3TAVA

Crystal structure of a methionine aminopeptidase from mycobacterium abscessus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
264
structure length
264
Chain Sequence
VGLFGRKKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSFLGYHGFPASICSSVNDQVVHGIPSATAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAAEKQFDRAFGIVDGYGGHGIGRSMHLDPFLPNEGAPGKGPLLAVGSVLAIEPMLTLGTTQTRVLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 82
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3tavA00
2OAZA 3L7GA 2BB7A 1WY2A 3MR1A 4U69A 3S6BA 4A6VA 2BHCA 1KQ9A 4ZWPA 2NQ7A 4R60A 1W7VA 4U1BA 5JI6A 4MATA 1QXZA 2B3LA 2DFIA 3MX6A 4FO8A 2GU5A 5JFRA 2EA4A 4IKTA 2BH3A 2GG5A 4A6WA 2GG8A 2Q95A 2V3YA 4PNCA 1XGMA 1M35A 1Y1NA 2P9AA 4IKSA 1R58A 3CB6A 4U73A 4IKUA 3FM3A 4JUQA 2B3HA 1B6AA 5D6FA 1N51A 4S2RP 4U70A 1WN1A 2Q93A 3IU8A 4KM3A 1YW8A 2Q92A 5CDLA 3PKAA 1YVMA 2GGCA 2GZ5A 3RORA 4FLLA 1C21A 2Q94A 2BWWA 2B3KA 3BITA 1WL6A 1CHMA 4U6ZA 5D6EA 4HXXA 3TB5A 3FMQA 1C27A 2GU7A 2BN7A 3BIQA 1C22A 5FCHA 2GG2A 2GG7A 3FMRA 2GG9A 5CIKA 3PKCA 3IU9A 1BN5A 1B59A 2GGBA 2P98A 3L24A 4ZWOA 2GA2A 2GG0A 4IF7A 4QR8A 4S00A 4U6EA 2P99A 3TAVA 2BWYA 1XNZA 5CNXA 1WBQA 3Q6DA 2IW2A 3IU7A 2BWVA 1R5HA 4B28A 4OOKA 2GG3A 1QXYA 2GTXA 4RZYA 3CTZA 3PKEA 2Q96A 1JAWA 2BWUA 2MATA 2ZSGA 2V3ZA 3IG4A 3RVAA 1O0XA 4U71A 3BIPA 4FKCA 1C23A 4PV4A 4IU6A 5CE6A 4FLIA 1PV9A 1W2MA 5E5BA 2EVCA 3MATA 1YW9A 2EVOA 4RGZ1 1KQ0A 2ADUA 2BHDA 3D27A 2V3XA 1QZYA 1XGOA 1YW7A 2EA2A 2BWXA 2NQ6A 4S01A 1R5GA 2BHAA 4FLJA 2BWSA 1WL9A 4IDYA 4U75A 4U76A 5JHUA 1XGSA 4RZZA 3PKDA 4IKRA 4IECA 4U6WA 2GU4A 1WKMA 1XGNA 1C24A 1KP0A 4FUKA 2Q8KA 3PKBA 4Z7MA 1YJ3A 3CB5A 2BWTA 1MATA 2G6PA 2GU6A 5CLSA 2HOWA 2OKNA 4FLKA 2BHBA 1A16A 4FO7A 2EVMA 4S2TP 1WLRA 4EGEA 5FCFA 2V6CA 4ZNGA 4IPAA 5CDEA 4ZWUA 5CDVA 4U6JA 1BOAA 4U6CA 1QXWA
chains in the Genus database with same CATH superfamily
