2P9AA

E. coli methionine aminopeptidase dimetalated with inhibitor ye6
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 83
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p9aA00
1XGMA 1XGOA 1QXZA 2EVCA 3Q6DA 2ZSGA 2GGCA 2Q93A 2DFIA 1XGNA 1KQ9A 2BWUA 1JAWA 5CLSA 4ZWUA 4R60A 2EA4A 2V3YA 5D6FA 3MR1A 1N51A 2P98A 2Q94A 1QXYA 5JFRA 2B3HA 2OKNA 2Q95A 4A6WA 1C21A 1WN1A 4IECA 4JUQA 1C24A 3IG4A 4U6EA 2MATA 2P99A 2HOWA 4RZZA 2BWXA 4U75A 5JHUA 2GG3A 3BITA 2Q92A 1YVMA 2ADUA 3IU7A 4IKTA 4IU6A 1B59A 4IKRA 2GU5A 4U6ZA 2GG2A 3TAVA 2BWWA 2P9AA 4FLLA 2BWVA 2GG5A 1WKMA 3PKCA 1MATA 1C22A 4OOKA 4ZNGA 4RZYA 2Q8KA 4S01A 2GG0A 1KQ0A 2GU7A 4IKUA 4B28A 5CIKA 5CNXA 1XGSA 3CTZA 5CDEA 3MATA 3TB5A 4FLIA 4HXXA 1QXWA 2OAZA 1WBQA 1O0XA 2GG7A 1R5HA 2GG9A 3BIQA 3PKEA 1BN5A 1WL6A 2NQ7A 4U73A 3RVAA 2GGBA 4U71A 2B3KA 4S00A 4Z7MA 2V3ZA 1B6AA 5FCHA 1WY2A 1YJ3A 3D27A 5D6EA 2BB7A 1C27A 5CDLA 4FO7A 4KM3A 1WLRA 4U69A 3FMRA 4U70A 4U6WA 2BWYA 1KP0A 4IKSA 5CDVA 4MATA 4EGEA 1C23A 4ZWPA 2EVMA 4PV4A 1W7VA 4S2RP 1CHMA 2EVOA 5FCFA 4IPAA 4U1BA 3RORA 2BHDA 2NQ6A 2GU6A 3PKDA 3S6BA 4FLJA 2BN7A 2BH3A 2BHAA 4U6CA 1YW8A 1Y1NA 2BWTA 2GG8A 3MX6A 4PNCA 1WL9A 2GZ5A 4FKCA 2BHCA 5JI6A 1R5GA 3BIPA 2V3XA 3PKAA 2V6CA 1R58A 3L7GA 4ZWOA 2GU4A 4S2TP 2GTXA 1A16A 2EA2A 2IW2A 2Q96A 1M35A 3PKBA 4RGZ1 2BWSA 4IDYA 4FO8A 5E5BA 4FLKA 1XNZA 1BOAA 1YW7A 2G6PA 3L24A 4FUKA 3FMQA 3FM3A 1YW9A 2BHBA 3CB5A 4U6JA 3CB6A 5CE6A 4A6VA 1PV9A 4QR8A 2B3LA 4IF7A 3IU8A 1QZYA 1W2MA 3IU9A 2GA2A 4U76A
chains in the Genus database with same CATH superfamily
1XGMA 1XGOA 1QXZA 2EVCA 3Q6DA 2ZSGA 2GGCA 2Q93A 2DFIA 1XGNA 1KQ9A 2BWUA 1JAWA 5CLSA 4ZWUA 4R60A 2EA4A 2V3YA 5D6FA 3MR1A 1N51A 2P98A 2Q94A 1QXYA 5JFRA 2B3HA 2OKNA 2Q95A 4A6WA 1C21A 1WN1A 4IECA 4JUQA 1C24A 3IG4A 4U6EA 2MATA 2P99A 2HOWA 4RZZA 2BWXA 4U75A 5JHUA 2GG3A 3BITA 2Q92A 1YVMA 2ADUA 3IU7A 4IKTA 4IU6A 1B59A 4IKRA 2GU5A 4U6ZA 2GG2A 3TAVA 2BWWA 2P9AA 4FLLA 2BWVA 2GG5A 1WKMA 3PKCA 1MATA 1C22A 4OOKA 4ZNGA 4RZYA 2Q8KA 4S01A 2GG0A 1KQ0A 2GU7A 4IKUA 4B28A 5CIKA 5CNXA 1XGSA 3CTZA 