3MATA

E.coli methionine aminopeptidase transition-state inhibitor complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 86
structure length 264
sequence length 264
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3matA00
1N51A 1WL9A 2GA2A 4IECA 5D6EA 3FMRA 4JUQA 2GU7A 3PKAA 2P9AA 4PNCA 4ZWPA 2HOWA 2Q8KA 1YVMA 2G6PA 2BB7A 4S2TP 4U70A 1QXWA 2B3KA 2NQ6A 5CDVA 1R5HA 2IW2A 1QXYA 3BITA 5FCHA 4KM3A 5CNXA 4R60A 5CDLA 4U1BA 3IU7A 2EVMA 3MR1A 4IKSA 1YW8A 3BIPA 2BHCA 1WL6A 1XGMA 2GG0A 2OAZA 4U69A 2BWXA 3L24A 1BOAA 1C22A 4FLLA 5JFRA 1WN1A 1QZYA 1MATA 5E5BA 3CB6A 1C24A 4RGZ1 2GU5A 4OOKA 2B3LA 2GG2A 1WBQA 4IKUA 4IU6A 4U71A 2P99A 1KQ9A 2BWWA 3IU9A 2Q95A 4IDYA 4FLKA 4A6VA 2EVCA 2GU6A 1B59A 2GG9A 2V6CA 2BWSA 1BN5A 2V3XA 3IU8A 1PV9A 1W2MA 4U75A 2GGCA 5FCFA 4A6WA 1A16A 3D27A 2DFIA 3FM3A 2V3YA 3PKCA 3CTZA 2BHBA 4FO8A 4IF7A 4IKTA 4U6JA 2MATA 3PKBA 1XNZA 2EA4A 4B28A 2ZSGA 1KQ0A 4MATA 2NQ7A 5CE6A 4IKRA 1R58A 3IG4A 4FLJA 4U6CA 3TB5A 4FUKA 1XGSA 2BH3A 4S00A 2BWUA 1WLRA 3MX6A 1O0XA 2BWTA 1B6AA 2Q96A 2GG7A 4S01A 3RVAA 2P98A 5CDEA 2BN7A 2V3ZA 2B3HA 2Q93A 3CB5A 4ZNGA 3L7GA 4RZZA 4U76A 1WY2A 3TAVA 3PKEA 4HXXA 4IPAA 5JHUA 1XGNA 4U6WA 1WKMA 4U6EA 3S6BA 1W7VA 4FO7A 2GZ5A 3MATA 1YJ3A 3Q6DA 1XGOA 2GG3A 1KP0A 2EVOA 4S2RP 2OKNA 4EGEA 5JI6A 2GTXA 4U73A 5CLSA 2BHDA 2Q94A 2GGBA 4PV4A 3RORA 3PKDA 1YW7A 2EA2A 1R5GA 3FMQA 4FLIA 1C27A 2GU4A 5D6FA 2Q92A 4RZYA 3BIQA 4ZWUA 1M35A 4Z7MA 2BWYA 1QXZA 1JAWA 4U6ZA 5CIKA 1C21A 2BWVA 2GG5A 1Y1NA 4FKCA 1CHMA 4QR8A 2ADUA 2GG8A 4ZWOA 1YW9A 2BHAA 1C23A
chains in the Genus database with same CATH superfamily
1N51A 1WL9A 2GA2A 4IECA 5D6EA 3FMRA 4JUQA 2GU7A 3PKAA 2P9AA 4PNCA 4ZWPA 2HOWA 2Q8KA 1YVMA 2G6PA 2BB7A 4S2TP 4U70A 1QXWA 2B3KA 2NQ6A 5CDVA 1R5HA 2IW2A 1QXYA 3BITA 5FCHA 4KM3A 5CNXA 4R60A 5CDLA 4U1BA 3IU7A 2EVMA 3MR1A 4IKSA 1YW8A 3BIPA 2BHCA 1WL6A 1XGMA 2GG0A 2OAZA 4U69A 2BWXA 3L24A 1BOAA 1C22A 4FLLA 5JFRA 1WN1A 1QZYA 1MATA 5E5BA 3CB6A 1C24A 4RGZ1 2GU5A 4OOKA 2B3LA 2GG2A 1WBQA 4IKUA 4IU6A 4U71A 2P99A 1KQ9A 2BWWA 3IU9A 2Q95A 4IDYA 4FLKA 4A6VA 2EVCA 