2P9AA

E. coli methionine aminopeptidase dimetalated with inhibitor ye6
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Inhibition of Monometalated Methionine Aminopeptidase: Inhibitor Discovery and Crystallographic Analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 83
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2007-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2p9aA00
1QZYA 4RZZA 2NQ6A 2BWYA 1QXYA 1XNZA 3FMRA 2BWTA 1YW8A 2BHDA 3L7GA 3PKAA 1BOAA 4PNCA 3S6BA 1Y1NA 2HOWA 4ZNGA 1BN5A 2V6CA 3RVAA 2GU5A 2GG3A 1KQ0A 2OKNA 1XGOA 2GG8A 2EA2A 4IF7A 4B28A 1KP0A 4FLKA 4S2TP 1R5HA 1C27A 1WL6A 1WL9A 1B59A 2V3YA 3FM3A 5JFRA 4RZYA 1PV9A 1C23A 3PKBA 2GA2A 5CE6A 5FCFA 1WLRA 2GG0A 1KQ9A 4Z7MA 4FUKA 1YJ3A 2Q92A 3TAVA 4FKCA 1R58A 1C21A 3IU7A 1WN1A 2GTXA 4IU6A 2GG5A 1WKMA 1C22A 4ZWPA 1JAWA 2P9AA 1W2MA 2BHBA 2Q94A 3IU9A 3CB5A 2V3ZA 2GGCA 3BITA 4IDYA 1WBQA 2B3KA 1XGMA 2GU6A 2B3HA 4IKTA 1O0XA 1YW9A 2BWUA 4U6ZA 2Q95A 3MR1A 2P98A 3IG4A 2BWWA 4HXXA 1QXWA 3MATA 4MATA 5D6EA 2EVMA 4S00A 1M35A 4S01A 1XGSA 4FO8A 4A6WA 2BHCA 5JHUA 4U6EA 2DFIA 4U69A 4U6JA 4IECA 1C24A 4U71A 4U6CA 2ADUA 4QR8A 2EA4A 2BH3A 2BB7A 4OOKA 4KM3A 2NQ7A 5D6FA 4A6VA 2IW2A 3MX6A 3RORA 1YW7A 2BWSA 4IKUA 2ZSGA 5CLSA 2BWXA 2EVOA 4IKSA 3FMQA 1A16A 5CNXA 4ZWOA 5CDEA 4RGZ1 3PKDA 2OAZA 1R5GA 4FLIA 2P99A 4FLJA 1B6AA 1W7VA 2BWVA 2GZ5A 2BN7A 4IKRA 4FO7A 2GU4A 4IPAA 2Q8KA 2Q93A 4U1BA 4PV4A 1N51A 2GU7A 2EVCA 3CB6A 3PKEA 2BHAA 4S2RP 4U73A 3TB5A 4EGEA 3L24A 1WY2A 3PKCA 4U70A 2GG9A 4R60A 3BIPA 5E5BA 1MATA 4U76A 2GG7A 4ZWUA 4JUQA 2MATA 3D27A 1CHMA 1XGNA 3IU8A 5CIKA 2GGBA 2V3XA 3BIQA 5CDLA 2GG2A 2B3LA 2G6PA 5CDVA 3CTZA 5JI6A 4U6WA 4U75A 2Q96A 4FLLA 5FCHA 1QXZA 3Q6DA 1YVMA
chains in the Genus database with same CATH superfamily
1QZYA 4RZZA 2NQ6A 2BWYA 1QXYA 1XNZA 3FMRA 2BWTA 1YW8A 2BHDA 3L7GA 3PKAA 1BOAA 4PNCA 3S6BA 1Y1NA 2HOWA 4ZNGA 1BN5A 2V6CA 3RVAA 2GU5A 2GG3A 1KQ0A 2OKNA 1XGOA 2GG8A 2EA2A 4IF7A 4B28A 1KP0A 4FLKA 4S2TP 1R5HA 1C27A 1WL6A 1WL9A 1B59A 2V3YA 3FM3A 5JFRA 4RZYA 1PV9A 1C23A 3PKBA 2GA2A 5CE6A 5FCFA 1WLRA 2GG0A 1KQ9A 4Z7MA 