4A6WA

X-ray structures of oxazole hydroxamate ecmetap-mn complexes
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydroxamic Acids as Potent Inhibitors of Fe(II) and Mn(II) E. Coli Methionine Aminopeptidase: Biological Activities and X-Ray Structures of Oxazole Hydroxamate-Ecmetap-Mn Complexes.
pubmed doi rcsb
molecule tags Transferase
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 83
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4a6wA00
1YJ3A 3CB5A 4U76A 1CHMA 2V6CA 4ZWOA 4U1BA 4QR8A 2Q94A 1C21A 4U70A 3PKDA 1QZYA 5CDEA 2B3KA 2Q96A 3CTZA 4IKSA 1W7VA 4U69A 4U6WA 4U6EA 2BWUA 2GG8A 4IKRA 1WLRA 1QXYA 2P99A 1QXWA 2ADUA 3PKAA 4FLJA 1R5GA 5E5BA 2BH3A 2GG5A 4S2RP 2GU6A 1YVMA 3RORA 4B28A 2GG9A 3TAVA 3MR1A 2B3HA 4U73A 1JAWA 4FKCA 1C24A 2GG0A 2ZSGA 4ZWUA 3PKEA 3RVAA 5D6FA 2B3LA 2BWVA 2V3ZA 3FM3A 3IG4A 1C23A 2BWSA 1A16A 4ZWPA 2BWYA 1N51A 4A6VA 1YW9A 2V3XA 1BOAA 2EVOA 4PNCA 5FCHA 5CNXA 1C27A 3FMRA 4U71A 4S01A 4A6WA 2EVMA 2GGBA 4OOKA 1XGSA 2GGCA 2P9AA 4ZNGA 4RZZA 2GZ5A 4JUQA 2G6PA 4KM3A 1WBQA 4IKTA 3IU8A 2IW2A 3MX6A 2GA2A 3BIQA 3FMQA 1KQ0A 5CLSA 2Q8KA 4RZYA 4IU6A 2GU5A 4U6ZA 5CDVA 1XGMA 3PKBA 1M35A 2BWTA 1B6AA 4FO8A 1BN5A 2OAZA 2EA2A 2Q93A 4IKUA 4Z7MA 1WKMA 3IU9A 2GU7A 4U6JA 2BB7A 5JI6A 3BITA 2P98A 3L7GA 3PKCA 2BHDA 4S2TP 1R58A 3L24A 2GG2A 4FO7A 4FUKA 4FLLA 1MATA 3D27A 2EVCA 5JHUA 4R60A 4U75A 5CE6A 1WL9A 2GG7A 2GTXA 2GG3A 2NQ6A 2OKNA 4FLIA 3BIPA 2BWWA 2DFIA 2BHCA 3CB6A 5CDLA 4IF7A 4HXXA 1WL6A 1KP0A 2HOWA 4PV4A 4MATA 1B59A 3TB5A 2GU4A 4IDYA 1KQ9A 1WY2A 4FLKA 2MATA 5FCFA 3IU7A 1YW7A 4IPAA 4RGZ1 1XGNA 4IECA 1Y1NA 2V3YA 4EGEA 2BHAA 4S00A 1WN1A 2BN7A 2EA4A 1YW8A 4U6CA 5JFRA 2NQ7A 5D6EA 1O0XA 1XGOA 1PV9A 3MATA 3S6BA 3Q6DA 1XNZA 1QXZA 1C22A 2Q95A 1W2MA 5CIKA 2Q92A 2BWXA 1R5HA 2BHBA
chains in the Genus database with same CATH superfamily
