4A6VA

X-ray structures of oxazole hydroxamate ecmetap-mn complexes
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 86
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4a6vA00
2GGBA 4FKCA 4FUKA 1WKMA 2EVOA 1KQ0A 4RZYA 1B59A 3PKCA 2BHDA 1Y1NA 3PKBA 2OAZA 3TAVA 2V3ZA 2BB7A 5CDEA 1YW9A 4IKTA 1QXWA 2NQ6A 4U1BA 4JUQA 4FLKA 4EGEA 2BWUA 1YW8A 3Q6DA 2P99A 1YJ3A 4ZWOA 3PKAA 4A6VA 3MATA 2BWTA 3IG4A 4RGZ1 4IF7A 2DFIA 4IDYA 2V3YA 2NQ7A 4Z7MA 5CE6A 5JI6A 5CNXA 2BWXA 3D27A 3PKDA 4PNCA 3CTZA 4U6CA 3FMQA 2GU6A 1C27A 1XGOA 1B6AA 2ZSGA 2OKNA 1QZYA 5JHUA 2BN7A 2EVMA 4ZNGA 2EA4A 1C22A 2GU4A 2V3XA 4IPAA 5D6EA 3BITA 3CB5A 3RVAA 3IU7A 1YW7A 2BH3A 2GG5A 5FCHA 2BHBA 1WBQA 4IKSA 1QXYA 1WL6A 2GG8A 1YVMA 4S01A 2EA2A 2GA2A 1WL9A 2GG0A 2GTXA 2V6CA 5D6FA 1XGMA 2GU5A 4FLJA 4IU6A 5CDVA 4U70A 4U6JA 4U6ZA 2B3LA 2Q8KA 2G6PA 2BHCA 2BWWA 4U69A 4IKUA 1C21A 1XNZA 3L24A 1QXZA 4FO8A 4U75A 4FLIA 5CIKA 2Q96A 3CB6A 3L7GA 2ADUA 3FMRA 4A6WA 1C23A 1R5HA 2Q92A 3TB5A 4B28A 4IKRA 2GGCA 4U76A 2GG3A 2Q93A 2MATA 4FLLA 2Q95A 5FCFA 2BWVA 2Q94A 1MATA 2BHAA 4RZZA 1C24A 4MATA 3IU8A 5E5BA 2GG9A 5CDLA 4FO7A 1N51A 4S2RP 1WLRA 1W2MA 1M35A 4U71A 1XGNA 5JFRA 4U6EA 2BWSA 1O0XA 2B3HA 2IW2A 1BOAA 1R58A 2EVCA 2GG7A 3FM3A 4S00A 4U73A 1BN5A 1XGSA 2B3KA 3BIQA 4KM3A 2GG2A 4HXXA 3S6BA 1WY2A 1A16A 3MR1A 4ZWPA 3RORA 1R5GA 1WN1A 2HOWA 2P98A 3IU9A 4QR8A 5CLSA 1W7VA 2P9AA 1KP0A 4IECA 4OOKA 4S2TP 3BIPA 3MX6A 1PV9A 3PKEA 4PV4A 2GU7A 4ZWUA 4R60A 4U6WA 2BWYA 1JAWA 2GZ5A 1CHMA 1KQ9A
chains in the Genus database with same CATH superfamily
2GGBA 4FKCA 4FUKA 1WKMA 2EVOA 1KQ0A 4RZYA 1B59A 3PKCA 2BHDA 1Y1NA 3PKBA 2OAZA 3TAVA 2V3ZA 2BB7A 5CDEA 1YW9A 4IKTA 1QXWA 2NQ6A 4U1BA 4JUQA 4FLKA 4EGEA 2BWUA 1YW8A 3Q6DA 2P99A 1YJ3A 4ZWOA 3PKAA 4A6VA 3MATA 2BWTA 3IG4A 4RGZ1 4IF7A 2DFIA 4IDYA 2V3YA 2NQ7A 4Z7MA 5CE6A 5JI6A 5CNXA 2BWXA 3D27A 3PKDA 4PNCA 3CTZA 4U6CA 3FMQA 2GU6A 1C27A 1XGOA 1B6AA 2ZSGA 2OKNA 1QZYA 5JHUA 2BN7A 2EVMA 4ZNGA 2EA4A 1C22A 2GU4A 2V3XA 4IPAA 5D6EA 3BITA 3CB5A 3RVAA 3IU7A 1YW7A 2BH3A 2GG5A 5FCHA 2BHBA 1WBQA 