4FUKA 1YJ3A 2Q92A 3TAVA 4FKCA 1R58A 1C21A 3IU7A 1WN1A 2GTXA 4IU6A 2GG5A 1WKMA 1C22A 4ZWPA 1JAWA 2P9AA 1W2MA 2BHBA 2Q94A 3IU9A 3CB5A 2V3ZA 2GGCA 3BITA 4IDYA 1WBQA 2B3KA 1XGMA 2GU6A 2B3HA 4IKTA 1O0XA 1YW9A 2BWUA 4U6ZA 2Q95A 3MR1A 2P98A 3IG4A 2BWWA 4HXXA 1QXWA 3MATA 4MATA 5D6EA 2EVMA 4S00A 1M35A 4S01A 1XGSA 4FO8A 4A6WA 2BHCA 5JHUA 4U6EA 2DFIA 4U69A 4U6JA 4IECA 1C24A 4U71A 4U6CA 2ADUA 4QR8A 2EA4A 2BH3A 2BB7A 4OOKA 4KM3A 2NQ7A 5D6FA 4A6VA 2IW2A 3MX6A 3RORA 1YW7A 2BWSA 4IKUA 2ZSGA 5CLSA 2BWXA 2EVOA 4IKSA 3FMQA 1A16A 5CNXA 4ZWOA 5CDEA 4RGZ1 3PKDA 2OAZA 1R5GA 4FLIA 2P99A 4FLJA 1B6AA 1W7VA 2BWVA 2GZ5A 2BN7A 4IKRA 4FO7A 2GU4A 4IPAA 2Q8KA 2Q93A 4U1BA 4PV4A 1N51A 2GU7A 2EVCA 3CB6A 3PKEA 2BHAA 4S2RP 4U73A 3TB5A 4EGEA 3L24A 1WY2A 3PKCA 4U70A 2GG9A 4R60A 3BIPA 5E5BA 1MATA 4U76A 2GG7A 4ZWUA 4JUQA 2MATA 3D27A 1CHMA 1XGNA 3IU8A 5CIKA 2GGBA 2V3XA 3BIQA 5CDLA 2GG2A 2B3LA 2G6PA 5CDVA 3CTZA 5JI6A 4U6WA 4U75A 2Q96A 4FLLA 5FCHA 1QXZA 3Q6DA 1YVMA
chains in the Genus database with same CATH topology
1QZYA 4RZZA 2NQ6A 2BWYA 1QXYA 1XNZA 3FMRA 2BWTA 1YW8A 2BHDA 3L7GA 3PKAA 1BOAA 4PNCA 3S6BA 1Y1NA 2HOWA 4ZNGA 1BN5A 2V6CA 3RVAA 2GU5A 2GG3A 1KQ0A 2OKNA 1XGOA 2GG8A 2EA2A 4IF7A 4B28A 1KP0A 4FLKA 4S2TP 1R5HA 1C27A 1WL6A 1WL9A 1B59A 2V3YA 3FM3A 5JFRA 4RZYA 1PV9A 1C23A 3PKBA 2GA2A 5CE6A 5FCFA 1WLRA 2GG0A 1KQ9A 4Z7MA 4FUKA 1YJ3A 2Q92A 3TAVA 4FKCA 1R58A 1C21A 3IU7A 1WN1A 2GTXA 4IU6A 2GG5A 1WKMA 1C22A 4ZWPA 1JAWA 2P9AA 1W2MA 2BHBA 2Q94A 3IU9A 3CB5A 2V3ZA 2GGCA 3BITA 4IDYA 1WBQA 2B3KA 1XGMA 2GU6A 2B3HA 4IKTA 1O0XA 1YW9A 2BWUA 4U6ZA 2Q95A 3MR1A 2P98A 3IG4A 2BWWA 4HXXA 1QXWA 3MATA 4MATA 5D6EA 2EVMA 4S00A 1M35A 4S01A 1XGSA 4FO8A 4A6WA 2BHCA 5JHUA 4U6EA 2DFIA 4U69A 4U6JA 4IECA 1C24A 4U71A 4U6CA 2ADUA 4QR8A 2EA4A 2BH3A 2BB7A 4OOKA 4KM3A 2NQ7A 5D6FA 4A6VA 2IW2A 3MX6A 3RORA 1YW7A 2BWSA 4IKUA 2ZSGA 5CLSA 2BWXA 2EVOA 4IKSA 3FMQA 1A16A 5CNXA 4ZWOA 5CDEA 4RGZ1 3PKDA 2OAZA 1R5GA 4FLIA 2P99A 4FLJA 1B6AA 1W7VA 2BWVA 2GZ5A 2BN7A 4IKRA 4FO7A 2GU4A 4IPAA 2Q8KA 2Q93A 4U1BA 4PV4A 1N51A 2GU7A 2EVCA 3CB6A 3PKEA 2BHAA 4S2RP 4U73A 3TB5A 4EGEA 