2P9AA

E. coli methionine aminopeptidase dimetalated with inhibitor ye6
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 83
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p9aA00
2GTXA 2GG8A 3BITA 4KM3A 4FKCA 1CHMA 1W2MA 5FCHA 3IU8A 2EVCA 2Q95A 2GU4A 3TB5A 2BHBA 2V6CA 2EVMA 5E5BA 5CDEA 4IECA 3PKAA 5CNXA 1WL9A 3MR1A 2BN7A 2G6PA 2GG3A 4FLKA 4R60A 1C23A 4FO7A 2DFIA 2BWWA 4U69A 5CDLA 4HXXA 4FLIA 1WBQA 1YW8A 2BB7A 1YJ3A 4IF7A 4ZWOA 4ZNGA 1WLRA 4JUQA 1QXYA 4PNCA 2NQ6A 3L7GA 4U6EA 2V3YA 4U6ZA 1WL6A 1XNZA 2BWTA 3IU9A 2BH3A 3IU7A 4U75A 4RZYA 4FUKA 5CIKA 4IKRA 4U6WA 2ZSGA 4IKTA 2BWUA 3CB6A 3L24A 4B28A 2GG5A 2Q92A 4S2RP 1KP0A 2BWSA 4ZWPA 3TAVA 3CTZA 4OOKA 4FLLA 2P99A 1B59A 1BN5A 4EGEA 2MATA 1R5HA 4FO8A 5D6FA 2BWXA 2EA2A 1BOAA 1XGSA 2GU7A 4IU6A 4QR8A 1YVMA 4U6JA 4ZWUA 2V3ZA 3BIPA 3PKDA 1PV9A 2HOWA 1R58A 3FM3A 5D6EA 2GG9A 2EA4A 2B3KA 4RGZ1 4S2TP 4S00A 4Z7MA 1KQ9A 1R5GA 2P9AA 3PKEA 5CE6A 1Y1NA 2GZ5A 2IW2A 2NQ7A 3PKBA 5JI6A 2EVOA 4FLJA 3MX6A 3PKCA 2OAZA 1KQ0A 2Q93A 1W7VA 1C22A 1WKMA 3FMQA 1WN1A 1YW7A 4A6VA 2B3LA 4MATA 3Q6DA 2GG2A 2GU5A 1XGOA 4IKSA 1JAWA 1XGNA 4IDYA 3IG4A 1QXWA 4U71A 2ADUA 3RORA 4U1BA 3S6BA 3BIQA 4U76A 2BHDA 1C27A 3D27A 4U70A 4U73A 1XGMA 5JFRA 2BHAA 2GGBA 4RZZA 5CLSA 1A16A 2B3HA 3FMRA 1B6AA 1O0XA 3MATA 2Q8KA 1C24A 2Q96A 2OKNA 3RVAA 5CDVA 1QZYA 4S01A 1MATA 2GA2A 1WY2A 1C21A 1N51A 2GG7A 2Q94A 4IPAA 1YW9A 4PV4A 2BWYA 4U6CA 2BHCA 4A6WA 2GG0A 2V3XA 1M35A 3CB5A 1QXZA 2BWVA 2P98A 5FCFA 4IKUA 2GU6A 5JHUA 2GGCA
chains in the Genus database with same CATH superfamily
2GTXA 2GG8A 3BITA 4KM3A 4FKCA 1CHMA 1W2MA 5FCHA 3IU8A 2EVCA 2Q95A 2GU4A 3TB5A 2BHBA 2V6CA 2EVMA 5E5BA 5CDEA 4IECA 3PKAA 5CNXA 1WL9A 3MR1A 2BN7A 2G6PA 2GG3A 4FLKA 4R60A 1C23A 4FO7A 2DFIA 2BWWA 4U69A 5CDLA 4HXXA 4FLIA 1WBQA 1YW8A 2BB7A 1YJ3A 4IF7A 4ZWOA 4ZNGA 1WLRA 4JUQA 1QXYA 4PNCA 2NQ6A 3L7GA 4U6EA 2V3YA 4U6ZA 1WL6A 1XNZA 2BWTA 3IU9A 2BH3A 3IU7A 4U75A 4RZYA 4FUKA 5CIKA 4IKRA 4U6WA 2ZSGA 4IKTA 2BWUA 3CB6A 3L24A 4B28A 2GG5A 2Q92A 4S2RP 1KP0A 2BWSA 4ZWPA 3TAVA 3CTZA 4OOKA 4FLLA 