4FLLA

Human metap1 with bengamide analog yz6, in mn form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 101
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fllA00
5D6EA 1XNZA 1YW9A 2NQ6A 2BB7A 3PKEA 4S2TP 4U76A 4FLJA 5FCFA 2GG9A 3S6BA 1KP0A 2OKNA 2P98A 4FO8A 2BH3A 4ZNGA 2BWWA 2GU5A 4HXXA 1QXWA 5CIKA 4U6EA 4PNCA 3FM3A 3MX6A 2ADUA 2BWTA 1Y1NA 4S2RP 2P99A 2GG8A 2GA2A 4U6CA 1KQ0A 1YW7A 3PKCA 5JFRA 3Q6DA 4OOKA 5E5BA 1B6AA 1R58A 1QZYA 2GG0A 4ZWOA 3RVAA 4RGZ1 3TAVA 5CNXA 2G6PA 1W2MA 1W7VA 2BHCA 4A6WA 2Q92A 3IU7A 1XGNA 1JAWA 2ZSGA 2EVCA 2V3XA 4RZZA 1WN1A 1XGSA 3FMQA 4ZWUA 4S00A 3PKDA 1C22A 3IG4A 4U70A 1R5GA 4IDYA 2B3LA 4U6ZA 2GGBA 4IKRA 3L24A 2BWSA 4U71A 2BWVA 1BN5A 1WKMA 4PV4A 1A16A 4IU6A 4U69A 2GTXA 2Q8KA 4MATA 1R5HA 2GG5A 2Q93A 3BIPA 4KM3A 1XGMA 1YJ3A 1WL6A 2EA4A 4IKUA 1CHMA 4IKSA 2GU7A 1C21A 2OAZA 4QR8A 1YW8A 5CE6A 1QXZA 4IF7A 5JHUA 2Q96A 2GGCA 5CDLA 3TB5A 2BHAA 4B28A 1QXYA 5CDVA 2B3HA 2EVOA 5D6FA 2BWYA 4FKCA 4Z7MA 3CTZA 3BITA 1WL9A 2GG3A 4IPAA 5CLSA 2V6CA 2P9AA 2V3YA 3L7GA 1M35A 1WLRA 1WY2A 4RZYA 2B3KA 4FLIA 2MATA 4JUQA 2IW2A 1XGOA 4FLKA 3PKAA 4IECA 4R60A 3RORA 4FUKA 4U75A 4EGEA 4U6WA 4S01A 1C24A 1KQ9A 2BHBA 2NQ7A 1N51A 5JI6A 4U6JA 1B59A 2GU6A 1C23A 4A6VA 2GG2A 4U73A 1MATA 2EVMA 3MATA 1PV9A 3PKBA 3D27A 3MR1A 2GG7A 2DFIA 2EA2A 2BN7A 3CB5A 2BHDA 2GZ5A 3FMRA 4FLLA 3CB6A 4FO7A 1BOAA 2HOWA 2Q94A 1O0XA 2BWUA 2Q95A 3BIQA 2GU4A 3IU9A 4IKTA 1WBQA 4U1BA 4ZWPA 5CDEA 2BWXA 2V3ZA 5FCHA 1YVMA 1C27A 3IU8A
chains in the Genus database with same CATH superfamily
5D6EA 1XNZA 1YW9A 2NQ6A 2BB7A 3PKEA 4S2TP 4U76A 4FLJA 5FCFA 2GG9A 3S6BA 1KP0A 2OKNA 2P98A 4FO8A 2BH3A 4ZNGA 2BWWA 2GU5A 4HXXA 1QXWA 5CIKA 4U6EA 4PNCA 3FM3A 3MX6A 2ADUA 2BWTA 1Y1NA 4S2RP 2P99A 2GG8A 2GA2A 4U6CA 1KQ0A 1YW7A 3PKCA 5JFRA 3Q6DA 4OOKA 5E5BA 1B6AA 1R58A 1QZYA 2GG0A 4ZWOA 3RVAA 4RGZ1 3TAVA 5CNXA 2G6PA 1W2MA 1W7VA 2BHCA 4A6WA 2Q92A 3IU7A 1XGNA 1JAWA 2ZSGA 2EVCA 2V3XA 4RZZA 1WN1A 1XGSA 3FMQA 4ZWUA 4S00A 3PKDA 1C22A 3IG4A 4U70A 1R5GA 4IDYA 2B3LA 4U6ZA 2GGBA 4IKRA 3L24A 2BWSA 4U71A 