3L24A 1WY2A 3PKCA 4U70A 2GG9A 4R60A 3BIPA 5E5BA 1MATA 4U76A 2GG7A 4ZWUA 4JUQA 2MATA 3D27A 1CHMA 1XGNA 3IU8A 5CIKA 2GGBA 2V3XA 3BIQA 5CDLA 2GG2A 2B3LA 2G6PA 5CDVA 3CTZA 5JI6A 4U6WA 4U75A 2Q96A 4FLLA 5FCHA 1QXZA 3Q6DA 1YVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZY A;  4RZZ A;  2NQ6 A;  2BWY A;  1QXY A;  1XNZ A;  3FMR A;  2BWT A;  1YW8 A;  2BHD A;  3L7G A;  3PKA A;  1BOA A;  4PNC A;  3S6B A;  1Y1N A;  2HOW A;  4ZNG A;  1BN5 A;  2V6C A;  3RVA A;  2GU5 A;  2GG3 A;  1KQ0 A;  2OKN A;  1XGO A;  2GG8 A;  2EA2 A;  4IF7 A;  4B28 A;  1KP0 A;  4FLK A;  4S2T P;  1R5H A;  1C27 A;  1WL6 A;  1WL9 A;  1B59 A;  2V3Y A;  3FM3 A;  5JFR A;  4RZY A;  1PV9 A;  1C23 A;  3PKB A;  2GA2 A;  5CE6 A;  5FCF A;  1WLR A;  2GG0 A;  1KQ9 A;  4Z7M A;  4FUK A;  1YJ3 A;  2Q92 A;  3TAV A;  4FKC A;  1R58 A;  1C21 A;  3IU7 A;  1WN1 A;  2GTX A;  4IU6 A;  2GG5 A;  1WKM A;  1C22 A;  4ZWP A;  1JAW A;  2P9A A;  1W2M A;  2BHB A;  2Q94 A;  3IU9 A;  3CB5 A;  2V3Z A;  2GGC A;  3BIT A;  4IDY A;  1WBQ A;  2B3K A;  1XGM A;  2GU6 A;  2B3H A;  4IKT A;  1O0X A;  1YW9 A;  2BWU A;  4U6Z A;  2Q95 A;  3MR1 A;  2P98 A;  3IG4 A;  2BWW A;  4HXX A;  1QXW A;  3MAT A;  4MAT A;  5D6E A;  2EVM A;  4S00 A;  1M35 A;  4S01 A;  1XGS A;  4FO8 A;  4A6W A;  2BHC A;  5JHU A;  4U6E A;  2DFI A;  4U69 A;  4U6J A;  4IEC A;  1C24 A;  4U71 A;  4U6C A;  2ADU A;  4QR8 A;  2EA4 A;  2BH3 A;  2BB7 A;  4OOK A;  4KM3 A;  2NQ7 A;  5D6F A;  4A6V A;  2IW2 A;  3MX6 A;  3ROR A;  1YW7 A;  2BWS A;  4IKU A;  2ZSG A;  5CLS A;  2BWX A;  2EVO A;  4IKS A;  3FMQ A;  1A16 A;  5CNX A;  4ZWO A;  5CDE A;  4RGZ 1;  3PKD A;  2OAZ A;  1R5G A;  4FLI A;  2P99 A;  4FLJ A;  1B6A A;  1W7V A;  2BWV A;  2GZ5 A;  2BN7 A;  4IKR A;  4FO7 A;  2GU4 A;  4IPA A;  2Q8K A;  2Q93 A;  4U1B A;  4PV4 A;  1N51 A;  2GU7 A;  2EVC A;  3CB6 A;  3PKE A;  2BHA A;  4S2R P;  4U73 A;  3TB5 A;  4EGE A;  3L24 A;  1WY2 A;  3PKC A;  4U70 A;  2GG9 A;  4R60 A;  3BIP A;  5E5B A;  1MAT A;  4U76 A;  2GG7 A;  4ZWU A;  4JUQ A;  2MAT A;  3D27 A;  1CHM A;  1XGN A;  3IU8 A;  5CIK A;  2GGB A;  2V3X A;  3BIQ A;  5CDL A;  2GG2 A;  2B3L A;  2G6P A;  5CDV A;  3CTZ A;  5JI6 A;  4U6W A;  4U75 A;  2Q96 A;  4FLL A;  5FCH A;  1QXZ A;  3Q6D A;  1YVM A; 