2P99A 1B59A 1BN5A 4EGEA 2MATA 1R5HA 4FO8A 5D6FA 2BWXA 2EA2A 1BOAA 1XGSA 2GU7A 4IU6A 4QR8A 1YVMA 4U6JA 4ZWUA 2V3ZA 3BIPA 3PKDA 1PV9A 2HOWA 1R58A 3FM3A 5D6EA 2GG9A 2EA4A 2B3KA 4RGZ1 4S2TP 4S00A 4Z7MA 1KQ9A 1R5GA 2P9AA 3PKEA 5CE6A 1Y1NA 2GZ5A 2IW2A 2NQ7A 3PKBA 5JI6A 2EVOA 4FLJA 3MX6A 3PKCA 2OAZA 1KQ0A 2Q93A 1W7VA 1C22A 1WKMA 3FMQA 1WN1A 1YW7A 4A6VA 2B3LA 4MATA 3Q6DA 2GG2A 2GU5A 1XGOA 4IKSA 1JAWA 1XGNA 4IDYA 3IG4A 1QXWA 4U71A 2ADUA 3RORA 4U1BA 3S6BA 3BIQA 4U76A 2BHDA 1C27A 3D27A 4U70A 4U73A 1XGMA 5JFRA 2BHAA 2GGBA 4RZZA 5CLSA 1A16A 2B3HA 3FMRA 1B6AA 1O0XA 3MATA 2Q8KA 1C24A 2Q96A 2OKNA 3RVAA 5CDVA 1QZYA 4S01A 1MATA 2GA2A 1WY2A 1C21A 1N51A 2GG7A 2Q94A 4IPAA 1YW9A 4PV4A 2BWYA 4U6CA 2BHCA 4A6WA 2GG0A 2V3XA 1M35A 3CB5A 1QXZA 2BWVA 2P98A 5FCFA 4IKUA 2GU6A 5JHUA 2GGCA
chains in the Genus database with same CATH topology
2GTXA 2GG8A 3BITA 4KM3A 4FKCA 1CHMA 1W2MA 5FCHA 3IU8A 2EVCA 2Q95A 2GU4A 3TB5A 2BHBA 2V6CA 2EVMA 5E5BA 5CDEA 4IECA 3PKAA 5CNXA 1WL9A 3MR1A 2BN7A 2G6PA 2GG3A 4FLKA 4R60A 1C23A 4FO7A 2DFIA 2BWWA 4U69A 5CDLA 4HXXA 4FLIA 1WBQA 1YW8A 2BB7A 1YJ3A 4IF7A 4ZWOA 4ZNGA 1WLRA 4JUQA 1QXYA 4PNCA 2NQ6A 3L7GA 4U6EA 2V3YA 4U6ZA 1WL6A 1XNZA 2BWTA 3IU9A 2BH3A 3IU7A 4U75A 4RZYA 4FUKA 5CIKA 4IKRA 4U6WA 2ZSGA 4IKTA 2BWUA 3CB6A 3L24A 4B28A 2GG5A 2Q92A 4S2RP 1KP0A 2BWSA 4ZWPA 3TAVA 3CTZA 4OOKA 4FLLA 2P99A 1B59A 1BN5A 4EGEA 2MATA 1R5HA 4FO8A 5D6FA 2BWXA 2EA2A 1BOAA 1XGSA 2GU7A 4IU6A 4QR8A 1YVMA 4U6JA 4ZWUA 2V3ZA 3BIPA 3PKDA 1PV9A 2HOWA 1R58A 3FM3A 5D6EA 2GG9A 2EA4A 2B3KA 4RGZ1 4S2TP 4S00A 4Z7MA 1KQ9A 1R5GA 2P9AA 3PKEA 5CE6A 1Y1NA 2GZ5A 2IW2A 2NQ7A 3PKBA 5JI6A 2EVOA 4FLJA 3MX6A 3PKCA 2OAZA 1KQ0A 2Q93A 1W7VA 1C22A 1WKMA 3FMQA 1WN1A 1YW7A 4A6VA 2B3LA 4MATA 3Q6DA 2GG2A 2GU5A 1XGOA 4IKSA 1JAWA 1XGNA 4IDYA 3IG4A 1QXWA 4U71A 2ADUA 3RORA 4U1BA 3S6BA 3BIQA 4U76A 2BHDA 1C27A 3D27A 4U70A 4U73A 1XGMA 5JFRA 2BHAA 2GGBA 4RZZA 5CLSA 1A16A 2B3HA 3FMRA 1B6AA 1O0XA 3MATA 2Q8KA 1C24A 2Q96A 2OKNA 3RVAA 5CDVA 1QZYA 4S01A 1MATA 2GA2A 1WY2A 1C21A 1N51A 2GG7A 2Q94A 4IPAA 1YW9A 4PV4A 