2GU6A 1B59A 2GG9A 2V6CA 2BWSA 1BN5A 2V3XA 3IU8A 1PV9A 1W2MA 4U75A 2GGCA 5FCFA 4A6WA 1A16A 3D27A 2DFIA 3FM3A 2V3YA 3PKCA 3CTZA 2BHBA 4FO8A 4IF7A 4IKTA 4U6JA 2MATA 3PKBA 1XNZA 2EA4A 4B28A 2ZSGA 1KQ0A 4MATA 2NQ7A 5CE6A 4IKRA 1R58A 3IG4A 4FLJA 4U6CA 3TB5A 4FUKA 1XGSA 2BH3A 4S00A 2BWUA 1WLRA 3MX6A 1O0XA 2BWTA 1B6AA 2Q96A 2GG7A 4S01A 3RVAA 2P98A 5CDEA 2BN7A 2V3ZA 2B3HA 2Q93A 3CB5A 4ZNGA 3L7GA 4RZZA 4U76A 1WY2A 3TAVA 3PKEA 4HXXA 4IPAA 5JHUA 1XGNA 4U6WA 1WKMA 4U6EA 3S6BA 1W7VA 4FO7A 2GZ5A 3MATA 1YJ3A 3Q6DA 1XGOA 2GG3A 1KP0A 2EVOA 4S2RP 2OKNA 4EGEA 5JI6A 2GTXA 4U73A 5CLSA 2BHDA 2Q94A 2GGBA 4PV4A 3RORA 3PKDA 1YW7A 2EA2A 1R5GA 3FMQA 4FLIA 1C27A 2GU4A 5D6FA 2Q92A 4RZYA 3BIQA 4ZWUA 1M35A 4Z7MA 2BWYA 1QXZA 1JAWA 4U6ZA 5CIKA 1C21A 2BWVA 2GG5A 1Y1NA 4FKCA 1CHMA 4QR8A 2ADUA 2GG8A 4ZWOA 1YW9A 2BHAA 1C23A
chains in the Genus database with same CATH topology
1N51A 1WL9A 2GA2A 4IECA 5D6EA 3FMRA 4JUQA 2GU7A 3PKAA 2P9AA 4PNCA 4ZWPA 2HOWA 2Q8KA 1YVMA 2G6PA 2BB7A 4S2TP 4U70A 1QXWA 2B3KA 2NQ6A 5CDVA 1R5HA 2IW2A 1QXYA 3BITA 5FCHA 4KM3A 5CNXA 4R60A 5CDLA 4U1BA 3IU7A 2EVMA 3MR1A 4IKSA 1YW8A 3BIPA 2BHCA 1WL6A 1XGMA 2GG0A 2OAZA 4U69A 2BWXA 3L24A 1BOAA 1C22A 4FLLA 5JFRA 1WN1A 1QZYA 1MATA 5E5BA 3CB6A 1C24A 4RGZ1 2GU5A 4OOKA 2B3LA 2GG2A 1WBQA 4IKUA 4IU6A 4U71A 2P99A 1KQ9A 2BWWA 3IU9A 2Q95A 4IDYA 4FLKA 4A6VA 2EVCA 2GU6A 1B59A 2GG9A 2V6CA 2BWSA 1BN5A 2V3XA 3IU8A 1PV9A 1W2MA 4U75A 2GGCA 5FCFA 4A6WA 1A16A 3D27A 2DFIA 3FM3A 2V3YA 3PKCA 3CTZA 2BHBA 4FO8A 4IF7A 4IKTA 4U6JA 2MATA 3PKBA 1XNZA 2EA4A 4B28A 2ZSGA 1KQ0A 4MATA 2NQ7A 5CE6A 4IKRA 1R58A 3IG4A 4FLJA 4U6CA 3TB5A 4FUKA 1XGSA 2BH3A 4S00A 2BWUA 1WLRA 3MX6A 1O0XA 2BWTA 1B6AA 2Q96A 2GG7A 4S01A 3RVAA 2P98A 5CDEA 2BN7A 2V3ZA 2B3HA 2Q93A 3CB5A 4ZNGA 3L7GA 4RZZA 4U76A 1WY2A 3TAVA 3PKEA 4HXXA 4IPAA 5JHUA 1XGNA 4U6WA 1WKMA 4U6EA 3S6BA 1W7VA 4FO7A 2GZ5A 3MATA 1YJ3A 3Q6DA 1XGOA 2GG3A 1KP0A 2EVOA 4S2RP 2OKNA 4EGEA 5JI6A 2GTXA 4U73A 5CLSA 2BHDA 2Q94A 2GGBA 4PV4A 3RORA 3PKDA 1YW7A 2EA2A 1R5GA 3FMQA 4FLIA 1C27A 2GU4A 5D6FA 2Q92A 4RZYA 3BIQA 4ZWUA 