4IKSA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(6-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iksA00
1YJ3A 2Q94A 1QXWA 3PKDA 1BOAA 1CHMA 1R58A 4MATA 4S01A 4U73A 4U6JA 1WBQA 1W7VA 2GG7A 3TB5A 2BWXA 5JI6A 1KQ0A 4HXXA 4PNCA 1WN1A 4QR8A 2OAZA 1BN5A 2BHDA 2BH3A 2MATA 4U69A 2Q96A 4FLLA 2BN7A 4B28A 1C24A 3BIPA 2BWWA 2OKNA 4PV4A 1R5GA 1B6AA 3RVAA 2BWTA 4R60A 1WKMA 2DFIA 2EVMA 2GA2A 3MX6A 2EVCA 2BHAA 1YW9A 2BHCA 1XGNA 3IU8A 3IU7A 2Q92A 2V3ZA 2BWUA 5CE6A 4U6CA 4IKTA 1N51A 2GG2A 5CDLA 3FMQA 2GU4A 1WY2A 2Q95A 2GG3A 5FCFA 5JFRA 2GTXA 2B3LA 1XGMA 4S2RP 5FCHA 4A6VA 2HOWA 1YW7A 4U71A 2BHBA 1XNZA 3MATA 4U1BA 2GGBA 1C21A 2GG8A 4S2TP 4RZZA 4IKUA 4U70A 5CLSA 3L24A 3PKBA 2EA4A 2BWVA 3PKCA 1WL9A 1C27A 2GG9A 3TAVA 2GU6A 4JUQA 2ADUA 4FLJA 5JHUA 4A6WA 4FUKA 2NQ6A 3S6BA 5CDVA 2EA2A 1B59A 3CTZA 3IU9A 4ZWUA 1QZYA 3CB5A 1XGSA 5CNXA 4RZYA 1WLRA 2BWYA 2GU5A 4OOKA 4Z7MA 2V3YA 1O0XA 1C22A 1WL6A 1KQ9A 4RGZ1 1C23A 5D6FA 1YVMA 3D27A 5E5BA 2B3KA 1QXYA 4FLKA 2V6CA 4FO8A 3PKAA 1KP0A 4ZNGA 2EVOA 2GGCA 2NQ7A 3CB6A 4IU6A 4U6EA 4EGEA 3BITA 3MR1A 4FKCA 4FLIA 4IECA 5CIKA 1QXZA 1R5HA 1Y1NA 4ZWPA 2Q8KA 2GG5A 3L7GA 2B3HA 4U6ZA 3FMRA 2BWSA 2GZ5A 2Q93A 4IKSA 2ZSGA 3PKEA 4IPAA 1PV9A 4U6WA 1W2MA 4ZWOA 2P99A 1YW8A 1MATA 3RORA 1M35A 4U75A 1A16A 2G6PA 2GU7A 3IG4A 2IW2A 2P9AA 2V3XA 4FO7A 4IDYA 2P98A 4U76A 4S00A 3BIQA 3FM3A 2GG0A 4IF7A 2BB7A 4KM3A 4IKRA 1XGOA 5D6EA 5CDEA 1JAWA 3Q6DA
chains in the Genus database with same CATH superfamily
1YJ3A 2Q94A 1QXWA 3PKDA 1BOAA 1CHMA 1R58A 4MATA 4S01A 4U73A 4U6JA 1WBQA 1W7VA 2GG7A 3TB5A 2BWXA 5JI6A 1KQ0A 4HXXA 4PNCA 1WN1A 4QR8A 2OAZA 1BN5A 2BHDA 2BH3A 2MATA 4U69A 2Q96A 4FLLA 2BN7A 4B28A 1C24A 3BIPA 2BWWA 2OKNA 4PV4A 1R5GA 1B6AA 3RVAA 2BWTA 4R60A 1WKMA 2DFIA 2EVMA 2GA2A 3MX6A 2EVCA 2BHAA 1YW9A 2BHCA 1XGNA 3IU8A 3IU7A 2Q92A 2V3ZA 2BWUA 5CE6A 