2BWYA 4U6CA 2BHCA 4A6WA 2GG0A 2V3XA 1M35A 3CB5A 1QXZA 2BWVA 2P98A 5FCFA 4IKUA 2GU6A 5JHUA 2GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTX A;  2GG8 A;  3BIT A;  4KM3 A;  4FKC A;  1CHM A;  1W2M A;  5FCH A;  3IU8 A;  2EVC A;  2Q95 A;  2GU4 A;  3TB5 A;  2BHB A;  2V6C A;  2EVM A;  5E5B A;  5CDE A;  4IEC A;  3PKA A;  5CNX A;  1WL9 A;  3MR1 A;  2BN7 A;  2G6P A;  2GG3 A;  4FLK A;  4R60 A;  1C23 A;  4FO7 A;  2DFI A;  2BWW A;  4U69 A;  5CDL A;  4HXX A;  4FLI A;  1WBQ A;  1YW8 A;  2BB7 A;  1YJ3 A;  4IF7 A;  4ZWO A;  4ZNG A;  1WLR A;  4JUQ A;  1QXY A;  4PNC A;  2NQ6 A;  3L7G A;  4U6E A;  2V3Y A;  4U6Z A;  1WL6 A;  1XNZ A;  2BWT A;  3IU9 A;  2BH3 A;  3IU7 A;  4U75 A;  4RZY A;  4FUK A;  5CIK A;  4IKR A;  4U6W A;  2ZSG A;  4IKT A;  2BWU A;  3CB6 A;  3L24 A;  4B28 A;  2GG5 A;  2Q92 A;  4S2R P;  1KP0 A;  2BWS A;  4ZWP A;  3TAV A;  3CTZ A;  4OOK A;  4FLL A;  2P99 A;  1B59 A;  1BN5 A;  4EGE A;  2MAT A;  1R5H A;  4FO8 A;  5D6F A;  2BWX A;  2EA2 A;  1BOA A;  1XGS A;  2GU7 A;  4IU6 A;  4QR8 A;  1YVM A;  4U6J A;  4ZWU A;  2V3Z A;  3BIP A;  3PKD A;  1PV9 A;  2HOW A;  1R58 A;  3FM3 A;  5D6E A;  2GG9 A;  2EA4 A;  2B3K A;  4RGZ 1;  4S2T P;  4S00 A;  4Z7M A;  1KQ9 A;  1R5G A;  2P9A A;  3PKE A;  5CE6 A;  1Y1N A;  2GZ5 A;  2IW2 A;  2NQ7 A;  3PKB A;  5JI6 A;  2EVO A;  4FLJ A;  3MX6 A;  3PKC A;  2OAZ A;  1KQ0 A;  2Q93 A;  1W7V A;  1C22 A;  1WKM A;  3FMQ A;  1WN1 A;  1YW7 A;  4A6V A;  2B3L A;  4MAT A;  3Q6D A;  2GG2 A;  2GU5 A;  1XGO A;  4IKS A;  1JAW A;  1XGN A;  4IDY A;  3IG4 A;  1QXW A;  4U71 A;  2ADU A;  3ROR A;  4U1B A;  3S6B A;  3BIQ A;  4U76 A;  2BHD A;  1C27 A;  3D27 A;  4U70 A;  4U73 A;  1XGM A;  5JFR A;  2BHA A;  2GGB A;  4RZZ A;  5CLS A;  1A16 A;  2B3H A;  3FMR A;  1B6A A;  1O0X A;  3MAT A;  2Q8K A;  1C24 A;  2Q96 A;  2OKN A;  3RVA A;  5CDV A;  1QZY A;  4S01 A;  1MAT A;  2GA2 A;  1WY2 A;  1C21 A;  1N51 A;  2GG7 A;  2Q94 A;  4IPA A;  1YW9 A;  4PV4 A;  2BWY A;  4U6C A;  2BHC A;  4A6W A;  2GG0 A;  2V3X A;  1M35 A;  3CB5 A;  1QXZ A;  2BWV A;  2P98 A;  5FCF A;  4IKU A;  2GU6 A;  5JHU A;  2GGC A; 
