2P9AA

E. coli methionine aminopeptidase dimetalated with inhibitor ye6
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 83
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p9aA00
4FUKA 5JFRA 4U1BA 2V6CA 4IPAA 4IU6A 4FLIA 5CDLA 4PV4A 4FLLA 4Z7MA 4FLJA 1B6AA 4U70A 1R58A 2GZ5A 2V3ZA 4U69A 2BWYA 2HOWA 2B3HA 4IF7A 2GGCA 3PKDA 5FCFA 3RORA 2GU7A 4U76A 1QZYA 1C21A 1KQ0A 3CB5A 4ZWOA 1WLRA 1WL9A 4IKUA 3PKAA 3PKCA 3PKBA 4S00A 5CLSA 4RGZ1 3S6BA 1YJ3A 2EVOA 3TAVA 2GGBA 4IECA 2V3XA 1QXYA 3MATA 1KP0A 3RVAA 1YVMA 4KM3A 4U6CA 4A6WA 4S2TP 4U6JA 1XNZA 1C24A 2BH3A 2BHBA 2B3KA 3BIQA 1BN5A 2EVMA 2G6PA 3FMRA 2GG7A 4B28A 1YW9A 1A16A 2GG8A 1W7VA 2Q92A 2GA2A 1N51A 2P99A 2Q95A 5E5BA 4A6VA 4S01A 1JAWA 2BWVA 2BHCA 2EA4A 3MR1A 1C27A 2P98A 3PKEA 4FO8A 1Y1NA 1YW8A 1R5GA 5D6FA 4RZYA 4U6WA 1PV9A 2GU5A 1C22A 2NQ7A 1XGSA 1BOAA 1WBQA 4U71A 1QXZA 2OAZA 2BWUA 3MX6A 2GG5A 2GG0A 2ADUA 2BHDA 2EA2A 2BWSA 2P9AA 4OOKA 1R5HA 3L24A 3IU9A 2Q8KA 1WN1A 5CE6A 1CHMA 4EGEA 1WL6A 3D27A 2BWWA 2BWTA 4FKCA 5CIKA 2GU4A 1B59A 1M35A 3IU8A 4IKTA 4PNCA 4IKRA 2BWXA 2ZSGA 2IW2A 4U75A 1MATA 2EVCA 4IDYA 4FLKA 2OKNA 2BB7A 2BHAA 3CB6A 2GTXA 4IKSA 1W2MA 4ZWUA 1KQ9A 2B3LA 2GG2A 3BITA 1C23A 5CDVA 5JI6A 4S2RP 4ZNGA 3FM3A 4JUQA 1O0XA 3TB5A 4ZWPA 2MATA 2GG3A 3L7GA 1WY2A 1XGMA 2DFIA 4HXXA 3Q6DA 2GG9A 3BIPA 4QR8A 4R60A 2Q93A 2Q96A 2BN7A 4U6EA 1WKMA 2Q94A 5D6EA 1YW7A 5JHUA 1XGOA 3CTZA 1QXWA 3FMQA 4U6ZA 4U73A 5CNXA 4MATA 2GU6A 3IU7A 4RZZA 4FO7A 2V3YA 5FCHA 3IG4A 2NQ6A 5CDEA 1XGNA
chains in the Genus database with same CATH superfamily
4FUKA 5JFRA 4U1BA 2V6CA 4IPAA 4IU6A 4FLIA 5CDLA 4PV4A 4FLLA 4Z7MA 4FLJA 1B6AA 4U70A 1R58A 2GZ5A 2V3ZA 4U69A 2BWYA 2HOWA 2B3HA 4IF7A 2GGCA 3PKDA 5FCFA 3RORA 2GU7A 4U76A 1QZYA 1C21A 1KQ0A 3CB5A 4ZWOA 1WLRA 1WL9A 4IKUA 3PKAA 3PKCA 3PKBA 4S00A 5CLSA 4RGZ1 3S6BA 1YJ3A 2EVOA 3TAVA 2GGBA 4IECA 2V3XA 1QXYA 3MATA 1KP0A 3RVAA 1YVMA 4KM3A 4U6CA 4A6WA 4S2TP 4U6JA 1XNZA 1C24A 2BH3A 2BHBA 2B3KA 3BIQA 1BN5A 2EVMA 2G6PA 3FMRA 2GG7A 4B28A 1YW9A 1A16A 2GG8A 1W7VA 2Q92A 2GA2A 1N51A 2P99A 2Q95A 