5CDEA 3MATA 3TB5A 4FLIA 4HXXA 1QXWA 2OAZA 1WBQA 1O0XA 2GG7A 1R5HA 2GG9A 3BIQA 3PKEA 1BN5A 1WL6A 2NQ7A 4U73A 3RVAA 2GGBA 4U71A 2B3KA 4S00A 4Z7MA 2V3ZA 1B6AA 5FCHA 1WY2A 1YJ3A 3D27A 5D6EA 2BB7A 1C27A 5CDLA 4FO7A 4KM3A 1WLRA 4U69A 3FMRA 4U70A 4U6WA 2BWYA 1KP0A 4IKSA 5CDVA 4MATA 4EGEA 1C23A 4ZWPA 2EVMA 4PV4A 1W7VA 4S2RP 1CHMA 2EVOA 5FCFA 4IPAA 4U1BA 3RORA 2BHDA 2NQ6A 2GU6A 3PKDA 3S6BA 4FLJA 2BN7A 2BH3A 2BHAA 4U6CA 1YW8A 1Y1NA 2BWTA 2GG8A 3MX6A 4PNCA 1WL9A 2GZ5A 4FKCA 2BHCA 5JI6A 1R5GA 3BIPA 2V3XA 3PKAA 2V6CA 1R58A 3L7GA 4ZWOA 2GU4A 4S2TP 2GTXA 1A16A 2EA2A 2IW2A 2Q96A 1M35A 3PKBA 4RGZ1 2BWSA 4IDYA 4FO8A 5E5BA 4FLKA 1XNZA 1BOAA 1YW7A 2G6PA 3L24A 4FUKA 3FMQA 3FM3A 1YW9A 2BHBA 3CB5A 4U6JA 3CB6A 5CE6A 4A6VA 1PV9A 4QR8A 2B3LA 4IF7A 3IU8A 1QZYA 1W2MA 3IU9A 2GA2A 4U76A
chains in the Genus database with same CATH topology
1XGMA 1XGOA 1QXZA 2EVCA 3Q6DA 2ZSGA 2GGCA 2Q93A 2DFIA 1XGNA 1KQ9A 2BWUA 1JAWA 5CLSA 4ZWUA 4R60A 2EA4A 2V3YA 5D6FA 3MR1A 1N51A 2P98A 2Q94A 1QXYA 5JFRA 2B3HA 2OKNA 2Q95A 4A6WA 1C21A 1WN1A 4IECA 4JUQA 1C24A 3IG4A 4U6EA 2MATA 2P99A 2HOWA 4RZZA 2BWXA 4U75A 5JHUA 2GG3A 3BITA 2Q92A 1YVMA 2ADUA 3IU7A 4IKTA 4IU6A 1B59A 4IKRA 2GU5A 4U6ZA 2GG2A 3TAVA 2BWWA 2P9AA 4FLLA 2BWVA 2GG5A 1WKMA 3PKCA 1MATA 1C22A 4OOKA 4ZNGA 4RZYA 2Q8KA 4S01A 2GG0A 1KQ0A 2GU7A 4IKUA 4B28A 5CIKA 5CNXA 1XGSA 3CTZA 5CDEA 3MATA 3TB5A 4FLIA 4HXXA 1QXWA 2OAZA 1WBQA 1O0XA 2GG7A 1R5HA 2GG9A 3BIQA 3PKEA 1BN5A 1WL6A 2NQ7A 4U73A 3RVAA 2GGBA 4U71A 2B3KA 4S00A 4Z7MA 2V3ZA 1B6AA 5FCHA 1WY2A 1YJ3A 3D27A 5D6EA 2BB7A 1C27A 5CDLA 4FO7A 4KM3A 1WLRA 4U69A 3FMRA 4U70A 4U6WA 2BWYA 1KP0A 4IKSA 5CDVA 4MATA 4EGEA 1C23A 4ZWPA 2EVMA 4PV4A 1W7VA 4S2RP 1CHMA 2EVOA 5FCFA 4IPAA 4U1BA 3RORA 2BHDA 2NQ6A 2GU6A 3PKDA 3S6BA 4FLJA 2BN7A 2BH3A 2BHAA 4U6CA 1YW8A 1Y1NA 2BWTA 2GG8A 3MX6A 4PNCA 1WL9A 2GZ5A 4FKCA 2BHCA 5JI6A 1R5GA 3BIPA 2V3XA 3PKAA 2V6CA 1R58A 3L7GA 4ZWOA 2GU4A 4S2TP 2GTXA 1A16A 2EA2A 2IW2A 2Q96A 1M35A 3PKBA 4RGZ1 2BWSA 4IDYA 4FO8A 5E5BA 4FLKA 1XNZA 1BOAA 1YW7A 2G6PA 3L24A 4FUKA 3FMQA 3FM3A 1YW9A 