#chains in the Genus database with same CATH topology
 2GTX A;  2GG8 A;  3BIT A;  4KM3 A;  4FKC A;  1CHM A;  1W2M A;  5FCH A;  3IU8 A;  2EVC A;  2Q95 A;  2GU4 A;  3TB5 A;  2BHB A;  2V6C A;  2EVM A;  5E5B A;  5CDE A;  4IEC A;  3PKA A;  5CNX A;  1WL9 A;  3MR1 A;  2BN7 A;  2G6P A;  2GG3 A;  4FLK A;  4R60 A;  1C23 A;  4FO7 A;  2DFI A;  2BWW A;  4U69 A;  5CDL A;  4HXX A;  4FLI A;  1WBQ A;  1YW8 A;  2BB7 A;  1YJ3 A;  4IF7 A;  4ZWO A;  4ZNG A;  1WLR A;  4JUQ A;  1QXY A;  4PNC A;  2NQ6 A;  3L7G A;  4U6E A;  2V3Y A;  4U6Z A;  1WL6 A;  1XNZ A;  2BWT A;  3IU9 A;  2BH3 A;  3IU7 A;  4U75 A;  4RZY A;  4FUK A;  5CIK A;  4IKR A;  4U6W A;  2ZSG A;  4IKT A;  2BWU A;  3CB6 A;  3L24 A;  4B28 A;  2GG5 A;  2Q92 A;  4S2R P;  1KP0 A;  2BWS A;  4ZWP A;  3TAV A;  3CTZ A;  4OOK A;  4FLL A;  2P99 A;  1B59 A;  1BN5 A;  4EGE A;  2MAT A;  1R5H A;  4FO8 A;  5D6F A;  2BWX A;  2EA2 A;  1BOA A;  1XGS A;  2GU7 A;  4IU6 A;  4QR8 A;  1YVM A;  4U6J A;  4ZWU A;  2V3Z A;  3BIP A;  3PKD A;  1PV9 A;  2HOW A;  1R58 A;  3FM3 A;  5D6E A;  2GG9 A;  2EA4 A;  2B3K A;  4RGZ 1;  4S2T P;  4S00 A;  4Z7M A;  1KQ9 A;  1R5G A;  2P9A A;  3PKE A;  5CE6 A;  1Y1N A;  2GZ5 A;  2IW2 A;  2NQ7 A;  3PKB A;  5JI6 A;  2EVO A;  4FLJ A;  3MX6 A;  3PKC A;  2OAZ A;  1KQ0 A;  2Q93 A;  1W7V A;  1C22 A;  1WKM A;  3FMQ A;  1WN1 A;  1YW7 A;  4A6V A;  2B3L A;  4MAT A;  3Q6D A;  2GG2 A;  2GU5 A;  1XGO A;  4IKS A;  1JAW A;  1XGN A;  4IDY A;  3IG4 A;  1QXW A;  4U71 A;  2ADU A;  3ROR A;  4U1B A;  3S6B A;  3BIQ A;  4U76 A;  2BHD A;  1C27 A;  3D27 A;  4U70 A;  4U73 A;  1XGM A;  5JFR A;  2BHA A;  2GGB A;  4RZZ A;  5CLS A;  1A16 A;  2B3H A;  3FMR A;  1B6A A;  1O0X A;  3MAT A;  2Q8K A;  1C24 A;  2Q96 A;  2OKN A;  3RVA A;  5CDV A;  1QZY A;  4S01 A;  1MAT A;  2GA2 A;  1WY2 A;  1C21 A;  1N51 A;  2GG7 A;  2Q94 A;  4IPA A;  1YW9 A;  4PV4 A;  2BWY A;  4U6C A;  2BHC A;  4A6W A;  2GG0 A;  2V3X A;  1M35 A;  3CB5 A;  1QXZ A;  2BWV A;  2P98 A;  5FCF A;  4IKU A;  2GU6 A;  5JHU A;  2GGC A; 