5E5BA 4A6VA 4S01A 1JAWA 2BWVA 2BHCA 2EA4A 3MR1A 1C27A 2P98A 3PKEA 4FO8A 1Y1NA 1YW8A 1R5GA 5D6FA 4RZYA 4U6WA 1PV9A 2GU5A 1C22A 2NQ7A 1XGSA 1BOAA 1WBQA 4U71A 1QXZA 2OAZA 2BWUA 3MX6A 2GG5A 2GG0A 2ADUA 2BHDA 2EA2A 2BWSA 2P9AA 4OOKA 1R5HA 3L24A 3IU9A 2Q8KA 1WN1A 5CE6A 1CHMA 4EGEA 1WL6A 3D27A 2BWWA 2BWTA 4FKCA 5CIKA 2GU4A 1B59A 1M35A 3IU8A 4IKTA 4PNCA 4IKRA 2BWXA 2ZSGA 2IW2A 4U75A 1MATA 2EVCA 4IDYA 4FLKA 2OKNA 2BB7A 2BHAA 3CB6A 2GTXA 4IKSA 1W2MA 4ZWUA 1KQ9A 2B3LA 2GG2A 3BITA 1C23A 5CDVA 5JI6A 4S2RP 4ZNGA 3FM3A 4JUQA 1O0XA 3TB5A 4ZWPA 2MATA 2GG3A 3L7GA 1WY2A 1XGMA 2DFIA 4HXXA 3Q6DA 2GG9A 3BIPA 4QR8A 4R60A 2Q93A 2Q96A 2BN7A 4U6EA 1WKMA 2Q94A 5D6EA 1YW7A 5JHUA 1XGOA 3CTZA 1QXWA 3FMQA 4U6ZA 4U73A 5CNXA 4MATA 2GU6A 3IU7A 4RZZA 4FO7A 2V3YA 5FCHA 3IG4A 2NQ6A 5CDEA 1XGNA
chains in the Genus database with same CATH topology
4FUKA 5JFRA 4U1BA 2V6CA 4IPAA 4IU6A 4FLIA 5CDLA 4PV4A 4FLLA 4Z7MA 4FLJA 1B6AA 4U70A 1R58A 2GZ5A 2V3ZA 4U69A 2BWYA 2HOWA 2B3HA 4IF7A 2GGCA 3PKDA 5FCFA 3RORA 2GU7A 4U76A 1QZYA 1C21A 1KQ0A 3CB5A 4ZWOA 1WLRA 1WL9A 4IKUA 3PKAA 3PKCA 3PKBA 4S00A 5CLSA 4RGZ1 3S6BA 1YJ3A 2EVOA 3TAVA 2GGBA 4IECA 2V3XA 1QXYA 3MATA 1KP0A 3RVAA 1YVMA 4KM3A 4U6CA 4A6WA 4S2TP 4U6JA 1XNZA 1C24A 2BH3A 2BHBA 2B3KA 3BIQA 1BN5A 2EVMA 2G6PA 3FMRA 2GG7A 4B28A 1YW9A 1A16A 2GG8A 1W7VA 2Q92A 2GA2A 1N51A 2P99A 2Q95A 5E5BA 4A6VA 4S01A 1JAWA 2BWVA 2BHCA 2EA4A 3MR1A 1C27A 2P98A 3PKEA 4FO8A 1Y1NA 1YW8A 1R5GA 5D6FA 4RZYA 4U6WA 1PV9A 2GU5A 1C22A 2NQ7A 1XGSA 1BOAA 1WBQA 4U71A 1QXZA 2OAZA 2BWUA 3MX6A 2GG5A 2GG0A 2ADUA 2BHDA 2EA2A 2BWSA 2P9AA 4OOKA 1R5HA 3L24A 3IU9A 2Q8KA 1WN1A 5CE6A 1CHMA 4EGEA 1WL6A 3D27A 2BWWA 2BWTA 4FKCA 5CIKA 2GU4A 1B59A 1M35A 3IU8A 4IKTA 4PNCA 4IKRA 2BWXA 2ZSGA 2IW2A 4U75A 1MATA 2EVCA 4IDYA 4FLKA 2OKNA 2BB7A 2BHAA 3CB6A 2GTXA 4IKSA 1W2MA 4ZWUA 1KQ9A 2B3LA 2GG2A 3BITA 1C23A 5CDVA 5JI6A 4S2RP 4ZNGA 3FM3A 4JUQA 1O0XA 3TB5A 4ZWPA 2MATA 2GG3A 3L7GA 1WY2A 1XGMA 2DFIA 4HXXA 3Q6DA 2GG9A 3BIPA 4QR8A 4R60A 2Q93A 2Q96A 2BN7A 4U6EA 1WKMA 2Q94A 5D6EA 1YW7A 5JHUA 1XGOA 3CTZA 