2OAZA 3L7GA 2BB7A 1WY2A 3MR1A 4U69A 3S6BA 4A6VA 2BHCA 1KQ9A 4ZWPA 2NQ7A 4R60A 1W7VA 4U1BA 5JI6A 4MATA 1QXZA 2B3LA 2DFIA 3MX6A 4FO8A 2GU5A 5JFRA 2EA4A 4IKTA 2BH3A 2GG5A 4A6WA 2GG8A 2Q95A 2V3YA 4PNCA 1XGMA 1M35A 1Y1NA 2P9AA 4IKSA 1R58A 3CB6A 4U73A 4IKUA 3FM3A 4JUQA 2B3HA 1B6AA 5D6FA 1N51A 4S2RP 4U70A 1WN1A 2Q93A 3IU8A 4KM3A 1YW8A 2Q92A 5CDLA 3PKAA 1YVMA 2GGCA 2GZ5A 3RORA 4FLLA 1C21A 2Q94A 2BWWA 2B3KA 3BITA 1WL6A 1CHMA 4U6ZA 5D6EA 4HXXA 3TB5A 3FMQA 1C27A 2GU7A 2BN7A 3BIQA 1C22A 5FCHA 2GG2A 2GG7A 3FMRA 2GG9A 5CIKA 3PKCA 3IU9A 1BN5A 1B59A 2GGBA 2P98A 3L24A 4ZWOA 2GA2A 2GG0A 4IF7A 4QR8A 4S00A 4U6EA 2P99A 3TAVA 2BWYA 1XNZA 5CNXA 1WBQA 3Q6DA 2IW2A 3IU7A 2BWVA 1R5HA 4B28A 4OOKA 2GG3A 1QXYA 2GTXA 4RZYA 3CTZA 3PKEA 2Q96A 1JAWA 2BWUA 2MATA 2ZSGA 2V3ZA 3IG4A 3RVAA 1O0XA 4U71A 3BIPA 4FKCA 1C23A 4PV4A 4IU6A 5CE6A 4FLIA 1PV9A 1W2MA 5E5BA 2EVCA 3MATA 1YW9A 2EVOA 4RGZ1 1KQ0A 2ADUA 2BHDA 3D27A 2V3XA 1QZYA 1XGOA 1YW7A 2EA2A 2BWXA 2NQ6A 4S01A 1R5GA 2BHAA 4FLJA 2BWSA 1WL9A 4IDYA 4U75A 4U76A 5JHUA 1XGSA 4RZZA 3PKDA 4IKRA 4IECA 4U6WA 2GU4A 1WKMA 1XGNA 1C24A 1KP0A 4FUKA 2Q8KA 3PKBA 4Z7MA 1YJ3A 3CB5A 2BWTA 1MATA 2G6PA 2GU6A 5CLSA 2HOWA 2OKNA 4FLKA 2BHBA 1A16A 4FO7A 2EVMA 4S2TP 1WLRA 4EGEA 5FCFA 2V6CA 4ZNGA 4IPAA 5CDEA 4ZWUA 5CDVA 4U6JA 1BOAA 4U6CA 1QXWA
chains in the Genus database with same CATH topology
2OAZA 3L7GA 2BB7A 1WY2A 3MR1A 4U69A 3S6BA 4A6VA 2BHCA 1KQ9A 4ZWPA 2NQ7A 4R60A 1W7VA 4U1BA 5JI6A 4MATA 1QXZA 2B3LA 2DFIA 3MX6A 4FO8A 2GU5A 5JFRA 2EA4A 4IKTA 2BH3A 2GG5A 4A6WA 2GG8A 2Q95A 2V3YA 4PNCA 1XGMA 1M35A 1Y1NA 2P9AA 4IKSA 1R58A 3CB6A 4U73A 4IKUA 3FM3A 4JUQA 2B3HA 1B6AA 5D6FA 1N51A 4S2RP 4U70A 1WN1A 2Q93A 3IU8A 4KM3A 1YW8A 2Q92A 5CDLA 3PKAA 1YVMA 2GGCA 2GZ5A 3RORA 4FLLA 1C21A 2Q94A 2BWWA 2B3KA 3BITA 1WL6A 1CHMA 4U6ZA 5D6EA 4HXXA 3TB5A 3FMQA 1C27A 2GU7A 2BN7A 3BIQA 1C22A 5FCHA 2GG2A 2GG7A 3FMRA 2GG9A 5CIKA 3PKCA 3IU9A 1BN5A 1B59A 2GGBA 2P98A 3L24A 4ZWOA 2GA2A 2GG0A 4IF7A 4QR8A 4S00A 4U6EA 2P99A 3TAVA 2BWYA 1XNZA 5CNXA 1WBQA 3Q6DA 2IW2A 3IU7A 2BWVA 1R5HA 4B28A 4OOKA 2GG3A 1QXYA 2GTXA 4RZYA 3CTZA 3PKEA 2Q96A 1JAWA 2BWUA 2MATA 2ZSGA 2V3ZA 3IG4A 3RVAA 1O0XA 4U71A 3BIPA 4FKCA 1C23A 4PV4A 4IU6A 5CE6A 4FLIA 1PV9A 1W2MA 5E5BA 2EVCA 3MATA 1YW9A 2EVOA 4RGZ1 1KQ0A 2ADUA 2BHDA 3D27A 2V3XA 1QZYA 1XGOA 1YW7A 2EA2A 2BWXA 2NQ6A 4S01A 1R5GA 2BHAA 4FLJA 2BWSA 1WL9A 