA 1B6AA 3IU9A 4IDYA 3MATA 2BWWA 3RVAA 3RORA 2BH3A 4Z7MA 1KQ0A 5CNXA 1QXYA 3PKEA 1WL9A 4U69A 3S6BA 1R5GA 2Q95A 1C24A 2GG5A 1C27A 5FCFA 3MX6A 1XGSA 2GG9A 2BWXA 4U6WA 3IU8A 2B3LA 2MATA 4S2TP 1YW7A 4IKTA 2NQ7A 4PNCA 2BWYA 5JHUA 3BIQA 1N51A 3D27A 1WL6A 2V3YA 5JI6A 3L24A 3CTZA 1WBQA 3PKBA 1YJ3A 3CB5A 2ADUA 1R58A 3TB5A 2B3KA 2GG2A 4RGZ1 1B59A 4PV4A 4B28A 1BOAA 2GGBA 2Q94A 4U75A 1O0XA 2EA2A 2P99A 1YVMA 4IF7A 4A6VA 1QXZA 5D6EA 3FMQA 2V3ZA 2P9AA 2ZSGA 2V6CA 2GTXA 4U73A 2GG3A 1Y1NA 1MATA 2V3XA 3Q6DA 4IKSA 4KM3A 1C23A 5CLSA 5CE6A 1W7VA 4EGEA 4IU6A 3L7GA 3IG4A 2BHCA 4S01A 4FLJA 2GA2A 2BWSA 2EVMA 2IW2A 4U6CA 1KQ9A 1QXWA 3IU7A 4HXXA 5CDLA 5CDEA 2EA4A 3PKAA 1XGMA 4FO8A 2GG7A 2Q96A 1WLRA 1XGOA 2BHBA 5FCHA 3BIPA 2OAZA 2BWVA 3MR1A 4IECA 2GG0A 3FMRA 1JAWA 2BWTA 4OOKA
chains in the Genus database with same CATH topology
4R60A 4A6WA 4ZWUA 4ZNGA 5CDVA 2G6PA 4QR8A 1R5HA 1A16A 2Q93A 3BITA 1C21A 5CIKA 4FLKA 4IKUA 2GU5A 5D6FA 4IKRA 2BB7A 2P98A 4RZZA 4S00A 2GU6A 2DFIA 4U6ZA 2HOWA 4FLIA 2B3HA 2NQ6A 3CB6A 4ZWOA 3TAVA 2GU4A 2BHAA 2BHDA 2OKNA 1W2MA 1M35A 2GU7A 4FUKA 4RZYA 3PKDA 4MATA 1QZYA 3PKCA 4IPAA 2EVOA 5E5BA 5JFRA 1CHMA 4S2RP 2BWUA 4U6EA 2Q92A 1XNZA 1PV9A 1WKMA 1KP0A 4U71A 4U1BA 4ZWPA 4U6JA 4U70A 4FLLA 1WN1A 4U76A 2EVCA 2GZ5A 4FO7A 2GG8A 1YW8A 1WY2A 1YW9A 2BN7A 4FKCA 1C22A 2Q8KA 1XGNA 3FM3A 4JUQA 1BN5A 2GGCA 1B6AA 3IU9A 4IDYA 3MATA 2BWWA 3RVAA 3RORA 2BH3A 4Z7MA 1KQ0A 5CNXA 1QXYA 3PKEA 1WL9A 4U69A 3S6BA 1R5GA 2Q95A 1C24A 2GG5A 1C27A 5FCFA 3MX6A 1XGSA 2GG9A 2BWXA 4U6WA 3IU8A 2B3LA 2MATA 4S2TP 1YW7A 4IKTA 2NQ7A 4PNCA 2BWYA 5JHUA 3BIQA 1N51A 3D27A 1WL6A 2V3YA 5JI6A 3L24A 3CTZA 1WBQA 3PKBA 1YJ3A 3CB5A 2ADUA 1R58A 3TB5A 2B3KA 2GG2A 4RGZ1 1B59A 4PV4A 4B28A 1BOAA 2GGBA 2Q94A 4U75A 1O0XA 2EA2A 2P99A 1YVMA 4IF7A 4A6VA 1QXZA 5D6EA 3FMQA 2V3ZA 2P9AA 2ZSGA 2V6CA 2GTXA 4U73A 2GG3A 1Y1NA 1MATA 2V3XA 3Q6DA 4IKSA 4KM3A 1C23A 5CLSA 5CE6A 1W7VA 4EGEA 4IU6A 3L7GA 3IG4A 2BHCA 4S01A 4FLJA 2GA2A 2BWSA 2EVMA 2IW2A 4U6CA 1KQ9A 1QXWA 3IU7A 4HXXA 5CDLA 5CDEA 2EA4A 3PKAA 1XGMA 4FO8A 2GG7A 