1QXWA 3FMQA 4U6ZA 4U73A 5CNXA 4MATA 2GU6A 3IU7A 4RZZA 4FO7A 2V3YA 5FCHA 3IG4A 2NQ6A 5CDEA 1XGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FUK A;  5JFR A;  4U1B A;  2V6C A;  4IPA A;  4IU6 A;  4FLI A;  5CDL A;  4PV4 A;  4FLL A;  4Z7M A;  4FLJ A;  1B6A A;  4U70 A;  1R58 A;  2GZ5 A;  2V3Z A;  4U69 A;  2BWY A;  2HOW A;  2B3H A;  4IF7 A;  2GGC A;  3PKD A;  5FCF A;  3ROR A;  2GU7 A;  4U76 A;  1QZY A;  1C21 A;  1KQ0 A;  3CB5 A;  4ZWO A;  1WLR A;  1WL9 A;  4IKU A;  3PKA A;  3PKC A;  3PKB A;  4S00 A;  5CLS A;  4RGZ 1;  3S6B A;  1YJ3 A;  2EVO A;  3TAV A;  2GGB A;  4IEC A;  2V3X A;  1QXY A;  3MAT A;  1KP0 A;  3RVA A;  1YVM A;  4KM3 A;  4U6C A;  4A6W A;  4S2T P;  4U6J A;  1XNZ A;  1C24 A;  2BH3 A;  2BHB A;  2B3K A;  3BIQ A;  1BN5 A;  2EVM A;  2G6P A;  3FMR A;  2GG7 A;  4B28 A;  1YW9 A;  1A16 A;  2GG8 A;  1W7V A;  2Q92 A;  2GA2 A;  1N51 A;  2P99 A;  2Q95 A;  5E5B A;  4A6V A;  4S01 A;  1JAW A;  2BWV A;  2BHC A;  2EA4 A;  3MR1 A;  1C27 A;  2P98 A;  3PKE A;  4FO8 A;  1Y1N A;  1YW8 A;  1R5G A;  5D6F A;  4RZY A;  4U6W A;  1PV9 A;  2GU5 A;  1C22 A;  2NQ7 A;  1XGS A;  1BOA A;  1WBQ A;  4U71 A;  1QXZ A;  2OAZ A;  2BWU A;  3MX6 A;  2GG5 A;  2GG0 A;  2ADU A;  2BHD A;  2EA2 A;  2BWS A;  2P9A A;  4OOK A;  1R5H A;  3L24 A;  3IU9 A;  2Q8K A;  1WN1 A;  5CE6 A;  1CHM A;  4EGE A;  1WL6 A;  3D27 A;  2BWW A;  2BWT A;  4FKC A;  5CIK A;  2GU4 A;  1B59 A;  1M35 A;  3IU8 A;  4IKT A;  4PNC A;  4IKR A;  2BWX A;  2ZSG A;  2IW2 A;  4U75 A;  1MAT A;  2EVC A;  4IDY A;  4FLK A;  2OKN A;  2BB7 A;  2BHA A;  3CB6 A;  2GTX A;  4IKS A;  1W2M A;  4ZWU A;  1KQ9 A;  2B3L A;  2GG2 A;  3BIT A;  1C23 A;  5CDV A;  5JI6 A;  4S2R P;  4ZNG A;  3FM3 A;  4JUQ A;  1O0X A;  3TB5 A;  4ZWP A;  2MAT A;  2GG3 A;  3L7G A;  1WY2 A;  1XGM A;  2DFI A;  4HXX A;  3Q6D A;  2GG9 A;  3BIP A;  4QR8 A;  4R60 A;  2Q93 A;  2Q96 A;  2BN7 A;  4U6E A;  1WKM A;  2Q94 A;  5D6E A;  1YW7 A;  5JHU A;  1XGO A;  3CTZ A;  1QXW A;  3FMQ A;  4U6Z A;  4U73 A;  5CNX A;  4MAT A;  2GU6 A;  3IU7 A;  4RZZ A;  4FO7 A;  2V3Y A;  5FCH A;  3IG4 A;  2NQ6 A;  5CDE A;  1XGN A; 