2BWVA 1BN5A 1WKMA 4PV4A 1A16A 4IU6A 4U69A 2GTXA 2Q8KA 4MATA 1R5HA 2GG5A 2Q93A 3BIPA 4KM3A 1XGMA 1YJ3A 1WL6A 2EA4A 4IKUA 1CHMA 4IKSA 2GU7A 1C21A 2OAZA 4QR8A 1YW8A 5CE6A 1QXZA 4IF7A 5JHUA 2Q96A 2GGCA 5CDLA 3TB5A 2BHAA 4B28A 1QXYA 5CDVA 2B3HA 2EVOA 5D6FA 2BWYA 4FKCA 4Z7MA 3CTZA 3BITA 1WL9A 2GG3A 4IPAA 5CLSA 2V6CA 2P9AA 2V3YA 3L7GA 1M35A 1WLRA 1WY2A 4RZYA 2B3KA 4FLIA 2MATA 4JUQA 2IW2A 1XGOA 4FLKA 3PKAA 4IECA 4R60A 3RORA 4FUKA 4U75A 4EGEA 4U6WA 4S01A 1C24A 1KQ9A 2BHBA 2NQ7A 1N51A 5JI6A 4U6JA 1B59A 2GU6A 1C23A 4A6VA 2GG2A 4U73A 1MATA 2EVMA 3MATA 1PV9A 3PKBA 3D27A 3MR1A 2GG7A 2DFIA 2EA2A 2BN7A 3CB5A 2BHDA 2GZ5A 3FMRA 4FLLA 3CB6A 4FO7A 1BOAA 2HOWA 2Q94A 1O0XA 2BWUA 2Q95A 3BIQA 2GU4A 3IU9A 4IKTA 1WBQA 4U1BA 4ZWPA 5CDEA 2BWXA 2V3ZA 5FCHA 1YVMA 1C27A 3IU8A
chains in the Genus database with same CATH topology
5D6EA 1XNZA 1YW9A 2NQ6A 2BB7A 3PKEA 4S2TP 4U76A 4FLJA 5FCFA 2GG9A 3S6BA 1KP0A 2OKNA 2P98A 4FO8A 2BH3A 4ZNGA 2BWWA 2GU5A 4HXXA 1QXWA 5CIKA 4U6EA 4PNCA 3FM3A 3MX6A 2ADUA 2BWTA 1Y1NA 4S2RP 2P99A 2GG8A 2GA2A 4U6CA 1KQ0A 1YW7A 3PKCA 5JFRA 3Q6DA 4OOKA 5E5BA 1B6AA 1R58A 1QZYA 2GG0A 4ZWOA 3RVAA 4RGZ1 3TAVA 5CNXA 2G6PA 1W2MA 1W7VA 2BHCA 4A6WA 2Q92A 3IU7A 1XGNA 1JAWA 2ZSGA 2EVCA 2V3XA 4RZZA 1WN1A 1XGSA 3FMQA 4ZWUA 4S00A 3PKDA 1C22A 3IG4A 4U70A 1R5GA 4IDYA 2B3LA 4U6ZA 2GGBA 4IKRA 3L24A 2BWSA 4U71A 2BWVA 1BN5A 1WKMA 4PV4A 1A16A 4IU6A 4U69A 2GTXA 2Q8KA 4MATA 1R5HA 2GG5A 2Q93A 3BIPA 4KM3A 1XGMA 1YJ3A 1WL6A 2EA4A 4IKUA 1CHMA 4IKSA 2GU7A 1C21A 2OAZA 4QR8A 1YW8A 5CE6A 1QXZA 4IF7A 5JHUA 2Q96A 2GGCA 5CDLA 3TB5A 2BHAA 4B28A 1QXYA 5CDVA 2B3HA 2EVOA 5D6FA 2BWYA 4FKCA 4Z7MA 3CTZA 3BITA 1WL9A 2GG3A 4IPAA 5CLSA 2V6CA 2P9AA 2V3YA 3L7GA 1M35A 1WLRA 1WY2A 4RZYA 2B3KA 4FLIA 2MATA 4JUQA 2IW2A 1XGOA 4FLKA 3PKAA 4IECA 4R60A 3RORA 4FUKA 4U75A 4EGEA 4U6WA 4S01A 1C24A 1KQ9A 2BHBA 2NQ7A 1N51A 5JI6A 4U6JA 1B59A 2GU6A 1C23A 4A6VA 2GG2A 4U73A 1MATA 2EVMA 3MATA 1PV9A 3PKBA 3D27A 3MR1A 2GG7A 2DFIA 2EA2A 2BN7A 3CB5A 2BHDA 2GZ5A 3FMRA 4FLLA 3CB6A 4FO7A 1BOAA 2HOWA 2Q94A 1O0XA 2BWUA 