1M35A 4Z7MA 2BWYA 1QXZA 1JAWA 4U6ZA 5CIKA 1C21A 2BWVA 2GG5A 1Y1NA 4FKCA 1CHMA 4QR8A 2ADUA 2GG8A 4ZWOA 1YW9A 2BHAA 1C23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N51 A;  1WL9 A;  2GA2 A;  4IEC A;  5D6E A;  3FMR A;  4JUQ A;  2GU7 A;  3PKA A;  2P9A A;  4PNC A;  4ZWP A;  2HOW A;  2Q8K A;  1YVM A;  2G6P A;  2BB7 A;  4S2T P;  4U70 A;  1QXW A;  2B3K A;  2NQ6 A;  5CDV A;  1R5H A;  2IW2 A;  1QXY A;  3BIT A;  5FCH A;  4KM3 A;  5CNX A;  4R60 A;  5CDL A;  4U1B A;  3IU7 A;  2EVM A;  3MR1 A;  4IKS A;  1YW8 A;  3BIP A;  2BHC A;  1WL6 A;  1XGM A;  2GG0 A;  2OAZ A;  4U69 A;  2BWX A;  3L24 A;  1BOA A;  1C22 A;  4FLL A;  5JFR A;  1WN1 A;  1QZY A;  1MAT A;  5E5B A;  3CB6 A;  1C24 A;  4RGZ 1;  2GU5 A;  4OOK A;  2B3L A;  2GG2 A;  1WBQ A;  4IKU A;  4IU6 A;  4U71 A;  2P99 A;  1KQ9 A;  2BWW A;  3IU9 A;  2Q95 A;  4IDY A;  4FLK A;  4A6V A;  2EVC A;  2GU6 A;  1B59 A;  2GG9 A;  2V6C A;  2BWS A;  1BN5 A;  2V3X A;  3IU8 A;  1PV9 A;  1W2M A;  4U75 A;  2GGC A;  5FCF A;  4A6W A;  1A16 A;  3D27 A;  2DFI A;  3FM3 A;  2V3Y A;  3PKC A;  3CTZ A;  2BHB A;  4FO8 A;  4IF7 A;  4IKT A;  4U6J A;  2MAT A;  3PKB A;  1XNZ A;  2EA4 A;  4B28 A;  2ZSG A;  1KQ0 A;  4MAT A;  2NQ7 A;  5CE6 A;  4IKR A;  1R58 A;  3IG4 A;  4FLJ A;  4U6C A;  3TB5 A;  4FUK A;  1XGS A;  2BH3 A;  4S00 A;  2BWU A;  1WLR A;  3MX6 A;  1O0X A;  2BWT A;  1B6A A;  2Q96 A;  2GG7 A;  4S01 A;  3RVA A;  2P98 A;  5CDE A;  2BN7 A;  2V3Z A;  2B3H A;  2Q93 A;  3CB5 A;  4ZNG A;  3L7G A;  4RZZ A;  4U76 A;  1WY2 A;  3TAV A;  3PKE A;  4HXX A;  4IPA A;  5JHU A;  1XGN A;  4U6W A;  1WKM A;  4U6E A;  3S6B A;  1W7V A;  4FO7 A;  2GZ5 A;  3MAT A;  1YJ3 A;  3Q6D A;  1XGO A;  2GG3 A;  1KP0 A;  2EVO A;  4S2R P;  2OKN A;  4EGE A;  5JI6 A;  2GTX A;  4U73 A;  5CLS A;  2BHD A;  2Q94 A;  2GGB A;  4PV4 A;  3ROR A;  3PKD A;  1YW7 A;  2EA2 A;  1R5G A;  3FMQ A;  4FLI A;  1C27 A;  2GU4 A;  5D6F A;  2Q92 A;  4RZY A;  3BIQ A;  4ZWU A;  1M35 A;  4Z7M A;  2BWY A;  1QXZ A;  1JAW A;  4U6Z A;  5CIK A;  1C21 A;  2BWV A;  2GG5 A;  1Y1N A;  4FKC A;  1CHM A;  4QR8 A;  2ADU A;  2GG8 A;  4ZWO A;  1YW9 A;  2BHA A;  1C23 A; 