#chains in the Genus database with same CATH topology
 4FUK A;  5JFR A;  4U1B A;  2V6C A;  4IPA A;  4IU6 A;  4FLI A;  5CDL A;  4PV4 A;  4FLL A;  4Z7M A;  4FLJ A;  1B6A A;  4U70 A;  1R58 A;  2GZ5 A;  2V3Z A;  4U69 A;  2BWY A;  2HOW A;  2B3H A;  4IF7 A;  2GGC A;  3PKD A;  5FCF A;  3ROR A;  2GU7 A;  4U76 A;  1QZY A;  1C21 A;  1KQ0 A;  3CB5 A;  4ZWO A;  1WLR A;  1WL9 A;  4IKU A;  3PKA A;  3PKC A;  3PKB A;  4S00 A;  5CLS A;  4RGZ 1;  3S6B A;  1YJ3 A;  2EVO A;  3TAV A;  2GGB A;  4IEC A;  2V3X A;  1QXY A;  3MAT A;  1KP0 A;  3RVA A;  1YVM A;  4KM3 A;  4U6C A;  4A6W A;  4S2T P;  4U6J A;  1XNZ A;  1C24 A;  2BH3 A;  2BHB A;  2B3K A;  3BIQ A;  1BN5 A;  2EVM A;  2G6P A;  3FMR A;  2GG7 A;  4B28 A;  1YW9 A;  1A16 A;  2GG8 A;  1W7V A;  2Q92 A;  2GA2 A;  1N51 A;  2P99 A;  2Q95 A;  5E5B A;  4A6V A;  4S01 A;  1JAW A;  2BWV A;  2BHC A;  2EA4 A;  3MR1 A;  1C27 A;  2P98 A;  3PKE A;  4FO8 A;  1Y1N A;  1YW8 A;  1R5G A;  5D6F A;  4RZY A;  4U6W A;  1PV9 A;  2GU5 A;  1C22 A;  2NQ7 A;  1XGS A;  1BOA A;  1WBQ A;  4U71 A;  1QXZ A;  2OAZ A;  2BWU A;  3MX6 A;  2GG5 A;  2GG0 A;  2ADU A;  2BHD A;  2EA2 A;  2BWS A;  2P9A A;  4OOK A;  1R5H A;  3L24 A;  3IU9 A;  2Q8K A;  1WN1 A;  5CE6 A;  1CHM A;  4EGE A;  1WL6 A;  3D27 A;  2BWW A;  2BWT A;  4FKC A;  5CIK A;  2GU4 A;  1B59 A;  1M35 A;  3IU8 A;  4IKT A;  4PNC A;  4IKR A;  2BWX A;  2ZSG A;  2IW2 A;  4U75 A;  1MAT A;  2EVC A;  4IDY A;  4FLK A;  2OKN A;  2BB7 A;  2BHA A;  3CB6 A;  2GTX A;  4IKS A;  1W2M A;  4ZWU A;  1KQ9 A;  2B3L A;  2GG2 A;  3BIT A;  1C23 A;  5CDV A;  5JI6 A;  4S2R P;  4ZNG A;  3FM3 A;  4JUQ A;  1O0X A;  3TB5 A;  4ZWP A;  2MAT A;  2GG3 A;  3L7G A;  1WY2 A;  1XGM A;  2DFI A;  4HXX A;  3Q6D A;  2GG9 A;  3BIP A;  4QR8 A;  4R60 A;  2Q93 A;  2Q96 A;  2BN7 A;  4U6E A;  1WKM A;  2Q94 A;  5D6E A;  1YW7 A;  5JHU A;  1XGO A;  3CTZ A;  1QXW A;  3FMQ A;  4U6Z A;  4U73 A;  5CNX A;  4MAT A;  2GU6 A;  3IU7 A;  4RZZ A;  4FO7 A;  2V3Y A;  5FCH A;  3IG4 A;  2NQ6 A;  5CDE A;  1XGN A; 