1YJ3A 3CB5A 4U76A 1CHMA 2V6CA 4ZWOA 4U1BA 4QR8A 2Q94A 1C21A 4U70A 3PKDA 1QZYA 5CDEA 2B3KA 2Q96A 3CTZA 4IKSA 1W7VA 4U69A 4U6WA 4U6EA 2BWUA 2GG8A 4IKRA 1WLRA 1QXYA 2P99A 1QXWA 2ADUA 3PKAA 4FLJA 1R5GA 5E5BA 2BH3A 2GG5A 4S2RP 2GU6A 1YVMA 3RORA 4B28A 2GG9A 3TAVA 3MR1A 2B3HA 4U73A 1JAWA 4FKCA 1C24A 2GG0A 2ZSGA 4ZWUA 3PKEA 3RVAA 5D6FA 2B3LA 2BWVA 2V3ZA 3FM3A 3IG4A 1C23A 2BWSA 1A16A 4ZWPA 2BWYA 1N51A 4A6VA 1YW9A 2V3XA 1BOAA 2EVOA 4PNCA 5FCHA 5CNXA 1C27A 3FMRA 4U71A 4S01A 4A6WA 2EVMA 2GGBA 4OOKA 1XGSA 2GGCA 2P9AA 4ZNGA 4RZZA 2GZ5A 4JUQA 2G6PA 4KM3A 1WBQA 4IKTA 3IU8A 2IW2A 3MX6A 2GA2A 3BIQA 3FMQA 1KQ0A 5CLSA 2Q8KA 4RZYA 4IU6A 2GU5A 4U6ZA 5CDVA 1XGMA 3PKBA 1M35A 2BWTA 1B6AA 4FO8A 1BN5A 2OAZA 2EA2A 2Q93A 4IKUA 4Z7MA 1WKMA 3IU9A 2GU7A 4U6JA 2BB7A 5JI6A 3BITA 2P98A 3L7GA 3PKCA 2BHDA 4S2TP 1R58A 3L24A 2GG2A 4FO7A 4FUKA 4FLLA 1MATA 3D27A 2EVCA 5JHUA 4R60A 4U75A 5CE6A 1WL9A 2GG7A 2GTXA 2GG3A 2NQ6A 2OKNA 4FLIA 3BIPA 2BWWA 2DFIA 2BHCA 3CB6A 5CDLA 4IF7A 4HXXA 1WL6A 1KP0A 2HOWA 4PV4A 4MATA 1B59A 3TB5A 2GU4A 4IDYA 1KQ9A 1WY2A 4FLKA 2MATA 5FCFA 3IU7A 1YW7A 4IPAA 4RGZ1 1XGNA 4IECA 1Y1NA 2V3YA 4EGEA 2BHAA 4S00A 1WN1A 2BN7A 2EA4A 1YW8A 4U6CA 5JFRA 2NQ7A 5D6EA 1O0XA 1XGOA 1PV9A 3MATA 3S6BA 3Q6DA 1XNZA 1QXZA 1C22A 2Q95A 1W2MA 5CIKA 2Q92A 2BWXA 1R5HA 2BHBA
chains in the Genus database with same CATH topology
1YJ3A 3CB5A 4U76A 1CHMA 2V6CA 4ZWOA 4U1BA 4QR8A 2Q94A 1C21A 4U70A 3PKDA 1QZYA 5CDEA 2B3KA 2Q96A 3CTZA 4IKSA 1W7VA 4U69A 4U6WA 4U6EA 2BWUA 2GG8A 4IKRA 1WLRA 1QXYA 2P99A 1QXWA 2ADUA 3PKAA 4FLJA 1R5GA 5E5BA 2BH3A 2GG5A 4S2RP 2GU6A 1YVMA 3RORA 4B28A 2GG9A 3TAVA 3MR1A 2B3HA 4U73A 1JAWA 4FKCA 1C24A 2GG0A 2ZSGA 4ZWUA 3PKEA 3RVAA 5D6FA 2B3LA 2BWVA 2V3ZA 3FM3A 3IG4A 1C23A 2BWSA 1A16A 4ZWPA 2BWYA 1N51A 4A6VA 1YW9A 2V3XA 1BOAA 2EVOA 4PNCA 5FCHA 5CNXA 1C27A 3FMRA 4U71A 4S01A 4A6WA 2EVMA 2GGBA 4OOKA 1XGSA 2GGCA 2P9AA 4ZNGA 4RZZA 2GZ5A 4JUQA 2G6PA 4KM3A 1WBQA 4IKTA 3IU8A 2IW2A 3MX6A 2GA2A 3BIQA 3FMQA 1KQ0A 5CLSA 2Q8KA 4RZYA 4IU6A 2GU5A 4U6ZA 5CDVA 1XGMA 3PKBA 1M35A 2BWTA 1B6AA 4FO8A 1BN5A 2OAZA 2EA2A 2Q93A 4IKUA 4Z7MA 1WKMA 3IU9A 2GU7A 4U6JA 2BB7A 5JI6A 3BITA 2P98A 3L7GA 3PKCA 2BHDA 4S2TP 1R58A 3L24A 2GG2A 4FO7A 4FUKA 4FLLA 1MATA 3D27A 2EVCA 5JHUA 4R60A 4U75A 5CE6A 1WL9A 2GG7A 2GTXA 2GG3A 2NQ6A 2OKNA 4FLIA 3BIPA 2BWWA 2DFIA 2BHCA 3CB6A 5CDLA 4IF7A 4HXXA 1WL6A 1KP0A 2HOWA 4PV4A 4MATA 1B59A 