2Q95A 3BIQA 2GU4A 3IU9A 4IKTA 1WBQA 4U1BA 4ZWPA 5CDEA 2BWXA 2V3ZA 5FCHA 1YVMA 1C27A 3IU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6E A;  1XNZ A;  1YW9 A;  2NQ6 A;  2BB7 A;  3PKE A;  4S2T P;  4U76 A;  4FLJ A;  5FCF A;  2GG9 A;  3S6B A;  1KP0 A;  2OKN A;  2P98 A;  4FO8 A;  2BH3 A;  4ZNG A;  2BWW A;  2GU5 A;  4HXX A;  1QXW A;  5CIK A;  4U6E A;  4PNC A;  3FM3 A;  3MX6 A;  2ADU A;  2BWT A;  1Y1N A;  4S2R P;  2P99 A;  2GG8 A;  2GA2 A;  4U6C A;  1KQ0 A;  1YW7 A;  3PKC A;  5JFR A;  3Q6D A;  4OOK A;  5E5B A;  1B6A A;  1R58 A;  1QZY A;  2GG0 A;  4ZWO A;  3RVA A;  4RGZ 1;  3TAV A;  5CNX A;  2G6P A;  1W2M A;  1W7V A;  2BHC A;  4A6W A;  2Q92 A;  3IU7 A;  1XGN A;  1JAW A;  2ZSG A;  2EVC A;  2V3X A;  4RZZ A;  1WN1 A;  1XGS A;  3FMQ A;  4ZWU A;  4S00 A;  3PKD A;  1C22 A;  3IG4 A;  4U70 A;  1R5G A;  4IDY A;  2B3L A;  4U6Z A;  2GGB A;  4IKR A;  3L24 A;  2BWS A;  4U71 A;  2BWV A;  1BN5 A;  1WKM A;  4PV4 A;  1A16 A;  4IU6 A;  4U69 A;  2GTX A;  2Q8K A;  4MAT A;  1R5H A;  2GG5 A;  2Q93 A;  3BIP A;  4KM3 A;  1XGM A;  1YJ3 A;  1WL6 A;  2EA4 A;  4IKU A;  1CHM A;  4IKS A;  2GU7 A;  1C21 A;  2OAZ A;  4QR8 A;  1YW8 A;  5CE6 A;  1QXZ A;  4IF7 A;  5JHU A;  2Q96 A;  2GGC A;  5CDL A;  3TB5 A;  2BHA A;  4B28 A;  1QXY A;  5CDV A;  2B3H A;  2EVO A;  5D6F A;  2BWY A;  4FKC A;  4Z7M A;  3CTZ A;  3BIT A;  1WL9 A;  2GG3 A;  4IPA A;  5CLS A;  2V6C A;  2P9A A;  2V3Y A;  3L7G A;  1M35 A;  1WLR A;  1WY2 A;  4RZY A;  2B3K A;  4FLI A;  2MAT A;  4JUQ A;  2IW2 A;  1XGO A;  4FLK A;  3PKA A;  4IEC A;  4R60 A;  3ROR A;  4FUK A;  4U75 A;  4EGE A;  4U6W A;  4S01 A;  1C24 A;  1KQ9 A;  2BHB A;  2NQ7 A;  1N51 A;  5JI6 A;  4U6J A;  1B59 A;  2GU6 A;  1C23 A;  4A6V A;  2GG2 A;  4U73 A;  1MAT A;  2EVM A;  3MAT A;  1PV9 A;  3PKB A;  3D27 A;  3MR1 A;  2GG7 A;  2DFI A;  2EA2 A;  2BN7 A;  3CB5 A;  2BHD A;  2GZ5 A;  3FMR A;  4FLL A;  3CB6 A;  4FO7 A;  1BOA A;  2HOW A;  2Q94 A;  1O0X A;  2BWU A;  2Q95 A;  3BIQ A;  2GU4 A;  3IU9 A;  4IKT A;  1WBQ A;  4U1B A;  4ZWP A;  5CDE A;  2BWX A;  2V3Z A;  5FCH A;  1YVM A;  1C27 A;  3IU8 A; 