4IDYA 4U75A 4U76A 5JHUA 1XGSA 4RZZA 3PKDA 4IKRA 4IECA 4U6WA 2GU4A 1WKMA 1XGNA 1C24A 1KP0A 4FUKA 2Q8KA 3PKBA 4Z7MA 1YJ3A 3CB5A 2BWTA 1MATA 2G6PA 2GU6A 5CLSA 2HOWA 2OKNA 4FLKA 2BHBA 1A16A 4FO7A 2EVMA 4S2TP 1WLRA 4EGEA 5FCFA 2V6CA 4ZNGA 4IPAA 5CDEA 4ZWUA 5CDVA 4U6JA 1BOAA 4U6CA 1QXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAZ A;  3L7G A;  2BB7 A;  1WY2 A;  3MR1 A;  4U69 A;  3S6B A;  4A6V A;  2BHC A;  1KQ9 A;  4ZWP A;  2NQ7 A;  4R60 A;  1W7V A;  4U1B A;  5JI6 A;  4MAT A;  1QXZ A;  2B3L A;  2DFI A;  3MX6 A;  4FO8 A;  2GU5 A;  5JFR A;  2EA4 A;  4IKT A;  2BH3 A;  2GG5 A;  4A6W A;  2GG8 A;  2Q95 A;  2V3Y A;  4PNC A;  1XGM A;  1M35 A;  1Y1N A;  2P9A A;  4IKS A;  1R58 A;  3CB6 A;  4U73 A;  4IKU A;  3FM3 A;  4JUQ A;  2B3H A;  1B6A A;  5D6F A;  1N51 A;  4S2R P;  4U70 A;  1WN1 A;  2Q93 A;  3IU8 A;  4KM3 A;  1YW8 A;  2Q92 A;  5CDL A;  3PKA A;  1YVM A;  2GGC A;  2GZ5 A;  3ROR A;  4FLL A;  1C21 A;  2Q94 A;  2BWW A;  2B3K A;  3BIT A;  1WL6 A;  1CHM A;  4U6Z A;  5D6E A;  4HXX A;  3TB5 A;  3FMQ A;  1C27 A;  2GU7 A;  2BN7 A;  3BIQ A;  1C22 A;  5FCH A;  2GG2 A;  2GG7 A;  3FMR A;  2GG9 A;  5CIK A;  3PKC A;  3IU9 A;  1BN5 A;  1B59 A;  2GGB A;  2P98 A;  3L24 A;  4ZWO A;  2GA2 A;  2GG0 A;  4IF7 A;  4QR8 A;  4S00 A;  4U6E A;  2P99 A;  3TAV A;  2BWY A;  1XNZ A;  5CNX A;  1WBQ A;  3Q6D A;  2IW2 A;  3IU7 A;  2BWV A;  1R5H A;  4B28 A;  4OOK A;  2GG3 A;  1QXY A;  2GTX A;  4RZY A;  3CTZ A;  3PKE A;  2Q96 A;  1JAW A;  2BWU A;  2MAT A;  2ZSG A;  2V3Z A;  3IG4 A;  3RVA A;  1O0X A;  4U71 A;  3BIP A;  4FKC A;  1C23 A;  4PV4 A;  4IU6 A;  5CE6 A;  4FLI A;  1PV9 A;  1W2M A;  5E5B A;  2EVC A;  3MAT A;  1YW9 A;  2EVO A;  4RGZ 1;  1KQ0 A;  2ADU A;  2BHD A;  3D27 A;  2V3X A;  1QZY A;  1XGO A;  1YW7 A;  2EA2 A;  2BWX A;  2NQ6 A;  4S01 A;  1R5G A;  2BHA A;  4FLJ A;  2BWS A;  1WL9 A;  4IDY A;  4U75 A;  4U76 A;  5JHU A;  1XGS A;  4RZZ A;  3PKD A;  4IKR A;  4IEC A;  4U6W A;  2GU4 A;  1WKM A;  1XGN A;  1C24 A;  1KP0 A;  4FUK A;  2Q8K A;  3PKB A;  4Z7M A;  1YJ3 A;  3CB5 A;  2BWT A;  1MAT A;  2G6P A;  2GU6 A;  5CLS A;  2HOW A;  2OKN A;  4FLK A;  2BHB A;  1A16 A;  4FO7 A;  2EVM A;  4S2T P;  1WLR A;  4EGE A;  5FCF A;  2V6C A;  4ZNG A;  4IPA A;  5CDE A;  4ZWU A;  5CDV A;  4U6J A;  1BOA A;  4U6C A;  1QXW A; 