4IKSA 1QXYA 1WL6A 2GG8A 1YVMA 4S01A 2EA2A 2GA2A 1WL9A 2GG0A 2GTXA 2V6CA 5D6FA 1XGMA 2GU5A 4FLJA 4IU6A 5CDVA 4U70A 4U6JA 4U6ZA 2B3LA 2Q8KA 2G6PA 2BHCA 2BWWA 4U69A 4IKUA 1C21A 1XNZA 3L24A 1QXZA 4FO8A 4U75A 4FLIA 5CIKA 2Q96A 3CB6A 3L7GA 2ADUA 3FMRA 4A6WA 1C23A 1R5HA 2Q92A 3TB5A 4B28A 4IKRA 2GGCA 4U76A 2GG3A 2Q93A 2MATA 4FLLA 2Q95A 5FCFA 2BWVA 2Q94A 1MATA 2BHAA 4RZZA 1C24A 4MATA 3IU8A 5E5BA 2GG9A 5CDLA 4FO7A 1N51A 4S2RP 1WLRA 1W2MA 1M35A 4U71A 1XGNA 5JFRA 4U6EA 2BWSA 1O0XA 2B3HA 2IW2A 1BOAA 1R58A 2EVCA 2GG7A 3FM3A 4S00A 4U73A 1BN5A 1XGSA 2B3KA 3BIQA 4KM3A 2GG2A 4HXXA 3S6BA 1WY2A 1A16A 3MR1A 4ZWPA 3RORA 1R5GA 1WN1A 2HOWA 2P98A 3IU9A 4QR8A 5CLSA 1W7VA 2P9AA 1KP0A 4IECA 4OOKA 4S2TP 3BIPA 3MX6A 1PV9A 3PKEA 4PV4A 2GU7A 4ZWUA 4R60A 4U6WA 2BWYA 1JAWA 2GZ5A 1CHMA 1KQ9A
chains in the Genus database with same CATH topology
2GGBA 4FKCA 4FUKA 1WKMA 2EVOA 1KQ0A 4RZYA 1B59A 3PKCA 2BHDA 1Y1NA 3PKBA 2OAZA 3TAVA 2V3ZA 2BB7A 5CDEA 1YW9A 4IKTA 1QXWA 2NQ6A 4U1BA 4JUQA 4FLKA 4EGEA 2BWUA 1YW8A 3Q6DA 2P99A 1YJ3A 4ZWOA 3PKAA 4A6VA 3MATA 2BWTA 3IG4A 4RGZ1 4IF7A 2DFIA 4IDYA 2V3YA 2NQ7A 4Z7MA 5CE6A 5JI6A 5CNXA 2BWXA 3D27A 3PKDA 4PNCA 3CTZA 4U6CA 3FMQA 2GU6A 1C27A 1XGOA 1B6AA 2ZSGA 2OKNA 1QZYA 5JHUA 2BN7A 2EVMA 4ZNGA 2EA4A 1C22A 2GU4A 2V3XA 4IPAA 5D6EA 3BITA 3CB5A 3RVAA 3IU7A 1YW7A 2BH3A 2GG5A 5FCHA 2BHBA 1WBQA 4IKSA 1QXYA 1WL6A 2GG8A 1YVMA 4S01A 2EA2A 2GA2A 1WL9A 2GG0A 2GTXA 2V6CA 5D6FA 1XGMA 2GU5A 4FLJA 4IU6A 5CDVA 4U70A 4U6JA 4U6ZA 2B3LA 2Q8KA 2G6PA 2BHCA 2BWWA 4U69A 4IKUA 1C21A 1XNZA 3L24A 1QXZA 4FO8A 4U75A 4FLIA 5CIKA 2Q96A 3CB6A 3L7GA 2ADUA 3FMRA 4A6WA 1C23A 1R5HA 2Q92A 3TB5A 4B28A 4IKRA 2GGCA 4U76A 2GG3A 2Q93A 2MATA 4FLLA 2Q95A 5FCFA 2BWVA 2Q94A 1MATA 2BHAA 4RZZA 1C24A 4MATA 3IU8A 5E5BA 2GG9A 5CDLA 4FO7A 1N51A 4S2RP 1WLRA 1W2MA 1M35A 4U71A 1XGNA 5JFRA 4U6EA 2BWSA 1O0XA 2B3HA 2IW2A 1BOAA 1R58A 2EVCA 2GG7A 3FM3A 4S00A 4U73A 1BN5A 1XGSA 2B3KA 3BIQA 4KM3A 2GG2A 4HXXA 3S6BA 1WY2A 1A16A 3MR1A 4ZWPA 3RORA 1R5GA 1WN1A 2HOWA 2P98A 3IU9A 4QR8A 5CLSA 1W7VA 2P9AA 1KP0A 4IECA 