2BHBA 3CB5A 4U6JA 3CB6A 5CE6A 4A6VA 1PV9A 4QR8A 2B3LA 4IF7A 3IU8A 1QZYA 1W2MA 3IU9A 2GA2A 4U76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGM A;  1XGO A;  1QXZ A;  2EVC A;  3Q6D A;  2ZSG A;  2GGC A;  2Q93 A;  2DFI A;  1XGN A;  1KQ9 A;  2BWU A;  1JAW A;  5CLS A;  4ZWU A;  4R60 A;  2EA4 A;  2V3Y A;  5D6F A;  3MR1 A;  1N51 A;  2P98 A;  2Q94 A;  1QXY A;  5JFR A;  2B3H A;  2OKN A;  2Q95 A;  4A6W A;  1C21 A;  1WN1 A;  4IEC A;  4JUQ A;  1C24 A;  3IG4 A;  4U6E A;  2MAT A;  2P99 A;  2HOW A;  4RZZ A;  2BWX A;  4U75 A;  5JHU A;  2GG3 A;  3BIT A;  2Q92 A;  1YVM A;  2ADU A;  3IU7 A;  4IKT A;  4IU6 A;  1B59 A;  4IKR A;  2GU5 A;  4U6Z A;  2GG2 A;  3TAV A;  2BWW A;  2P9A A;  4FLL A;  2BWV A;  2GG5 A;  1WKM A;  3PKC A;  1MAT A;  1C22 A;  4OOK A;  4ZNG A;  4RZY A;  2Q8K A;  4S01 A;  2GG0 A;  1KQ0 A;  2GU7 A;  4IKU A;  4B28 A;  5CIK A;  5CNX A;  1XGS A;  3CTZ A;  5CDE A;  3MAT A;  3TB5 A;  4FLI A;  4HXX A;  1QXW A;  2OAZ A;  1WBQ A;  1O0X A;  2GG7 A;  1R5H A;  2GG9 A;  3BIQ A;  3PKE A;  1BN5 A;  1WL6 A;  2NQ7 A;  4U73 A;  3RVA A;  2GGB A;  4U71 A;  2B3K A;  4S00 A;  4Z7M A;  2V3Z A;  1B6A A;  5FCH A;  1WY2 A;  1YJ3 A;  3D27 A;  5D6E A;  2BB7 A;  1C27 A;  5CDL A;  4FO7 A;  4KM3 A;  1WLR A;  4U69 A;  3FMR A;  4U70 A;  4U6W A;  2BWY A;  1KP0 A;  4IKS A;  5CDV A;  4MAT A;  4EGE A;  1C23 A;  4ZWP A;  2EVM A;  4PV4 A;  1W7V A;  4S2R P;  1CHM A;  2EVO A;  5FCF A;  4IPA A;  4U1B A;  3ROR A;  2BHD A;  2NQ6 A;  2GU6 A;  3PKD A;  3S6B A;  4FLJ A;  2BN7 A;  2BH3 A;  2BHA A;  4U6C A;  1YW8 A;  1Y1N A;  2BWT A;  2GG8 A;  3MX6 A;  4PNC A;  1WL9 A;  2GZ5 A;  4FKC A;  2BHC A;  5JI6 A;  1R5G A;  3BIP A;  2V3X A;  3PKA A;  2V6C A;  1R58 A;  3L7G A;  4ZWO A;  2GU4 A;  4S2T P;  2GTX A;  1A16 A;  2EA2 A;  2IW2 A;  2Q96 A;  1M35 A;  3PKB A;  4RGZ 1;  2BWS A;  4IDY A;  4FO8 A;  5E5B A;  4FLK A;  1XNZ A;  1BOA A;  1YW7 A;  2G6P A;  3L24 A;  4FUK A;  3FMQ A;  3FM3 A;  1YW9 A;  2BHB A;  3CB5 A;  4U6J A;  3CB6 A;  5CE6 A;  4A6V A;  1PV9 A;  4QR8 A;  2B3L A;  4IF7 A;  3IU8 A;  1QZY A;  1W2M A;  3IU9 A;  2GA2 A;  4U76 A; 