#chains in the Genus database with same CATH topology
 5D6E A;  1XNZ A;  1YW9 A;  2NQ6 A;  2BB7 A;  3PKE A;  4S2T P;  4U76 A;  4FLJ A;  5FCF A;  2GG9 A;  3S6B A;  1KP0 A;  2OKN A;  2P98 A;  4FO8 A;  2BH3 A;  4ZNG A;  2BWW A;  2GU5 A;  4HXX A;  1QXW A;  5CIK A;  4U6E A;  4PNC A;  3FM3 A;  3MX6 A;  2ADU A;  2BWT A;  1Y1N A;  4S2R P;  2P99 A;  2GG8 A;  2GA2 A;  4U6C A;  1KQ0 A;  1YW7 A;  3PKC A;  5JFR A;  3Q6D A;  4OOK A;  5E5B A;  1B6A A;  1R58 A;  1QZY A;  2GG0 A;  4ZWO A;  3RVA A;  4RGZ 1;  3TAV A;  5CNX A;  2G6P A;  1W2M A;  1W7V A;  2BHC A;  4A6W A;  2Q92 A;  3IU7 A;  1XGN A;  1JAW A;  2ZSG A;  2EVC A;  2V3X A;  4RZZ A;  1WN1 A;  1XGS A;  3FMQ A;  4ZWU A;  4S00 A;  3PKD A;  1C22 A;  3IG4 A;  4U70 A;  1R5G A;  4IDY A;  2B3L A;  4U6Z A;  2GGB A;  4IKR A;  3L24 A;  2BWS A;  4U71 A;  2BWV A;  1BN5 A;  1WKM A;  4PV4 A;  1A16 A;  4IU6 A;  4U69 A;  2GTX A;  2Q8K A;  4MAT A;  1R5H A;  2GG5 A;  2Q93 A;  3BIP A;  4KM3 A;  1XGM A;  1YJ3 A;  1WL6 A;  2EA4 A;  4IKU A;  1CHM A;  4IKS A;  2GU7 A;  1C21 A;  2OAZ A;  4QR8 A;  1YW8 A;  5CE6 A;  1QXZ A;  4IF7 A;  5JHU A;  2Q96 A;  2GGC A;  5CDL A;  3TB5 A;  2BHA A;  4B28 A;  1QXY A;  5CDV A;  2B3H A;  2EVO A;  5D6F A;  2BWY A;  4FKC A;  4Z7M A;  3CTZ A;  3BIT A;  1WL9 A;  2GG3 A;  4IPA A;  5CLS A;  2V6C A;  2P9A A;  2V3Y A;  3L7G A;  1M35 A;  1WLR A;  1WY2 A;  4RZY A;  2B3K A;  4FLI A;  2MAT A;  4JUQ A;  2IW2 A;  1XGO A;  4FLK A;  3PKA A;  4IEC A;  4R60 A;  3ROR A;  4FUK A;  4U75 A;  4EGE A;  4U6W A;  4S01 A;  1C24 A;  1KQ9 A;  2BHB A;  2NQ7 A;  1N51 A;  5JI6 A;  4U6J A;  1B59 A;  2GU6 A;  1C23 A;  4A6V A;  2GG2 A;  4U73 A;  1MAT A;  2EVM A;  3MAT A;  1PV9 A;  3PKB A;  3D27 A;  3MR1 A;  2GG7 A;  2DFI A;  2EA2 A;  2BN7 A;  3CB5 A;  2BHD A;  2GZ5 A;  3FMR A;  4FLL A;  3CB6 A;  4FO7 A;  1BOA A;  2HOW A;  2Q94 A;  1O0X A;  2BWU A;  2Q95 A;  3BIQ A;  2GU4 A;  3IU9 A;  4IKT A;  1WBQ A;  4U1B A;  4ZWP A;  5CDE A;  2BWX A;  2V3Z A;  5FCH A;  1YVM A;  1C27 A;  3IU8 A; 