#chains in the Genus database with same CATH homology
 2GTX A;  2GG8 A;  3BIT A;  4KM3 A;  4FKC A;  1CHM A;  1W2M A;  5FCH A;  3IU8 A;  2EVC A;  2Q95 A;  2GU4 A;  3TB5 A;  2BHB A;  2V6C A;  2EVM A;  5E5B A;  5CDE A;  4IEC A;  3PKA A;  5CNX A;  1WL9 A;  3MR1 A;  2BN7 A;  2G6P A;  2GG3 A;  4FLK A;  4R60 A;  1C23 A;  4FO7 A;  2DFI A;  2BWW A;  4U69 A;  5CDL A;  4HXX A;  4FLI A;  1WBQ A;  1YW8 A;  2BB7 A;  1YJ3 A;  4IF7 A;  4ZWO A;  4ZNG A;  1WLR A;  4JUQ A;  1QXY A;  4PNC A;  2NQ6 A;  3L7G A;  4U6E A;  2V3Y A;  4U6Z A;  1WL6 A;  1XNZ A;  2BWT A;  3IU9 A;  2BH3 A;  3IU7 A;  4U75 A;  4RZY A;  4FUK A;  5CIK A;  4IKR A;  4U6W A;  2ZSG A;  4IKT A;  2BWU A;  3CB6 A;  3L24 A;  4B28 A;  2GG5 A;  2Q92 A;  4S2R P;  1KP0 A;  2BWS A;  4ZWP A;  3TAV A;  3CTZ A;  4OOK A;  4FLL A;  2P99 A;  1B59 A;  1BN5 A;  4EGE A;  2MAT A;  1R5H A;  4FO8 A;  5D6F A;  2BWX A;  2EA2 A;  1BOA A;  1XGS A;  2GU7 A;  4IU6 A;  4QR8 A;  1YVM A;  4U6J A;  4ZWU A;  2V3Z A;  3BIP A;  3PKD A;  1PV9 A;  2HOW A;  1R58 A;  3FM3 A;  5D6E A;  2GG9 A;  2EA4 A;  2B3K A;  4RGZ 1;  4S2T P;  4S00 A;  4Z7M A;  1KQ9 A;  1R5G A;  2P9A A;  3PKE A;  5CE6 A;  1Y1N A;  2GZ5 A;  2IW2 A;  2NQ7 A;  3PKB A;  5JI6 A;  2EVO A;  4FLJ A;  3MX6 A;  3PKC A;  2OAZ A;  1KQ0 A;  2Q93 A;  1W7V A;  1C22 A;  1WKM A;  3FMQ A;  1WN1 A;  1YW7 A;  4A6V A;  2B3L A;  4MAT A;  3Q6D A;  2GG2 A;  2GU5 A;  1XGO A;  4IKS A;  1JAW A;  1XGN A;  4IDY A;  3IG4 A;  1QXW A;  4U71 A;  2ADU A;  3ROR A;  4U1B A;  3S6B A;  3BIQ A;  4U76 A;  2BHD A;  1C27 A;  3D27 A;  4U70 A;  4U73 A;  1XGM A;  5JFR A;  2BHA A;  2GGB A;  4RZZ A;  5CLS A;  1A16 A;  2B3H A;  3FMR A;  1B6A A;  1O0X A;  3MAT A;  2Q8K A;  1C24 A;  2Q96 A;  2OKN A;  3RVA A;  5CDV A;  1QZY A;  4S01 A;  1MAT A;  2GA2 A;  1WY2 A;  1C21 A;  1N51 A;  2GG7 A;  2Q94 A;  4IPA A;  1YW9 A;  4PV4 A;  2BWY A;  4U6C A;  2BHC A;  4A6W A;  2GG0 A;  2V3X A;  1M35 A;  3CB5 A;  1QXZ A;  2BWV A;  2P98 A;  5FCF A;  4IKU A;  2GU6 A;  5JHU A;  2GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...