#chains in the Genus database with same CATH topology
 1XGM A;  1XGO A;  1QXZ A;  2EVC A;  3Q6D A;  2ZSG A;  2GGC A;  2Q93 A;  2DFI A;  1XGN A;  1KQ9 A;  2BWU A;  1JAW A;  5CLS A;  4ZWU A;  4R60 A;  2EA4 A;  2V3Y A;  5D6F A;  3MR1 A;  1N51 A;  2P98 A;  2Q94 A;  1QXY A;  5JFR A;  2B3H A;  2OKN A;  2Q95 A;  4A6W A;  1C21 A;  1WN1 A;  4IEC A;  4JUQ A;  1C24 A;  3IG4 A;  4U6E A;  2MAT A;  2P99 A;  2HOW A;  4RZZ A;  2BWX A;  4U75 A;  5JHU A;  2GG3 A;  3BIT A;  2Q92 A;  1YVM A;  2ADU A;  3IU7 A;  4IKT A;  4IU6 A;  1B59 A;  4IKR A;  2GU5 A;  4U6Z A;  2GG2 A;  3TAV A;  2BWW A;  2P9A A;  4FLL A;  2BWV A;  2GG5 A;  1WKM A;  3PKC A;  1MAT A;  1C22 A;  4OOK A;  4ZNG A;  4RZY A;  2Q8K A;  4S01 A;  2GG0 A;  1KQ0 A;  2GU7 A;  4IKU A;  4B28 A;  5CIK A;  5CNX A;  1XGS A;  3CTZ A;  5CDE A;  3MAT A;  3TB5 A;  4FLI A;  4HXX A;  1QXW A;  2OAZ A;  1WBQ A;  1O0X A;  2GG7 A;  1R5H A;  2GG9 A;  3BIQ A;  3PKE A;  1BN5 A;  1WL6 A;  2NQ7 A;  4U73 A;  3RVA A;  2GGB A;  4U71 A;  2B3K A;  4S00 A;  4Z7M A;  2V3Z A;  1B6A A;  5FCH A;  1WY2 A;  1YJ3 A;  3D27 A;  5D6E A;  2BB7 A;  1C27 A;  5CDL A;  4FO7 A;  4KM3 A;  1WLR A;  4U69 A;  3FMR A;  4U70 A;  4U6W A;  2BWY A;  1KP0 A;  4IKS A;  5CDV A;  4MAT A;  4EGE A;  1C23 A;  4ZWP A;  2EVM A;  4PV4 A;  1W7V A;  4S2R P;  1CHM A;  2EVO A;  5FCF A;  4IPA A;  4U1B A;  3ROR A;  2BHD A;  2NQ6 A;  2GU6 A;  3PKD A;  3S6B A;  4FLJ A;  2BN7 A;  2BH3 A;  2BHA A;  4U6C A;  1YW8 A;  1Y1N A;  2BWT A;  2GG8 A;  3MX6 A;  4PNC A;  1WL9 A;  2GZ5 A;  4FKC A;  2BHC A;  5JI6 A;  1R5G A;  3BIP A;  2V3X A;  3PKA A;  2V6C A;  1R58 A;  3L7G A;  4ZWO A;  2GU4 A;  4S2T P;  2GTX A;  1A16 A;  2EA2 A;  2IW2 A;  2Q96 A;  1M35 A;  3PKB A;  4RGZ 1;  2BWS A;  4IDY A;  4FO8 A;  5E5B A;  4FLK A;  1XNZ A;  1BOA A;  1YW7 A;  2G6P A;  3L24 A;  4FUK A;  3FMQ A;  3FM3 A;  1YW9 A;  2BHB A;  3CB5 A;  4U6J A;  3CB6 A;  5CE6 A;  4A6V A;  1PV9 A;  4QR8 A;  2B3L A;  4IF7 A;  3IU8 A;  1QZY A;  1W2M A;  3IU9 A;  2GA2 A;  4U76 A; 