4U6CA 4IKTA 1N51A 2GG2A 5CDLA 3FMQA 2GU4A 1WY2A 2Q95A 2GG3A 5FCFA 5JFRA 2GTXA 2B3LA 1XGMA 4S2RP 5FCHA 4A6VA 2HOWA 1YW7A 4U71A 2BHBA 1XNZA 3MATA 4U1BA 2GGBA 1C21A 2GG8A 4S2TP 4RZZA 4IKUA 4U70A 5CLSA 3L24A 3PKBA 2EA4A 2BWVA 3PKCA 1WL9A 1C27A 2GG9A 3TAVA 2GU6A 4JUQA 2ADUA 4FLJA 5JHUA 4A6WA 4FUKA 2NQ6A 3S6BA 5CDVA 2EA2A 1B59A 3CTZA 3IU9A 4ZWUA 1QZYA 3CB5A 1XGSA 5CNXA 4RZYA 1WLRA 2BWYA 2GU5A 4OOKA 4Z7MA 2V3YA 1O0XA 1C22A 1WL6A 1KQ9A 4RGZ1 1C23A 5D6FA 1YVMA 3D27A 5E5BA 2B3KA 1QXYA 4FLKA 2V6CA 4FO8A 3PKAA 1KP0A 4ZNGA 2EVOA 2GGCA 2NQ7A 3CB6A 4IU6A 4U6EA 4EGEA 3BITA 3MR1A 4FKCA 4FLIA 4IECA 5CIKA 1QXZA 1R5HA 1Y1NA 4ZWPA 2Q8KA 2GG5A 3L7GA 2B3HA 4U6ZA 3FMRA 2BWSA 2GZ5A 2Q93A 4IKSA 2ZSGA 3PKEA 4IPAA 1PV9A 4U6WA 1W2MA 4ZWOA 2P99A 1YW8A 1MATA 3RORA 1M35A 4U75A 1A16A 2G6PA 2GU7A 3IG4A 2IW2A 2P9AA 2V3XA 4FO7A 4IDYA 2P98A 4U76A 4S00A 3BIQA 3FM3A 2GG0A 4IF7A 2BB7A 4KM3A 4IKRA 1XGOA 5D6EA 5CDEA 1JAWA 3Q6DA
chains in the Genus database with same CATH topology
1YJ3A 2Q94A 1QXWA 3PKDA 1BOAA 1CHMA 1R58A 4MATA 4S01A 4U73A 4U6JA 1WBQA 1W7VA 2GG7A 3TB5A 2BWXA 5JI6A 1KQ0A 4HXXA 4PNCA 1WN1A 4QR8A 2OAZA 1BN5A 2BHDA 2BH3A 2MATA 4U69A 2Q96A 4FLLA 2BN7A 4B28A 1C24A 3BIPA 2BWWA 2OKNA 4PV4A 1R5GA 1B6AA 3RVAA 2BWTA 4R60A 1WKMA 2DFIA 2EVMA 2GA2A 3MX6A 2EVCA 2BHAA 1YW9A 2BHCA 1XGNA 3IU8A 3IU7A 2Q92A 2V3ZA 2BWUA 5CE6A 4U6CA 4IKTA 1N51A 2GG2A 5CDLA 3FMQA 2GU4A 1WY2A 2Q95A 2GG3A 5FCFA 5JFRA 2GTXA 2B3LA 1XGMA 4S2RP 5FCHA 4A6VA 2HOWA 1YW7A 4U71A 2BHBA 1XNZA 3MATA 4U1BA 2GGBA 1C21A 2GG8A 4S2TP 4RZZA 4IKUA 4U70A 5CLSA 3L24A 3PKBA 2EA4A 2BWVA 3PKCA 1WL9A 1C27A 2GG9A 3TAVA 2GU6A 4JUQA 2ADUA 4FLJA 5JHUA 4A6WA 4FUKA 2NQ6A 3S6BA 5CDVA 2EA2A 1B59A 3CTZA 3IU9A 4ZWUA 1QZYA 3CB5A 1XGSA 5CNXA 4RZYA 1WLRA 2BWYA 2GU5A 4OOKA 4Z7MA 2V3YA 1O0XA 1C22A 1WL6A 1KQ9A 4RGZ1 1C23A 5D6FA 1YVMA 3D27A 5E5BA 