2Q96A 1WLRA 1XGOA 2BHBA 5FCHA 3BIPA 2OAZA 2BWVA 3MR1A 4IECA 2GG0A 3FMRA 1JAWA 2BWTA 4OOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R60 A;  4A6W A;  4ZWU A;  4ZNG A;  5CDV A;  2G6P A;  4QR8 A;  1R5H A;  1A16 A;  2Q93 A;  3BIT A;  1C21 A;  5CIK A;  4FLK A;  4IKU A;  2GU5 A;  5D6F A;  4IKR A;  2BB7 A;  2P98 A;  4RZZ A;  4S00 A;  2GU6 A;  2DFI A;  4U6Z A;  2HOW A;  4FLI A;  2B3H A;  2NQ6 A;  3CB6 A;  4ZWO A;  3TAV A;  2GU4 A;  2BHA A;  2BHD A;  2OKN A;  1W2M A;  1M35 A;  2GU7 A;  4FUK A;  4RZY A;  3PKD A;  4MAT A;  1QZY A;  3PKC A;  4IPA A;  2EVO A;  5E5B A;  5JFR A;  1CHM A;  4S2R P;  2BWU A;  4U6E A;  2Q92 A;  1XNZ A;  1PV9 A;  1WKM A;  1KP0 A;  4U71 A;  4U1B A;  4ZWP A;  4U6J A;  4U70 A;  4FLL A;  1WN1 A;  4U76 A;  2EVC A;  2GZ5 A;  4FO7 A;  2GG8 A;  1YW8 A;  1WY2 A;  1YW9 A;  2BN7 A;  4FKC A;  1C22 A;  2Q8K A;  1XGN A;  3FM3 A;  4JUQ A;  1BN5 A;  2GGC A;  1B6A A;  3IU9 A;  4IDY A;  3MAT A;  2BWW A;  3RVA A;  3ROR A;  2BH3 A;  4Z7M A;  1KQ0 A;  5CNX A;  1QXY A;  3PKE A;  1WL9 A;  4U69 A;  3S6B A;  1R5G A;  2Q95 A;  1C24 A;  2GG5 A;  1C27 A;  5FCF A;  3MX6 A;  1XGS A;  2GG9 A;  2BWX A;  4U6W A;  3IU8 A;  2B3L A;  2MAT A;  4S2T P;  1YW7 A;  4IKT A;  2NQ7 A;  4PNC A;  2BWY A;  5JHU A;  3BIQ A;  1N51 A;  3D27 A;  1WL6 A;  2V3Y A;  5JI6 A;  3L24 A;  3CTZ A;  1WBQ A;  3PKB A;  1YJ3 A;  3CB5 A;  2ADU A;  1R58 A;  3TB5 A;  2B3K A;  2GG2 A;  4RGZ 1;  1B59 A;  4PV4 A;  4B28 A;  1BOA A;  2GGB A;  2Q94 A;  4U75 A;  1O0X A;  2EA2 A;  2P99 A;  1YVM A;  4IF7 A;  4A6V A;  1QXZ A;  5D6E A;  3FMQ A;  2V3Z A;  2P9A A;  2ZSG A;  2V6C A;  2GTX A;  4U73 A;  2GG3 A;  1Y1N A;  1MAT A;  2V3X A;  3Q6D A;  4IKS A;  4KM3 A;  1C23 A;  5CLS A;  5CE6 A;  1W7V A;  4EGE A;  4IU6 A;  3L7G A;  3IG4 A;  2BHC A;  4S01 A;  4FLJ A;  2GA2 A;  2BWS A;  2EVM A;  2IW2 A;  4U6C A;  1KQ9 A;  1QXW A;  3IU7 A;  4HXX A;  5CDL A;  5CDE A;  2EA4 A;  3PKA A;  1XGM A;  4FO8 A;  2GG7 A;  2Q96 A;  1WLR A;  1XGO A;  2BHB A;  5FCH A;  3BIP A;  2OAZ A;  2BWV A;  3MR1 A;  4IEC A;  2GG0 A;  3FMR A;  1JAW A;  2BWT A;  4OOK A; 