3TB5A 2GU4A 4IDYA 1KQ9A 1WY2A 4FLKA 2MATA 5FCFA 3IU7A 1YW7A 4IPAA 4RGZ1 1XGNA 4IECA 1Y1NA 2V3YA 4EGEA 2BHAA 4S00A 1WN1A 2BN7A 2EA4A 1YW8A 4U6CA 5JFRA 2NQ7A 5D6EA 1O0XA 1XGOA 1PV9A 3MATA 3S6BA 3Q6DA 1XNZA 1QXZA 1C22A 2Q95A 1W2MA 5CIKA 2Q92A 2BWXA 1R5HA 2BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ3 A;  3CB5 A;  4U76 A;  1CHM A;  2V6C A;  4ZWO A;  4U1B A;  4QR8 A;  2Q94 A;  1C21 A;  4U70 A;  3PKD A;  1QZY A;  5CDE A;  2B3K A;  2Q96 A;  3CTZ A;  4IKS A;  1W7V A;  4U69 A;  4U6W A;  4U6E A;  2BWU A;  2GG8 A;  4IKR A;  1WLR A;  1QXY A;  2P99 A;  1QXW A;  2ADU A;  3PKA A;  4FLJ A;  1R5G A;  5E5B A;  2BH3 A;  2GG5 A;  4S2R P;  2GU6 A;  1YVM A;  3ROR A;  4B28 A;  2GG9 A;  3TAV A;  3MR1 A;  2B3H A;  4U73 A;  1JAW A;  4FKC A;  1C24 A;  2GG0 A;  2ZSG A;  4ZWU A;  3PKE A;  3RVA A;  5D6F A;  2B3L A;  2BWV A;  2V3Z A;  3FM3 A;  3IG4 A;  1C23 A;  2BWS A;  1A16 A;  4ZWP A;  2BWY A;  1N51 A;  4A6V A;  1YW9 A;  2V3X A;  1BOA A;  2EVO A;  4PNC A;  5FCH A;  5CNX A;  1C27 A;  3FMR A;  4U71 A;  4S01 A;  4A6W A;  2EVM A;  2GGB A;  4OOK A;  1XGS A;  2GGC A;  2P9A A;  4ZNG A;  4RZZ A;  2GZ5 A;  4JUQ A;  2G6P A;  4KM3 A;  1WBQ A;  4IKT A;  3IU8 A;  2IW2 A;  3MX6 A;  2GA2 A;  3BIQ A;  3FMQ A;  1KQ0 A;  5CLS A;  2Q8K A;  4RZY A;  4IU6 A;  2GU5 A;  4U6Z A;  5CDV A;  1XGM A;  3PKB A;  1M35 A;  2BWT A;  1B6A A;  4FO8 A;  1BN5 A;  2OAZ A;  2EA2 A;  2Q93 A;  4IKU A;  4Z7M A;  1WKM A;  3IU9 A;  2GU7 A;  4U6J A;  2BB7 A;  5JI6 A;  3BIT A;  2P98 A;  3L7G A;  3PKC A;  2BHD A;  4S2T P;  1R58 A;  3L24 A;  2GG2 A;  4FO7 A;  4FUK A;  4FLL A;  1MAT A;  3D27 A;  2EVC A;  5JHU A;  4R60 A;  4U75 A;  5CE6 A;  1WL9 A;  2GG7 A;  2GTX A;  2GG3 A;  2NQ6 A;  2OKN A;  4FLI A;  3BIP A;  2BWW A;  2DFI A;  2BHC A;  3CB6 A;  5CDL A;  4IF7 A;  4HXX A;  1WL6 A;  1KP0 A;  2HOW A;  4PV4 A;  4MAT A;  1B59 A;  3TB5 A;  2GU4 A;  4IDY A;  1KQ9 A;  1WY2 A;  4FLK A;  2MAT A;  5FCF A;  3IU7 A;  1YW7 A;  4IPA A;  4RGZ 1;  1XGN A;  4IEC A;  1Y1N A;  2V3Y A;  4EGE A;  2BHA A;  4S00 A;  1WN1 A;  2BN7 A;  2EA4 A;  1YW8 A;  4U6C A;  5JFR A;  2NQ7 A;  5D6E A;  1O0X A;  1XGO A;  1PV9 A;  3MAT A;  3S6B A;  3Q6D A;  1XNZ A;  1QXZ A;  1C22 A;  2Q95 A;  1W2M A;  5CIK A;  2Q92 A;  2BWX A;  1R5H A;  2BHB A; 