4OOKA 4S2TP 3BIPA 3MX6A 1PV9A 3PKEA 4PV4A 2GU7A 4ZWUA 4R60A 4U6WA 2BWYA 1JAWA 2GZ5A 1CHMA 1KQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGB A;  4FKC A;  4FUK A;  1WKM A;  2EVO A;  1KQ0 A;  4RZY A;  1B59 A;  3PKC A;  2BHD A;  1Y1N A;  3PKB A;  2OAZ A;  3TAV A;  2V3Z A;  2BB7 A;  5CDE A;  1YW9 A;  4IKT A;  1QXW A;  2NQ6 A;  4U1B A;  4JUQ A;  4FLK A;  4EGE A;  2BWU A;  1YW8 A;  3Q6D A;  2P99 A;  1YJ3 A;  4ZWO A;  3PKA A;  4A6V A;  3MAT A;  2BWT A;  3IG4 A;  4RGZ 1;  4IF7 A;  2DFI A;  4IDY A;  2V3Y A;  2NQ7 A;  4Z7M A;  5CE6 A;  5JI6 A;  5CNX A;  2BWX A;  3D27 A;  3PKD A;  4PNC A;  3CTZ A;  4U6C A;  3FMQ A;  2GU6 A;  1C27 A;  1XGO A;  1B6A A;  2ZSG A;  2OKN A;  1QZY A;  5JHU A;  2BN7 A;  2EVM A;  4ZNG A;  2EA4 A;  1C22 A;  2GU4 A;  2V3X A;  4IPA A;  5D6E A;  3BIT A;  3CB5 A;  3RVA A;  3IU7 A;  1YW7 A;  2BH3 A;  2GG5 A;  5FCH A;  2BHB A;  1WBQ A;  4IKS A;  1QXY A;  1WL6 A;  2GG8 A;  1YVM A;  4S01 A;  2EA2 A;  2GA2 A;  1WL9 A;  2GG0 A;  2GTX A;  2V6C A;  5D6F A;  1XGM A;  2GU5 A;  4FLJ A;  4IU6 A;  5CDV A;  4U70 A;  4U6J A;  4U6Z A;  2B3L A;  2Q8K A;  2G6P A;  2BHC A;  2BWW A;  4U69 A;  4IKU A;  1C21 A;  1XNZ A;  3L24 A;  1QXZ A;  4FO8 A;  4U75 A;  4FLI A;  5CIK A;  2Q96 A;  3CB6 A;  3L7G A;  2ADU A;  3FMR A;  4A6W A;  1C23 A;  1R5H A;  2Q92 A;  3TB5 A;  4B28 A;  4IKR A;  2GGC A;  4U76 A;  2GG3 A;  2Q93 A;  2MAT A;  4FLL A;  2Q95 A;  5FCF A;  2BWV A;  2Q94 A;  1MAT A;  2BHA A;  4RZZ A;  1C24 A;  4MAT A;  3IU8 A;  5E5B A;  2GG9 A;  5CDL A;  4FO7 A;  1N51 A;  4S2R P;  1WLR A;  1W2M A;  1M35 A;  4U71 A;  1XGN A;  5JFR A;  4U6E A;  2BWS A;  1O0X A;  2B3H A;  2IW2 A;  1BOA A;  1R58 A;  2EVC A;  2GG7 A;  3FM3 A;  4S00 A;  4U73 A;  1BN5 A;  1XGS A;  2B3K A;  3BIQ A;  4KM3 A;  2GG2 A;  4HXX A;  3S6B A;  1WY2 A;  1A16 A;  3MR1 A;  4ZWP A;  3ROR A;  1R5G A;  1WN1 A;  2HOW A;  2P98 A;  3IU9 A;  4QR8 A;  5CLS A;  1W7V A;  2P9A A;  1KP0 A;  4IEC A;  4OOK A;  4S2T P;  3BIP A;  3MX6 A;  1PV9 A;  3PKE A;  4PV4 A;  2GU7 A;  4ZWU A;  4R60 A;  4U6W A;  2BWY A;  1JAW A;  2GZ5 A;  1CHM A;  1KQ9 A; 