#chains in the Genus database with same CATH homology
 1XGM A;  1XGO A;  1QXZ A;  2EVC A;  3Q6D A;  2ZSG A;  2GGC A;  2Q93 A;  2DFI A;  1XGN A;  1KQ9 A;  2BWU A;  1JAW A;  5CLS A;  4ZWU A;  4R60 A;  2EA4 A;  2V3Y A;  5D6F A;  3MR1 A;  1N51 A;  2P98 A;  2Q94 A;  1QXY A;  5JFR A;  2B3H A;  2OKN A;  2Q95 A;  4A6W A;  1C21 A;  1WN1 A;  4IEC A;  4JUQ A;  1C24 A;  3IG4 A;  4U6E A;  2MAT A;  2P99 A;  2HOW A;  4RZZ A;  2BWX A;  4U75 A;  5JHU A;  2GG3 A;  3BIT A;  2Q92 A;  1YVM A;  2ADU A;  3IU7 A;  4IKT A;  4IU6 A;  1B59 A;  4IKR A;  2GU5 A;  4U6Z A;  2GG2 A;  3TAV A;  2BWW A;  2P9A A;  4FLL A;  2BWV A;  2GG5 A;  1WKM A;  3PKC A;  1MAT A;  1C22 A;  4OOK A;  4ZNG A;  4RZY A;  2Q8K A;  4S01 A;  2GG0 A;  1KQ0 A;  2GU7 A;  4IKU A;  4B28 A;  5CIK A;  5CNX A;  1XGS A;  3CTZ A;  5CDE A;  3MAT A;  3TB5 A;  4FLI A;  4HXX A;  1QXW A;  2OAZ A;  1WBQ A;  1O0X A;  2GG7 A;  1R5H A;  2GG9 A;  3BIQ A;  3PKE A;  1BN5 A;  1WL6 A;  2NQ7 A;  4U73 A;  3RVA A;  2GGB A;  4U71 A;  2B3K A;  4S00 A;  4Z7M A;  2V3Z A;  1B6A A;  5FCH A;  1WY2 A;  1YJ3 A;  3D27 A;  5D6E A;  2BB7 A;  1C27 A;  5CDL A;  4FO7 A;  4KM3 A;  1WLR A;  4U69 A;  3FMR A;  4U70 A;  4U6W A;  2BWY A;  1KP0 A;  4IKS A;  5CDV A;  4MAT A;  4EGE A;  1C23 A;  4ZWP A;  2EVM A;  4PV4 A;  1W7V A;  4S2R P;  1CHM A;  2EVO A;  5FCF A;  4IPA A;  4U1B A;  3ROR A;  2BHD A;  2NQ6 A;  2GU6 A;  3PKD A;  3S6B A;  4FLJ A;  2BN7 A;  2BH3 A;  2BHA A;  4U6C A;  1YW8 A;  1Y1N A;  2BWT A;  2GG8 A;  3MX6 A;  4PNC A;  1WL9 A;  2GZ5 A;  4FKC A;  2BHC A;  5JI6 A;  1R5G A;  3BIP A;  2V3X A;  3PKA A;  2V6C A;  1R58 A;  3L7G A;  4ZWO A;  2GU4 A;  4S2T P;  2GTX A;  1A16 A;  2EA2 A;  2IW2 A;  2Q96 A;  1M35 A;  3PKB A;  4RGZ 1;  2BWS A;  4IDY A;  4FO8 A;  5E5B A;  4FLK A;  1XNZ A;  1BOA A;  1YW7 A;  2G6P A;  3L24 A;  4FUK A;  3FMQ A;  3FM3 A;  1YW9 A;  2BHB A;  3CB5 A;  4U6J A;  3CB6 A;  5CE6 A;  4A6V A;  1PV9 A;  4QR8 A;  2B3L A;  4IF7 A;  3IU8 A;  1QZY A;  1W2M A;  3IU9 A;  2GA2 A;  4U76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...