#chains in the Genus database with same CATH topology
 1YJ3 A;  3CB5 A;  4U76 A;  1CHM A;  2V6C A;  4ZWO A;  4U1B A;  4QR8 A;  2Q94 A;  1C21 A;  4U70 A;  3PKD A;  1QZY A;  5CDE A;  2B3K A;  2Q96 A;  3CTZ A;  4IKS A;  1W7V A;  4U69 A;  4U6W A;  4U6E A;  2BWU A;  2GG8 A;  4IKR A;  1WLR A;  1QXY A;  2P99 A;  1QXW A;  2ADU A;  3PKA A;  4FLJ A;  1R5G A;  5E5B A;  2BH3 A;  2GG5 A;  4S2R P;  2GU6 A;  1YVM A;  3ROR A;  4B28 A;  2GG9 A;  3TAV A;  3MR1 A;  2B3H A;  4U73 A;  1JAW A;  4FKC A;  1C24 A;  2GG0 A;  2ZSG A;  4ZWU A;  3PKE A;  3RVA A;  5D6F A;  2B3L A;  2BWV A;  2V3Z A;  3FM3 A;  3IG4 A;  1C23 A;  2BWS A;  1A16 A;  4ZWP A;  2BWY A;  1N51 A;  4A6V A;  1YW9 A;  2V3X A;  1BOA A;  2EVO A;  4PNC A;  5FCH A;  5CNX A;  1C27 A;  3FMR A;  4U71 A;  4S01 A;  4A6W A;  2EVM A;  2GGB A;  4OOK A;  1XGS A;  2GGC A;  2P9A A;  4ZNG A;  4RZZ A;  2GZ5 A;  4JUQ A;  2G6P A;  4KM3 A;  1WBQ A;  4IKT A;  3IU8 A;  2IW2 A;  3MX6 A;  2GA2 A;  3BIQ A;  3FMQ A;  1KQ0 A;  5CLS A;  2Q8K A;  4RZY A;  4IU6 A;  2GU5 A;  4U6Z A;  5CDV A;  1XGM A;  3PKB A;  1M35 A;  2BWT A;  1B6A A;  4FO8 A;  1BN5 A;  2OAZ A;  2EA2 A;  2Q93 A;  4IKU A;  4Z7M A;  1WKM A;  3IU9 A;  2GU7 A;  4U6J A;  2BB7 A;  5JI6 A;  3BIT A;  2P98 A;  3L7G A;  3PKC A;  2BHD A;  4S2T P;  1R58 A;  3L24 A;  2GG2 A;  4FO7 A;  4FUK A;  4FLL A;  1MAT A;  3D27 A;  2EVC A;  5JHU A;  4R60 A;  4U75 A;  5CE6 A;  1WL9 A;  2GG7 A;  2GTX A;  2GG3 A;  2NQ6 A;  2OKN A;  4FLI A;  3BIP A;  2BWW A;  2DFI A;  2BHC A;  3CB6 A;  5CDL A;  4IF7 A;  4HXX A;  1WL6 A;  1KP0 A;  2HOW A;  4PV4 A;  4MAT A;  1B59 A;  3TB5 A;  2GU4 A;  4IDY A;  1KQ9 A;  1WY2 A;  4FLK A;  2MAT A;  5FCF A;  3IU7 A;  1YW7 A;  4IPA A;  4RGZ 1;  1XGN A;  4IEC A;  1Y1N A;  2V3Y A;  4EGE A;  2BHA A;  4S00 A;  1WN1 A;  2BN7 A;  2EA4 A;  1YW8 A;  4U6C A;  5JFR A;  2NQ7 A;  5D6E A;  1O0X A;  1XGO A;  1PV9 A;  3MAT A;  3S6B A;  3Q6D A;  1XNZ A;  1QXZ A;  1C22 A;  2Q95 A;  1W2M A;  5CIK A;  2Q92 A;  2BWX A;  1R5H A;  2BHB A; 