#chains in the Genus database with same CATH topology
 1N51 A;  1WL9 A;  2GA2 A;  4IEC A;  5D6E A;  3FMR A;  4JUQ A;  2GU7 A;  3PKA A;  2P9A A;  4PNC A;  4ZWP A;  2HOW A;  2Q8K A;  1YVM A;  2G6P A;  2BB7 A;  4S2T P;  4U70 A;  1QXW A;  2B3K A;  2NQ6 A;  5CDV A;  1R5H A;  2IW2 A;  1QXY A;  3BIT A;  5FCH A;  4KM3 A;  5CNX A;  4R60 A;  5CDL A;  4U1B A;  3IU7 A;  2EVM A;  3MR1 A;  4IKS A;  1YW8 A;  3BIP A;  2BHC A;  1WL6 A;  1XGM A;  2GG0 A;  2OAZ A;  4U69 A;  2BWX A;  3L24 A;  1BOA A;  1C22 A;  4FLL A;  5JFR A;  1WN1 A;  1QZY A;  1MAT A;  5E5B A;  3CB6 A;  1C24 A;  4RGZ 1;  2GU5 A;  4OOK A;  2B3L A;  2GG2 A;  1WBQ A;  4IKU A;  4IU6 A;  4U71 A;  2P99 A;  1KQ9 A;  2BWW A;  3IU9 A;  2Q95 A;  4IDY A;  4FLK A;  4A6V A;  2EVC A;  2GU6 A;  1B59 A;  2GG9 A;  2V6C A;  2BWS A;  1BN5 A;  2V3X A;  3IU8 A;  1PV9 A;  1W2M A;  4U75 A;  2GGC A;  5FCF A;  4A6W A;  1A16 A;  3D27 A;  2DFI A;  3FM3 A;  2V3Y A;  3PKC A;  3CTZ A;  2BHB A;  4FO8 A;  4IF7 A;  4IKT A;  4U6J A;  2MAT A;  3PKB A;  1XNZ A;  2EA4 A;  4B28 A;  2ZSG A;  1KQ0 A;  4MAT A;  2NQ7 A;  5CE6 A;  4IKR A;  1R58 A;  3IG4 A;  4FLJ A;  4U6C A;  3TB5 A;  4FUK A;  1XGS A;  2BH3 A;  4S00 A;  2BWU A;  1WLR A;  3MX6 A;  1O0X A;  2BWT A;  1B6A A;  2Q96 A;  2GG7 A;  4S01 A;  3RVA A;  2P98 A;  5CDE A;  2BN7 A;  2V3Z A;  2B3H A;  2Q93 A;  3CB5 A;  4ZNG A;  3L7G A;  4RZZ A;  4U76 A;  1WY2 A;  3TAV A;  3PKE A;  4HXX A;  4IPA A;  5JHU A;  1XGN A;  4U6W A;  1WKM A;  4U6E A;  3S6B A;  1W7V A;  4FO7 A;  2GZ5 A;  3MAT A;  1YJ3 A;  3Q6D A;  1XGO A;  2GG3 A;  1KP0 A;  2EVO A;  4S2R P;  2OKN A;  4EGE A;  5JI6 A;  2GTX A;  4U73 A;  5CLS A;  2BHD A;  2Q94 A;  2GGB A;  4PV4 A;  3ROR A;  3PKD A;  1YW7 A;  2EA2 A;  1R5G A;  3FMQ A;  4FLI A;  1C27 A;  2GU4 A;  5D6F A;  2Q92 A;  4RZY A;  3BIQ A;  4ZWU A;  1M35 A;  4Z7M A;  2BWY A;  1QXZ A;  1JAW A;  4U6Z A;  5CIK A;  1C21 A;  2BWV A;  2GG5 A;  1Y1N A;  4FKC A;  1CHM A;  4QR8 A;  2ADU A;  2GG8 A;  4ZWO A;  1YW9 A;  2BHA A;  1C23 A; 