#chains in the Genus database with same CATH homology
 5D6E A;  1XNZ A;  1YW9 A;  2NQ6 A;  2BB7 A;  3PKE A;  4S2T P;  4U76 A;  4FLJ A;  5FCF A;  2GG9 A;  3S6B A;  1KP0 A;  2OKN A;  2P98 A;  4FO8 A;  2BH3 A;  4ZNG A;  2BWW A;  2GU5 A;  4HXX A;  1QXW A;  5CIK A;  4U6E A;  4PNC A;  3FM3 A;  3MX6 A;  2ADU A;  2BWT A;  1Y1N A;  4S2R P;  2P99 A;  2GG8 A;  2GA2 A;  4U6C A;  1KQ0 A;  1YW7 A;  3PKC A;  5JFR A;  3Q6D A;  4OOK A;  5E5B A;  1B6A A;  1R58 A;  1QZY A;  2GG0 A;  4ZWO A;  3RVA A;  4RGZ 1;  3TAV A;  5CNX A;  2G6P A;  1W2M A;  1W7V A;  2BHC A;  4A6W A;  2Q92 A;  3IU7 A;  1XGN A;  1JAW A;  2ZSG A;  2EVC A;  2V3X A;  4RZZ A;  1WN1 A;  1XGS A;  3FMQ A;  4ZWU A;  4S00 A;  3PKD A;  1C22 A;  3IG4 A;  4U70 A;  1R5G A;  4IDY A;  2B3L A;  4U6Z A;  2GGB A;  4IKR A;  3L24 A;  2BWS A;  4U71 A;  2BWV A;  1BN5 A;  1WKM A;  4PV4 A;  1A16 A;  4IU6 A;  4U69 A;  2GTX A;  2Q8K A;  4MAT A;  1R5H A;  2GG5 A;  2Q93 A;  3BIP A;  4KM3 A;  1XGM A;  1YJ3 A;  1WL6 A;  2EA4 A;  4IKU A;  1CHM A;  4IKS A;  2GU7 A;  1C21 A;  2OAZ A;  4QR8 A;  1YW8 A;  5CE6 A;  1QXZ A;  4IF7 A;  5JHU A;  2Q96 A;  2GGC A;  5CDL A;  3TB5 A;  2BHA A;  4B28 A;  1QXY A;  5CDV A;  2B3H A;  2EVO A;  5D6F A;  2BWY A;  4FKC A;  4Z7M A;  3CTZ A;  3BIT A;  1WL9 A;  2GG3 A;  4IPA A;  5CLS A;  2V6C A;  2P9A A;  2V3Y A;  3L7G A;  1M35 A;  1WLR A;  1WY2 A;  4RZY A;  2B3K A;  4FLI A;  2MAT A;  4JUQ A;  2IW2 A;  1XGO A;  4FLK A;  3PKA A;  4IEC A;  4R60 A;  3ROR A;  4FUK A;  4U75 A;  4EGE A;  4U6W A;  4S01 A;  1C24 A;  1KQ9 A;  2BHB A;  2NQ7 A;  1N51 A;  5JI6 A;  4U6J A;  1B59 A;  2GU6 A;  1C23 A;  4A6V A;  2GG2 A;  4U73 A;  1MAT A;  2EVM A;  3MAT A;  1PV9 A;  3PKB A;  3D27 A;  3MR1 A;  2GG7 A;  2DFI A;  2EA2 A;  2BN7 A;  3CB5 A;  2BHD A;  2GZ5 A;  3FMR A;  4FLL A;  3CB6 A;  4FO7 A;  1BOA A;  2HOW A;  2Q94 A;  1O0X A;  2BWU A;  2Q95 A;  3BIQ A;  2GU4 A;  3IU9 A;  4IKT A;  1WBQ A;  4U1B A;  4ZWP A;  5CDE A;  2BWX A;  2V3Z A;  5FCH A;  1YVM A;  1C27 A;  3IU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...