#chains in the Genus database with same CATH homology
 1YJ3 A;  3CB5 A;  4U76 A;  1CHM A;  2V6C A;  4ZWO A;  4U1B A;  4QR8 A;  2Q94 A;  1C21 A;  4U70 A;  3PKD A;  1QZY A;  5CDE A;  2B3K A;  2Q96 A;  3CTZ A;  4IKS A;  1W7V A;  4U69 A;  4U6W A;  4U6E A;  2BWU A;  2GG8 A;  4IKR A;  1WLR A;  1QXY A;  2P99 A;  1QXW A;  2ADU A;  3PKA A;  4FLJ A;  1R5G A;  5E5B A;  2BH3 A;  2GG5 A;  4S2R P;  2GU6 A;  1YVM A;  3ROR A;  4B28 A;  2GG9 A;  3TAV A;  3MR1 A;  2B3H A;  4U73 A;  1JAW A;  4FKC A;  1C24 A;  2GG0 A;  2ZSG A;  4ZWU A;  3PKE A;  3RVA A;  5D6F A;  2B3L A;  2BWV A;  2V3Z A;  3FM3 A;  3IG4 A;  1C23 A;  2BWS A;  1A16 A;  4ZWP A;  2BWY A;  1N51 A;  4A6V A;  1YW9 A;  2V3X A;  1BOA A;  2EVO A;  4PNC A;  5FCH A;  5CNX A;  1C27 A;  3FMR A;  4U71 A;  4S01 A;  4A6W A;  2EVM A;  2GGB A;  4OOK A;  1XGS A;  2GGC A;  2P9A A;  4ZNG A;  4RZZ A;  2GZ5 A;  4JUQ A;  2G6P A;  4KM3 A;  1WBQ A;  4IKT A;  3IU8 A;  2IW2 A;  3MX6 A;  2GA2 A;  3BIQ A;  3FMQ A;  1KQ0 A;  5CLS A;  2Q8K A;  4RZY A;  4IU6 A;  2GU5 A;  4U6Z A;  5CDV A;  1XGM A;  3PKB A;  1M35 A;  2BWT A;  1B6A A;  4FO8 A;  1BN5 A;  2OAZ A;  2EA2 A;  2Q93 A;  4IKU A;  4Z7M A;  1WKM A;  3IU9 A;  2GU7 A;  4U6J A;  2BB7 A;  5JI6 A;  3BIT A;  2P98 A;  3L7G A;  3PKC A;  2BHD A;  4S2T P;  1R58 A;  3L24 A;  2GG2 A;  4FO7 A;  4FUK A;  4FLL A;  1MAT A;  3D27 A;  2EVC A;  5JHU A;  4R60 A;  4U75 A;  5CE6 A;  1WL9 A;  2GG7 A;  2GTX A;  2GG3 A;  2NQ6 A;  2OKN A;  4FLI A;  3BIP A;  2BWW A;  2DFI A;  2BHC A;  3CB6 A;  5CDL A;  4IF7 A;  4HXX A;  1WL6 A;  1KP0 A;  2HOW A;  4PV4 A;  4MAT A;  1B59 A;  3TB5 A;  2GU4 A;  4IDY A;  1KQ9 A;  1WY2 A;  4FLK A;  2MAT A;  5FCF A;  3IU7 A;  1YW7 A;  4IPA A;  4RGZ 1;  1XGN A;  4IEC A;  1Y1N A;  2V3Y A;  4EGE A;  2BHA A;  4S00 A;  1WN1 A;  2BN7 A;  2EA4 A;  1YW8 A;  4U6C A;  5JFR A;  2NQ7 A;  5D6E A;  1O0X A;  1XGO A;  1PV9 A;  3MAT A;  3S6B A;  3Q6D A;  1XNZ A;  1QXZ A;  1C22 A;  2Q95 A;  1W2M A;  5CIK A;  2Q92 A;  2BWX A;  1R5H A;  2BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...