#chains in the Genus database with same CATH topology
 4R60 A;  4A6W A;  4ZWU A;  4ZNG A;  5CDV A;  2G6P A;  4QR8 A;  1R5H A;  1A16 A;  2Q93 A;  3BIT A;  1C21 A;  5CIK A;  4FLK A;  4IKU A;  2GU5 A;  5D6F A;  4IKR A;  2BB7 A;  2P98 A;  4RZZ A;  4S00 A;  2GU6 A;  2DFI A;  4U6Z A;  2HOW A;  4FLI A;  2B3H A;  2NQ6 A;  3CB6 A;  4ZWO A;  3TAV A;  2GU4 A;  2BHA A;  2BHD A;  2OKN A;  1W2M A;  1M35 A;  2GU7 A;  4FUK A;  4RZY A;  3PKD A;  4MAT A;  1QZY A;  3PKC A;  4IPA A;  2EVO A;  5E5B A;  5JFR A;  1CHM A;  4S2R P;  2BWU A;  4U6E A;  2Q92 A;  1XNZ A;  1PV9 A;  1WKM A;  1KP0 A;  4U71 A;  4U1B A;  4ZWP A;  4U6J A;  4U70 A;  4FLL A;  1WN1 A;  4U76 A;  2EVC A;  2GZ5 A;  4FO7 A;  2GG8 A;  1YW8 A;  1WY2 A;  1YW9 A;  2BN7 A;  4FKC A;  1C22 A;  2Q8K A;  1XGN A;  3FM3 A;  4JUQ A;  1BN5 A;  2GGC A;  1B6A A;  3IU9 A;  4IDY A;  3MAT A;  2BWW A;  3RVA A;  3ROR A;  2BH3 A;  4Z7M A;  1KQ0 A;  5CNX A;  1QXY A;  3PKE A;  1WL9 A;  4U69 A;  3S6B A;  1R5G A;  2Q95 A;  1C24 A;  2GG5 A;  1C27 A;  5FCF A;  3MX6 A;  1XGS A;  2GG9 A;  2BWX A;  4U6W A;  3IU8 A;  2B3L A;  2MAT A;  4S2T P;  1YW7 A;  4IKT A;  2NQ7 A;  4PNC A;  2BWY A;  5JHU A;  3BIQ A;  1N51 A;  3D27 A;  1WL6 A;  2V3Y A;  5JI6 A;  3L24 A;  3CTZ A;  1WBQ A;  3PKB A;  1YJ3 A;  3CB5 A;  2ADU A;  1R58 A;  3TB5 A;  2B3K A;  2GG2 A;  4RGZ 1;  1B59 A;  4PV4 A;  4B28 A;  1BOA A;  2GGB A;  2Q94 A;  4U75 A;  1O0X A;  2EA2 A;  2P99 A;  1YVM A;  4IF7 A;  4A6V A;  1QXZ A;  5D6E A;  3FMQ A;  2V3Z A;  2P9A A;  2ZSG A;  2V6C A;  2GTX A;  4U73 A;  2GG3 A;  1Y1N A;  1MAT A;  2V3X A;  3Q6D A;  4IKS A;  4KM3 A;  1C23 A;  5CLS A;  5CE6 A;  1W7V A;  4EGE A;  4IU6 A;  3L7G A;  3IG4 A;  2BHC A;  4S01 A;  4FLJ A;  2GA2 A;  2BWS A;  2EVM A;  2IW2 A;  4U6C A;  1KQ9 A;  1QXW A;  3IU7 A;  4HXX A;  5CDL A;  5CDE A;  2EA4 A;  3PKA A;  1XGM A;  4FO8 A;  2GG7 A;  2Q96 A;  1WLR A;  1XGO A;  2BHB A;  5FCH A;  3BIP A;  2OAZ A;  2BWV A;  3MR1 A;  4IEC A;  2GG0 A;  3FMR A;  1JAW A;  2BWT A;  4OOK A; 