#chains in the Genus database with same CATH topology
 1QZY A;  4RZZ A;  2NQ6 A;  2BWY A;  1QXY A;  1XNZ A;  3FMR A;  2BWT A;  1YW8 A;  2BHD A;  3L7G A;  3PKA A;  1BOA A;  4PNC A;  3S6B A;  1Y1N A;  2HOW A;  4ZNG A;  1BN5 A;  2V6C A;  3RVA A;  2GU5 A;  2GG3 A;  1KQ0 A;  2OKN A;  1XGO A;  2GG8 A;  2EA2 A;  4IF7 A;  4B28 A;  1KP0 A;  4FLK A;  4S2T P;  1R5H A;  1C27 A;  1WL6 A;  1WL9 A;  1B59 A;  2V3Y A;  3FM3 A;  5JFR A;  4RZY A;  1PV9 A;  1C23 A;  3PKB A;  2GA2 A;  5CE6 A;  5FCF A;  1WLR A;  2GG0 A;  1KQ9 A;  4Z7M A;  4FUK A;  1YJ3 A;  2Q92 A;  3TAV A;  4FKC A;  1R58 A;  1C21 A;  3IU7 A;  1WN1 A;  2GTX A;  4IU6 A;  2GG5 A;  1WKM A;  1C22 A;  4ZWP A;  1JAW A;  2P9A A;  1W2M A;  2BHB A;  2Q94 A;  3IU9 A;  3CB5 A;  2V3Z A;  2GGC A;  3BIT A;  4IDY A;  1WBQ A;  2B3K A;  1XGM A;  2GU6 A;  2B3H A;  4IKT A;  1O0X A;  1YW9 A;  2BWU A;  4U6Z A;  2Q95 A;  3MR1 A;  2P98 A;  3IG4 A;  2BWW A;  4HXX A;  1QXW A;  3MAT A;  4MAT A;  5D6E A;  2EVM A;  4S00 A;  1M35 A;  4S01 A;  1XGS A;  4FO8 A;  4A6W A;  2BHC A;  5JHU A;  4U6E A;  2DFI A;  4U69 A;  4U6J A;  4IEC A;  1C24 A;  4U71 A;  4U6C A;  2ADU A;  4QR8 A;  2EA4 A;  2BH3 A;  2BB7 A;  4OOK A;  4KM3 A;  2NQ7 A;  5D6F A;  4A6V A;  2IW2 A;  3MX6 A;  3ROR A;  1YW7 A;  2BWS A;  4IKU A;  2ZSG A;  5CLS A;  2BWX A;  2EVO A;  4IKS A;  3FMQ A;  1A16 A;  5CNX A;  4ZWO A;  5CDE A;  4RGZ 1;  3PKD A;  2OAZ A;  1R5G A;  4FLI A;  2P99 A;  4FLJ A;  1B6A A;  1W7V A;  2BWV A;  2GZ5 A;  2BN7 A;  4IKR A;  4FO7 A;  2GU4 A;  4IPA A;  2Q8K A;  2Q93 A;  4U1B A;  4PV4 A;  1N51 A;  2GU7 A;  2EVC A;  3CB6 A;  3PKE A;  2BHA A;  4S2R P;  4U73 A;  3TB5 A;  4EGE A;  3L24 A;  1WY2 A;  3PKC A;  4U70 A;  2GG9 A;  4R60 A;  3BIP A;  5E5B A;  1MAT A;  4U76 A;  2GG7 A;  4ZWU A;  4JUQ A;  2MAT A;  3D27 A;  1CHM A;  1XGN A;  3IU8 A;  5CIK A;  2GGB A;  2V3X A;  3BIQ A;  5CDL A;  2GG2 A;  2B3L A;  2G6P A;  5CDV A;  3CTZ A;  5JI6 A;  4U6W A;  4U75 A;  2Q96 A;  4FLL A;  5FCH A;  1QXZ A;  3Q6D A;  1YVM A; 