2B3KA 1QXYA 4FLKA 2V6CA 4FO8A 3PKAA 1KP0A 4ZNGA 2EVOA 2GGCA 2NQ7A 3CB6A 4IU6A 4U6EA 4EGEA 3BITA 3MR1A 4FKCA 4FLIA 4IECA 5CIKA 1QXZA 1R5HA 1Y1NA 4ZWPA 2Q8KA 2GG5A 3L7GA 2B3HA 4U6ZA 3FMRA 2BWSA 2GZ5A 2Q93A 4IKSA 2ZSGA 3PKEA 4IPAA 1PV9A 4U6WA 1W2MA 4ZWOA 2P99A 1YW8A 1MATA 3RORA 1M35A 4U75A 1A16A 2G6PA 2GU7A 3IG4A 2IW2A 2P9AA 2V3XA 4FO7A 4IDYA 2P98A 4U76A 4S00A 3BIQA 3FM3A 2GG0A 4IF7A 2BB7A 4KM3A 4IKRA 1XGOA 5D6EA 5CDEA 1JAWA 3Q6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ3 A;  2Q94 A;  1QXW A;  3PKD A;  1BOA A;  1CHM A;  1R58 A;  4MAT A;  4S01 A;  4U73 A;  4U6J A;  1WBQ A;  1W7V A;  2GG7 A;  3TB5 A;  2BWX A;  5JI6 A;  1KQ0 A;  4HXX A;  4PNC A;  1WN1 A;  4QR8 A;  2OAZ A;  1BN5 A;  2BHD A;  2BH3 A;  2MAT A;  4U69 A;  2Q96 A;  4FLL A;  2BN7 A;  4B28 A;  1C24 A;  3BIP A;  2BWW A;  2OKN A;  4PV4 A;  1R5G A;  1B6A A;  3RVA A;  2BWT A;  4R60 A;  1WKM A;  2DFI A;  2EVM A;  2GA2 A;  3MX6 A;  2EVC A;  2BHA A;  1YW9 A;  2BHC A;  1XGN A;  3IU8 A;  3IU7 A;  2Q92 A;  2V3Z A;  2BWU A;  5CE6 A;  4U6C A;  4IKT A;  1N51 A;  2GG2 A;  5CDL A;  3FMQ A;  2GU4 A;  1WY2 A;  2Q95 A;  2GG3 A;  5FCF A;  5JFR A;  2GTX A;  2B3L A;  1XGM A;  4S2R P;  5FCH A;  4A6V A;  2HOW A;  1YW7 A;  4U71 A;  2BHB A;  1XNZ A;  3MAT A;  4U1B A;  2GGB A;  1C21 A;  2GG8 A;  4S2T P;  4RZZ A;  4IKU A;  4U70 A;  5CLS A;  3L24 A;  3PKB A;  2EA4 A;  2BWV A;  3PKC A;  1WL9 A;  1C27 A;  2GG9 A;  3TAV A;  2GU6 A;  4JUQ A;  2ADU A;  4FLJ A;  5JHU A;  4A6W A;  4FUK A;  2NQ6 A;  3S6B A;  5CDV A;  2EA2 A;  1B59 A;  3CTZ A;  3IU9 A;  4ZWU A;  1QZY A;  3CB5 A;  1XGS A;  5CNX A;  4RZY A;  1WLR A;  2BWY A;  2GU5 A;  4OOK A;  4Z7M A;  2V3Y A;  1O0X A;  1C22 A;  1WL6 A;  1KQ9 A;  4RGZ 1;  1C23 A;  5D6F A;  1YVM A;  3D27 A;  5E5B A;  2B3K A;  1QXY A;  4FLK A;  2V6C A;  4FO8 A;  3PKA A;  1KP0 A;  4ZNG A;  