#chains in the Genus database with same CATH topology
 2OAZ A;  3L7G A;  2BB7 A;  1WY2 A;  3MR1 A;  4U69 A;  3S6B A;  4A6V A;  2BHC A;  1KQ9 A;  4ZWP A;  2NQ7 A;  4R60 A;  1W7V A;  4U1B A;  5JI6 A;  4MAT A;  1QXZ A;  2B3L A;  2DFI A;  3MX6 A;  4FO8 A;  2GU5 A;  5JFR A;  2EA4 A;  4IKT A;  2BH3 A;  2GG5 A;  4A6W A;  2GG8 A;  2Q95 A;  2V3Y A;  4PNC A;  1XGM A;  1M35 A;  1Y1N A;  2P9A A;  4IKS A;  1R58 A;  3CB6 A;  4U73 A;  4IKU A;  3FM3 A;  4JUQ A;  2B3H A;  1B6A A;  5D6F A;  1N51 A;  4S2R P;  4U70 A;  1WN1 A;  2Q93 A;  3IU8 A;  4KM3 A;  1YW8 A;  2Q92 A;  5CDL A;  3PKA A;  1YVM A;  2GGC A;  2GZ5 A;  3ROR A;  4FLL A;  1C21 A;  2Q94 A;  2BWW A;  2B3K A;  3BIT A;  1WL6 A;  1CHM A;  4U6Z A;  5D6E A;  4HXX A;  3TB5 A;  3FMQ A;  1C27 A;  2GU7 A;  2BN7 A;  3BIQ A;  1C22 A;  5FCH A;  2GG2 A;  2GG7 A;  3FMR A;  2GG9 A;  5CIK A;  3PKC A;  3IU9 A;  1BN5 A;  1B59 A;  2GGB A;  2P98 A;  3L24 A;  4ZWO A;  2GA2 A;  2GG0 A;  4IF7 A;  4QR8 A;  4S00 A;  4U6E A;  2P99 A;  3TAV A;  2BWY A;  1XNZ A;  5CNX A;  1WBQ A;  3Q6D A;  2IW2 A;  3IU7 A;  2BWV A;  1R5H A;  4B28 A;  4OOK A;  2GG3 A;  1QXY A;  2GTX A;  4RZY A;  3CTZ A;  3PKE A;  2Q96 A;  1JAW A;  2BWU A;  2MAT A;  2ZSG A;  2V3Z A;  3IG4 A;  3RVA A;  1O0X A;  4U71 A;  3BIP A;  4FKC A;  1C23 A;  4PV4 A;  4IU6 A;  5CE6 A;  4FLI A;  1PV9 A;  1W2M A;  5E5B A;  2EVC A;  3MAT A;  1YW9 A;  2EVO A;  4RGZ 1;  1KQ0 A;  2ADU A;  2BHD A;  3D27 A;  2V3X A;  1QZY A;  1XGO A;  1YW7 A;  2EA2 A;  2BWX A;  2NQ6 A;  4S01 A;  1R5G A;  2BHA A;  4FLJ A;  2BWS A;  1WL9 A;  4IDY A;  4U75 A;  4U76 A;  5JHU A;  1XGS A;  4RZZ A;  3PKD A;  4IKR A;  4IEC A;  4U6W A;  2GU4 A;  1WKM A;  1XGN A;  1C24 A;  1KP0 A;  4FUK A;  2Q8K A;  3PKB A;  4Z7M A;  1YJ3 A;  3CB5 A;  2BWT A;  1MAT A;  2G6P A;  2GU6 A;  5CLS A;  2HOW A;  2OKN A;  4FLK A;  2BHB A;  1A16 A;  4FO7 A;  2EVM A;  4S2T P;  1WLR A;  4EGE A;  5FCF A;  2V6C A;  4ZNG A;  4IPA A;  5CDE A;  4ZWU A;  5CDV A;  4U6J A;  1BOA A;  4U6C A;  1QXW A; 