#chains in the Genus database with same CATH homology
 4R60 A;  4A6W A;  4ZWU A;  4ZNG A;  5CDV A;  2G6P A;  4QR8 A;  1R5H A;  1A16 A;  2Q93 A;  3BIT A;  1C21 A;  5CIK A;  4FLK A;  4IKU A;  2GU5 A;  5D6F A;  4IKR A;  2BB7 A;  2P98 A;  4RZZ A;  4S00 A;  2GU6 A;  2DFI A;  4U6Z A;  2HOW A;  4FLI A;  2B3H A;  2NQ6 A;  3CB6 A;  4ZWO A;  3TAV A;  2GU4 A;  2BHA A;  2BHD A;  2OKN A;  1W2M A;  1M35 A;  2GU7 A;  4FUK A;  4RZY A;  3PKD A;  4MAT A;  1QZY A;  3PKC A;  4IPA A;  2EVO A;  5E5B A;  5JFR A;  1CHM A;  4S2R P;  2BWU A;  4U6E A;  2Q92 A;  1XNZ A;  1PV9 A;  1WKM A;  1KP0 A;  4U71 A;  4U1B A;  4ZWP A;  4U6J A;  4U70 A;  4FLL A;  1WN1 A;  4U76 A;  2EVC A;  2GZ5 A;  4FO7 A;  2GG8 A;  1YW8 A;  1WY2 A;  1YW9 A;  2BN7 A;  4FKC A;  1C22 A;  2Q8K A;  1XGN A;  3FM3 A;  4JUQ A;  1BN5 A;  2GGC A;  1B6A A;  3IU9 A;  4IDY A;  3MAT A;  2BWW A;  3RVA A;  3ROR A;  2BH3 A;  4Z7M A;  1KQ0 A;  5CNX A;  1QXY A;  3PKE A;  1WL9 A;  4U69 A;  3S6B A;  1R5G A;  2Q95 A;  1C24 A;  2GG5 A;  1C27 A;  5FCF A;  3MX6 A;  1XGS A;  2GG9 A;  2BWX A;  4U6W A;  3IU8 A;  2B3L A;  2MAT A;  4S2T P;  1YW7 A;  4IKT A;  2NQ7 A;  4PNC A;  2BWY A;  5JHU A;  3BIQ A;  1N51 A;  3D27 A;  1WL6 A;  2V3Y A;  5JI6 A;  3L24 A;  3CTZ A;  1WBQ A;  3PKB A;  1YJ3 A;  3CB5 A;  2ADU A;  1R58 A;  3TB5 A;  2B3K A;  2GG2 A;  4RGZ 1;  1B59 A;  4PV4 A;  4B28 A;  1BOA A;  2GGB A;  2Q94 A;  4U75 A;  1O0X A;  2EA2 A;  2P99 A;  1YVM A;  4IF7 A;  4A6V A;  1QXZ A;  5D6E A;  3FMQ A;  2V3Z A;  2P9A A;  2ZSG A;  2V6C A;  2GTX A;  4U73 A;  2GG3 A;  1Y1N A;  1MAT A;  2V3X A;  3Q6D A;  4IKS A;  4KM3 A;  1C23 A;  5CLS A;  5CE6 A;  1W7V A;  4EGE A;  4IU6 A;  3L7G A;  3IG4 A;  2BHC A;  4S01 A;  4FLJ A;  2GA2 A;  2BWS A;  2EVM A;  2IW2 A;  4U6C A;  1KQ9 A;  1QXW A;  3IU7 A;  4HXX A;  5CDL A;  5CDE A;  2EA4 A;  3PKA A;  1XGM A;  4FO8 A;  2GG7 A;  2Q96 A;  1WLR A;  1XGO A;  2BHB A;  5FCH A;  3BIP A;  2OAZ A;  2BWV A;  3MR1 A;  4IEC A;  2GG0 A;  3FMR A;  1JAW A;  2BWT A;  4OOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...