#chains in the Genus database with same CATH topology
 2GGB A;  4FKC A;  4FUK A;  1WKM A;  2EVO A;  1KQ0 A;  4RZY A;  1B59 A;  3PKC A;  2BHD A;  1Y1N A;  3PKB A;  2OAZ A;  3TAV A;  2V3Z A;  2BB7 A;  5CDE A;  1YW9 A;  4IKT A;  1QXW A;  2NQ6 A;  4U1B A;  4JUQ A;  4FLK A;  4EGE A;  2BWU A;  1YW8 A;  3Q6D A;  2P99 A;  1YJ3 A;  4ZWO A;  3PKA A;  4A6V A;  3MAT A;  2BWT A;  3IG4 A;  4RGZ 1;  4IF7 A;  2DFI A;  4IDY A;  2V3Y A;  2NQ7 A;  4Z7M A;  5CE6 A;  5JI6 A;  5CNX A;  2BWX A;  3D27 A;  3PKD A;  4PNC A;  3CTZ A;  4U6C A;  3FMQ A;  2GU6 A;  1C27 A;  1XGO A;  1B6A A;  2ZSG A;  2OKN A;  1QZY A;  5JHU A;  2BN7 A;  2EVM A;  4ZNG A;  2EA4 A;  1C22 A;  2GU4 A;  2V3X A;  4IPA A;  5D6E A;  3BIT A;  3CB5 A;  3RVA A;  3IU7 A;  1YW7 A;  2BH3 A;  2GG5 A;  5FCH A;  2BHB A;  1WBQ A;  4IKS A;  1QXY A;  1WL6 A;  2GG8 A;  1YVM A;  4S01 A;  2EA2 A;  2GA2 A;  1WL9 A;  2GG0 A;  2GTX A;  2V6C A;  5D6F A;  1XGM A;  2GU5 A;  4FLJ A;  4IU6 A;  5CDV A;  4U70 A;  4U6J A;  4U6Z A;  2B3L A;  2Q8K A;  2G6P A;  2BHC A;  2BWW A;  4U69 A;  4IKU A;  1C21 A;  1XNZ A;  3L24 A;  1QXZ A;  4FO8 A;  4U75 A;  4FLI A;  5CIK A;  2Q96 A;  3CB6 A;  3L7G A;  2ADU A;  3FMR A;  4A6W A;  1C23 A;  1R5H A;  2Q92 A;  3TB5 A;  4B28 A;  4IKR A;  2GGC A;  4U76 A;  2GG3 A;  2Q93 A;  2MAT A;  4FLL A;  2Q95 A;  5FCF A;  2BWV A;  2Q94 A;  1MAT A;  2BHA A;  4RZZ A;  1C24 A;  4MAT A;  3IU8 A;  5E5B A;  2GG9 A;  5CDL A;  4FO7 A;  1N51 A;  4S2R P;  1WLR A;  1W2M A;  1M35 A;  4U71 A;  1XGN A;  5JFR A;  4U6E A;  2BWS A;  1O0X A;  2B3H A;  2IW2 A;  1BOA A;  1R58 A;  2EVC A;  2GG7 A;  3FM3 A;  4S00 A;  4U73 A;  1BN5 A;  1XGS A;  2B3K A;  3BIQ A;  4KM3 A;  2GG2 A;  4HXX A;  3S6B A;  1WY2 A;  1A16 A;  3MR1 A;  4ZWP A;  3ROR A;  1R5G A;  1WN1 A;  2HOW A;  2P98 A;  3IU9 A;  4QR8 A;  5CLS A;  1W7V A;  2P9A A;  1KP0 A;  4IEC A;  4OOK A;  4S2T P;  3BIP A;  3MX6 A;  1PV9 A;  3PKE A;  4PV4 A;  2GU7 A;  4ZWU A;  4R60 A;  4U6W A;  2BWY A;  1JAW A;  2GZ5 A;  1CHM A;  1KQ9 A; 