#chains in the Genus database with same CATH homology
 2OAZ A;  3L7G A;  2BB7 A;  1WY2 A;  3MR1 A;  4U69 A;  3S6B A;  4A6V A;  2BHC A;  1KQ9 A;  4ZWP A;  2NQ7 A;  4R60 A;  1W7V A;  4U1B A;  5JI6 A;  4MAT A;  1QXZ A;  2B3L A;  2DFI A;  3MX6 A;  4FO8 A;  2GU5 A;  5JFR A;  2EA4 A;  4IKT A;  2BH3 A;  2GG5 A;  4A6W A;  2GG8 A;  2Q95 A;  2V3Y A;  4PNC A;  1XGM A;  1M35 A;  1Y1N A;  2P9A A;  4IKS A;  1R58 A;  3CB6 A;  4U73 A;  4IKU A;  3FM3 A;  4JUQ A;  2B3H A;  1B6A A;  5D6F A;  1N51 A;  4S2R P;  4U70 A;  1WN1 A;  2Q93 A;  3IU8 A;  4KM3 A;  1YW8 A;  2Q92 A;  5CDL A;  3PKA A;  1YVM A;  2GGC A;  2GZ5 A;  3ROR A;  4FLL A;  1C21 A;  2Q94 A;  2BWW A;  2B3K A;  3BIT A;  1WL6 A;  1CHM A;  4U6Z A;  5D6E A;  4HXX A;  3TB5 A;  3FMQ A;  1C27 A;  2GU7 A;  2BN7 A;  3BIQ A;  1C22 A;  5FCH A;  2GG2 A;  2GG7 A;  3FMR A;  2GG9 A;  5CIK A;  3PKC A;  3IU9 A;  1BN5 A;  1B59 A;  2GGB A;  2P98 A;  3L24 A;  4ZWO A;  2GA2 A;  2GG0 A;  4IF7 A;  4QR8 A;  4S00 A;  4U6E A;  2P99 A;  3TAV A;  2BWY A;  1XNZ A;  5CNX A;  1WBQ A;  3Q6D A;  2IW2 A;  3IU7 A;  2BWV A;  1R5H A;  4B28 A;  4OOK A;  2GG3 A;  1QXY A;  2GTX A;  4RZY A;  3CTZ A;  3PKE A;  2Q96 A;  1JAW A;  2BWU A;  2MAT A;  2ZSG A;  2V3Z A;  3IG4 A;  3RVA A;  1O0X A;  4U71 A;  3BIP A;  4FKC A;  1C23 A;  4PV4 A;  4IU6 A;  5CE6 A;  4FLI A;  1PV9 A;  1W2M A;  5E5B A;  2EVC A;  3MAT A;  1YW9 A;  2EVO A;  4RGZ 1;  1KQ0 A;  2ADU A;  2BHD A;  3D27 A;  2V3X A;  1QZY A;  1XGO A;  1YW7 A;  2EA2 A;  2BWX A;  2NQ6 A;  4S01 A;  1R5G A;  2BHA A;  4FLJ A;  2BWS A;  1WL9 A;  4IDY A;  4U75 A;  4U76 A;  5JHU A;  1XGS A;  4RZZ A;  3PKD A;  4IKR A;  4IEC A;  4U6W A;  2GU4 A;  1WKM A;  1XGN A;  1C24 A;  1KP0 A;  4FUK A;  2Q8K A;  3PKB A;  4Z7M A;  1YJ3 A;  3CB5 A;  2BWT A;  1MAT A;  2G6P A;  2GU6 A;  5CLS A;  2HOW A;  2OKN A;  4FLK A;  2BHB A;  1A16 A;  4FO7 A;  2EVM A;  4S2T P;  1WLR A;  4EGE A;  5FCF A;  2V6C A;  4ZNG A;  4IPA A;  5CDE A;  4ZWU A;  5CDV A;  4U6J A;  1BOA A;  4U6C A;  1QXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...