2EVO A;  2GGC A;  2NQ7 A;  3CB6 A;  4IU6 A;  4U6E A;  4EGE A;  3BIT A;  3MR1 A;  4FKC A;  4FLI A;  4IEC A;  5CIK A;  1QXZ A;  1R5H A;  1Y1N A;  4ZWP A;  2Q8K A;  2GG5 A;  3L7G A;  2B3H A;  4U6Z A;  3FMR A;  2BWS A;  2GZ5 A;  2Q93 A;  4IKS A;  2ZSG A;  3PKE A;  4IPA A;  1PV9 A;  4U6W A;  1W2M A;  4ZWO A;  2P99 A;  1YW8 A;  1MAT A;  3ROR A;  1M35 A;  4U75 A;  1A16 A;  2G6P A;  2GU7 A;  3IG4 A;  2IW2 A;  2P9A A;  2V3X A;  4FO7 A;  4IDY A;  2P98 A;  4U76 A;  4S00 A;  3BIQ A;  3FM3 A;  2GG0 A;  4IF7 A;  2BB7 A;  4KM3 A;  4IKR A;  1XGO A;  5D6E A;  5CDE A;  1JAW A;  3Q6D A; 
#chains in the Genus database with same CATH topology
 1YJ3 A;  2Q94 A;  1QXW A;  3PKD A;  1BOA A;  1CHM A;  1R58 A;  4MAT A;  4S01 A;  4U73 A;  4U6J A;  1WBQ A;  1W7V A;  2GG7 A;  3TB5 A;  2BWX A;  5JI6 A;  1KQ0 A;  4HXX A;  4PNC A;  1WN1 A;  4QR8 A;  2OAZ A;  1BN5 A;  2BHD A;  2BH3 A;  2MAT A;  4U69 A;  2Q96 A;  4FLL A;  2BN7 A;  4B28 A;  1C24 A;  3BIP A;  2BWW A;  2OKN A;  4PV4 A;  1R5G A;  1B6A A;  3RVA A;  2BWT A;  4R60 A;  1WKM A;  2DFI A;  2EVM A;  2GA2 A;  3MX6 A;  2EVC A;  2BHA A;  1YW9 A;  2BHC A;  1XGN A;  3IU8 A;  3IU7 A;  2Q92 A;  2V3Z A;  2BWU A;  5CE6 A;  4U6C A;  4IKT A;  1N51 A;  2GG2 A;  5CDL A;  3FMQ A;  2GU4 A;  1WY2 A;  2Q95 A;  2GG3 A;  5FCF A;  5JFR A;  2GTX A;  2B3L A;  1XGM A;  4S2R P;  5FCH A;  4A6V A;  2HOW A;  1YW7 A;  4U71 A;  2BHB A;  1XNZ A;  3MAT A;  4U1B A;  2GGB A;  1C21 A;  2GG8 A;  4S2T P;  4RZZ A;  4IKU A;  4U70 A;  5CLS A;  3L24 A;  3PKB A;  2EA4 A;  2BWV A;  3PKC A;  1WL9 A;  1C27 A;  2GG9 A;  3TAV A;  2GU6 A;  4JUQ A;  2ADU A;  4FLJ A;  5JHU A;  4A6W A;  4FUK A;  2NQ6 A;  3S6B A;  5CDV A;  2EA2 A;  1B59 A;  3CTZ A;  3IU9 A;  4ZWU A;  1QZY A;  3CB5 A;  1XGS A;  5CNX A;  4RZY A;  1WLR A;  2BWY A;  2GU5 A;  4OOK A;  4Z7M A;  2V3Y A;  1O0X