#chains in the Genus database with same CATH homology
 2GGB A;  4FKC A;  4FUK A;  1WKM A;  2EVO A;  1KQ0 A;  4RZY A;  1B59 A;  3PKC A;  2BHD A;  1Y1N A;  3PKB A;  2OAZ A;  3TAV A;  2V3Z A;  2BB7 A;  5CDE A;  1YW9 A;  4IKT A;  1QXW A;  2NQ6 A;  4U1B A;  4JUQ A;  4FLK A;  4EGE A;  2BWU A;  1YW8 A;  3Q6D A;  2P99 A;  1YJ3 A;  4ZWO A;  3PKA A;  4A6V A;  3MAT A;  2BWT A;  3IG4 A;  4RGZ 1;  4IF7 A;  2DFI A;  4IDY A;  2V3Y A;  2NQ7 A;  4Z7M A;  5CE6 A;  5JI6 A;  5CNX A;  2BWX A;  3D27 A;  3PKD A;  4PNC A;  3CTZ A;  4U6C A;  3FMQ A;  2GU6 A;  1C27 A;  1XGO A;  1B6A A;  2ZSG A;  2OKN A;  1QZY A;  5JHU A;  2BN7 A;  2EVM A;  4ZNG A;  2EA4 A;  1C22 A;  2GU4 A;  2V3X A;  4IPA A;  5D6E A;  3BIT A;  3CB5 A;  3RVA A;  3IU7 A;  1YW7 A;  2BH3 A;  2GG5 A;  5FCH A;  2BHB A;  1WBQ A;  4IKS A;  1QXY A;  1WL6 A;  2GG8 A;  1YVM A;  4S01 A;  2EA2 A;  2GA2 A;  1WL9 A;  2GG0 A;  2GTX A;  2V6C A;  5D6F A;  1XGM A;  2GU5 A;  4FLJ A;  4IU6 A;  5CDV A;  4U70 A;  4U6J A;  4U6Z A;  2B3L A;  2Q8K A;  2G6P A;  2BHC A;  2BWW A;  4U69 A;  4IKU A;  1C21 A;  1XNZ A;  3L24 A;  1QXZ A;  4FO8 A;  4U75 A;  4FLI A;  5CIK A;  2Q96 A;  3CB6 A;  3L7G A;  2ADU A;  3FMR A;  4A6W A;  1C23 A;  1R5H A;  2Q92 A;  3TB5 A;  4B28 A;  4IKR A;  2GGC A;  4U76 A;  2GG3 A;  2Q93 A;  2MAT A;  4FLL A;  2Q95 A;  5FCF A;  2BWV A;  2Q94 A;  1MAT A;  2BHA A;  4RZZ A;  1C24 A;  4MAT A;  3IU8 A;  5E5B A;  2GG9 A;  5CDL A;  4FO7 A;  1N51 A;  4S2R P;  1WLR A;  1W2M A;  1M35 A;  4U71 A;  1XGN A;  5JFR A;  4U6E A;  2BWS A;  1O0X A;  2B3H A;  2IW2 A;  1BOA A;  1R58 A;  2EVC A;  2GG7 A;  3FM3 A;  4S00 A;  4U73 A;  1BN5 A;  1XGS A;  2B3K A;  3BIQ A;  4KM3 A;  2GG2 A;  4HXX A;  3S6B A;  1WY2 A;  1A16 A;  3MR1 A;  4ZWP A;  3ROR A;  1R5G A;  1WN1 A;  2HOW A;  2P98 A;  3IU9 A;  4QR8 A;  5CLS A;  1W7V A;  2P9A A;  1KP0 A;  4IEC A;  4OOK A;  4S2T P;  3BIP A;  3MX6 A;  1PV9 A;  3PKE A;  4PV4 A;  2GU7 A;  4ZWU A;  4R60 A;  4U6W A;  2BWY A;  1JAW A;  2GZ5 A;  1CHM A;  1KQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...