#chains in the Genus database with same CATH homology
 4FUK A;  5JFR A;  4U1B A;  2V6C A;  4IPA A;  4IU6 A;  4FLI A;  5CDL A;  4PV4 A;  4FLL A;  4Z7M A;  4FLJ A;  1B6A A;  4U70 A;  1R58 A;  2GZ5 A;  2V3Z A;  4U69 A;  2BWY A;  2HOW A;  2B3H A;  4IF7 A;  2GGC A;  3PKD A;  5FCF A;  3ROR A;  2GU7 A;  4U76 A;  1QZY A;  1C21 A;  1KQ0 A;  3CB5 A;  4ZWO A;  1WLR A;  1WL9 A;  4IKU A;  3PKA A;  3PKC A;  3PKB A;  4S00 A;  5CLS A;  4RGZ 1;  3S6B A;  1YJ3 A;  2EVO A;  3TAV A;  2GGB A;  4IEC A;  2V3X A;  1QXY A;  3MAT A;  1KP0 A;  3RVA A;  1YVM A;  4KM3 A;  4U6C A;  4A6W A;  4S2T P;  4U6J A;  1XNZ A;  1C24 A;  2BH3 A;  2BHB A;  2B3K A;  3BIQ A;  1BN5 A;  2EVM A;  2G6P A;  3FMR A;  2GG7 A;  4B28 A;  1YW9 A;  1A16 A;  2GG8 A;  1W7V A;  2Q92 A;  2GA2 A;  1N51 A;  2P99 A;  2Q95 A;  5E5B A;  4A6V A;  4S01 A;  1JAW A;  2BWV A;  2BHC A;  2EA4 A;  3MR1 A;  1C27 A;  2P98 A;  3PKE A;  4FO8 A;  1Y1N A;  1YW8 A;  1R5G A;  5D6F A;  4RZY A;  4U6W A;  1PV9 A;  2GU5 A;  1C22 A;  2NQ7 A;  1XGS A;  1BOA A;  1WBQ A;  4U71 A;  1QXZ A;  2OAZ A;  2BWU A;  3MX6 A;  2GG5 A;  2GG0 A;  2ADU A;  2BHD A;  2EA2 A;  2BWS A;  2P9A A;  4OOK A;  1R5H A;  3L24 A;  3IU9 A;  2Q8K A;  1WN1 A;  5CE6 A;  1CHM A;  4EGE A;  1WL6 A;  3D27 A;  2BWW A;  2BWT A;  4FKC A;  5CIK A;  2GU4 A;  1B59 A;  1M35 A;  3IU8 A;  4IKT A;  4PNC A;  4IKR A;  2BWX A;  2ZSG A;  2IW2 A;  4U75 A;  1MAT A;  2EVC A;  4IDY A;  4FLK A;  2OKN A;  2BB7 A;  2BHA A;  3CB6 A;  2GTX A;  4IKS A;  1W2M A;  4ZWU A;  1KQ9 A;  2B3L A;  2GG2 A;  3BIT A;  1C23 A;  5CDV A;  5JI6 A;  4S2R P;  4ZNG A;  3FM3 A;  4JUQ A;  1O0X A;  3TB5 A;  4ZWP A;  2MAT A;  2GG3 A;  3L7G A;  1WY2 A;  1XGM A;  2DFI A;  4HXX A;  3Q6D A;  2GG9 A;  3BIP A;  4QR8 A;  4R60 A;  2Q93 A;  2Q96 A;  2BN7 A;  4U6E A;  1WKM A;  2Q94 A;  5D6E A;  1YW7 A;  5JHU A;  1XGO A;  3CTZ A;  1QXW A;  3FMQ A;  4U6Z A;  4U73 A;  5CNX A;  4MAT A;  2GU6 A;  3IU7 A;  4RZZ A;  4FO7 A;  2V3Y A;  5FCH A;  3IG4 A;  2NQ6 A;  5CDE A;  1XGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...