#chains in the Genus database with same CATH homology
 1N51 A;  1WL9 A;  2GA2 A;  4IEC A;  5D6E A;  3FMR A;  4JUQ A;  2GU7 A;  3PKA A;  2P9A A;  4PNC A;  4ZWP A;  2HOW A;  2Q8K A;  1YVM A;  2G6P A;  2BB7 A;  4S2T P;  4U70 A;  1QXW A;  2B3K A;  2NQ6 A;  5CDV A;  1R5H A;  2IW2 A;  1QXY A;  3BIT A;  5FCH A;  4KM3 A;  5CNX A;  4R60 A;  5CDL A;  4U1B A;  3IU7 A;  2EVM A;  3MR1 A;  4IKS A;  1YW8 A;  3BIP A;  2BHC A;  1WL6 A;  1XGM A;  2GG0 A;  2OAZ A;  4U69 A;  2BWX A;  3L24 A;  1BOA A;  1C22 A;  4FLL A;  5JFR A;  1WN1 A;  1QZY A;  1MAT A;  5E5B A;  3CB6 A;  1C24 A;  4RGZ 1;  2GU5 A;  4OOK A;  2B3L A;  2GG2 A;  1WBQ A;  4IKU A;  4IU6 A;  4U71 A;  2P99 A;  1KQ9 A;  2BWW A;  3IU9 A;  2Q95 A;  4IDY A;  4FLK A;  4A6V A;  2EVC A;  2GU6 A;  1B59 A;  2GG9 A;  2V6C A;  2BWS A;  1BN5 A;  2V3X A;  3IU8 A;  1PV9 A;  1W2M A;  4U75 A;  2GGC A;  5FCF A;  4A6W A;  1A16 A;  3D27 A;  2DFI A;  3FM3 A;  2V3Y A;  3PKC A;  3CTZ A;  2BHB A;  4FO8 A;  4IF7 A;  4IKT A;  4U6J A;  2MAT A;  3PKB A;  1XNZ A;  2EA4 A;  4B28 A;  2ZSG A;  1KQ0 A;  4MAT A;  2NQ7 A;  5CE6 A;  4IKR A;  1R58 A;  3IG4 A;  4FLJ A;  4U6C A;  3TB5 A;  4FUK A;  1XGS A;  2BH3 A;  4S00 A;  2BWU A;  1WLR A;  3MX6 A;  1O0X A;  2BWT A;  1B6A A;  2Q96 A;  2GG7 A;  4S01 A;  3RVA A;  2P98 A;  5CDE A;  2BN7 A;  2V3Z A;  2B3H A;  2Q93 A;  3CB5 A;  4ZNG A;  3L7G A;  4RZZ A;  4U76 A;  1WY2 A;  3TAV A;  3PKE A;  4HXX A;  4IPA A;  5JHU A;  1XGN A;  4U6W A;  1WKM A;  4U6E A;  3S6B A;  1W7V A;  4FO7 A;  2GZ5 A;  3MAT A;  1YJ3 A;  3Q6D A;  1XGO A;  2GG3 A;  1KP0 A;  2EVO A;  4S2R P;  2OKN A;  4EGE A;  5JI6 A;  2GTX A;  4U73 A;  5CLS A;  2BHD A;  2Q94 A;  2GGB A;  4PV4 A;  3ROR A;  3PKD A;  1YW7 A;  2EA2 A;  1R5G A;  3FMQ A;  4FLI A;  1C27 A;  2GU4 A;  5D6F A;  2Q92 A;  4RZY A;  3BIQ A;  4ZWU A;  1M35 A;  4Z7M A;  2BWY A;  1QXZ A;  1JAW A;  4U6Z A;  5CIK A;  1C21 A;  2BWV A;  2GG5 A;  1Y1N A;  4FKC A;  1CHM A;  4QR8 A;  2ADU A;  2GG8 A;  4ZWO A;  1YW9 A;  2BHA A;  1C23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...