#chains in the Genus database with same CATH homology
 1QZY A;  4RZZ A;  2NQ6 A;  2BWY A;  1QXY A;  1XNZ A;  3FMR A;  2BWT A;  1YW8 A;  2BHD A;  3L7G A;  3PKA A;  1BOA A;  4PNC A;  3S6B A;  1Y1N A;  2HOW A;  4ZNG A;  1BN5 A;  2V6C A;  3RVA A;  2GU5 A;  2GG3 A;  1KQ0 A;  2OKN A;  1XGO A;  2GG8 A;  2EA2 A;  4IF7 A;  4B28 A;  1KP0 A;  4FLK A;  4S2T P;  1R5H A;  1C27 A;  1WL6 A;  1WL9 A;  1B59 A;  2V3Y A;  3FM3 A;  5JFR A;  4RZY A;  1PV9 A;  1C23 A;  3PKB A;  2GA2 A;  5CE6 A;  5FCF A;  1WLR A;  2GG0 A;  1KQ9 A;  4Z7M A;  4FUK A;  1YJ3 A;  2Q92 A;  3TAV A;  4FKC A;  1R58 A;  1C21 A;  3IU7 A;  1WN1 A;  2GTX A;  4IU6 A;  2GG5 A;  1WKM A;  1C22 A;  4ZWP A;  1JAW A;  2P9A A;  1W2M A;  2BHB A;  2Q94 A;  3IU9 A;  3CB5 A;  2V3Z A;  2GGC A;  3BIT A;  4IDY A;  1WBQ A;  2B3K A;  1XGM A;  2GU6 A;  2B3H A;  4IKT A;  1O0X A;  1YW9 A;  2BWU A;  4U6Z A;  2Q95 A;  3MR1 A;  2P98 A;  3IG4 A;  2BWW A;  4HXX A;  1QXW A;  3MAT A;  4MAT A;  5D6E A;  2EVM A;  4S00 A;  1M35 A;  4S01 A;  1XGS A;  4FO8 A;  4A6W A;  2BHC A;  5JHU A;  4U6E A;  2DFI A;  4U69 A;  4U6J A;  4IEC A;  1C24 A;  4U71 A;  4U6C A;  2ADU A;  4QR8 A;  2EA4 A;  2BH3 A;  2BB7 A;  4OOK A;  4KM3 A;  2NQ7 A;  5D6F A;  4A6V A;  2IW2 A;  3MX6 A;  3ROR A;  1YW7 A;  2BWS A;  4IKU A;  2ZSG A;  5CLS A;  2BWX A;  2EVO A;  4IKS A;  3FMQ A;  1A16 A;  5CNX A;  4ZWO A;  5CDE A;  4RGZ 1;  3PKD A;  2OAZ A;  1R5G A;  4FLI A;  2P99 A;  4FLJ A;  1B6A A;  1W7V A;  2BWV A;  2GZ5 A;  2BN7 A;  4IKR A;  4FO7 A;  2GU4 A;  4IPA A;  2Q8K A;  2Q93 A;  4U1B A;  4PV4 A;  1N51 A;  2GU7 A;  2EVC A;  3CB6 A;  3PKE A;  2BHA A;  4S2R P;  4U73 A;  3TB5 A;  4EGE A;  3L24 A;  1WY2 A;  3PKC A;  4U70 A;  2GG9 A;  4R60 A;  3BIP A;  5E5B A;  1MAT A;  4U76 A;  2GG7 A;  4ZWU A;  4JUQ A;  2MAT A;  3D27 A;  1CHM A;  1XGN A;  3IU8 A;  5CIK A;  2GGB A;  2V3X A;  3BIQ A;  5CDL A;  2GG2 A;  2B3L A;  2G6P A;  5CDV A;  3CTZ A;  5JI6 A;  4U6W A;  4U75 A;  2Q96 A;  4FLL A;  5FCH A;  1QXZ A;  3Q6D A;  1YVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...