A;  1C22 A;  1WL6 A;  1KQ9 A;  4RGZ 1;  1C23 A;  5D6F A;  1YVM A;  3D27 A;  5E5B A;  2B3K A;  1QXY A;  4FLK A;  2V6C A;  4FO8 A;  3PKA A;  1KP0 A;  4ZNG A;  2EVO A;  2GGC A;  2NQ7 A;  3CB6 A;  4IU6 A;  4U6E A;  4EGE A;  3BIT A;  3MR1 A;  4FKC A;  4FLI A;  4IEC A;  5CIK A;  1QXZ A;  1R5H A;  1Y1N A;  4ZWP A;  2Q8K A;  2GG5 A;  3L7G A;  2B3H A;  4U6Z A;  3FMR A;  2BWS A;  2GZ5 A;  2Q93 A;  4IKS A;  2ZSG A;  3PKE A;  4IPA A;  1PV9 A;  4U6W A;  1W2M A;  4ZWO A;  2P99 A;  1YW8 A;  1MAT A;  3ROR A;  1M35 A;  4U75 A;  1A16 A;  2G6P A;  2GU7 A;  3IG4 A;  2IW2 A;  2P9A A;  2V3X A;  4FO7 A;  4IDY A;  2P98 A;  4U76 A;  4S00 A;  3BIQ A;  3FM3 A;  2GG0 A;  4IF7 A;  2BB7 A;  4KM3 A;  4IKR A;  1XGO A;  5D6E A;  5CDE A;  1JAW A;  3Q6D A; 
#chains in the Genus database with same CATH homology
 1YJ3 A;  2Q94 A;  1QXW A;  3PKD A;  1BOA A;  1CHM A;  1R58 A;  4MAT A;  4S01 A;  4U73 A;  4U6J A;  1WBQ A;  1W7V A;  2GG7 A;  3TB5 A;  2BWX A;  5JI6 A;  1KQ0 A;  4HXX A;  4PNC A;  1WN1 A;  4QR8 A;  2OAZ A;  1BN5 A;  2BHD A;  2BH3 A;  2MAT A;  4U69 A;  2Q96 A;  4FLL A;  2BN7 A;  4B28 A;  1C24 A;  3BIP A;  2BWW A;  2OKN A;  4PV4 A;  1R5G A;  1B6A A;  3RVA A;  2BWT A;  4R60 A;  1WKM A;  2DFI A;  2EVM A;  2GA2 A;  3MX6 A;  2EVC A;  2BHA A;  1YW9 A;  2BHC A;  1XGN A;  3IU8 A;  3IU7 A;  2Q92 A;  2V3Z A;  2BWU A;  5CE6 A;  4U6C A;  4IKT A;  1N51 A;  2GG2 A;  5CDL A;  3FMQ A;  2GU4 A;  1WY2 A;  2Q95 A;  2GG3 A;  5FCF A;  5JFR A;  2GTX A;  2B3L A;  1XGM A;  4S2R P;  5FCH A;  4A6V A;  2HOW A;  1YW7 A;  4U71 A;  2BHB A;  1XNZ A;  3MAT A;  4U1B A;  2GGB A;  1C21 A;  2GG8 A;  4S2T P;  4RZZ A;  4IKU A;  4U70 A;  5CLS A;  3L24 A;  3PKB A;  2EA4 A;  2BWV A;  3PKC A;  1WL9 A;  1C27 A;  2GG9 A;  3TAV A;  2GU6 A;  4JUQ A;  2ADU A;  4FLJ A;  5JHU A;  4A6W A;  4FUK A;  2NQ6 A;  3S6B A;  5CDV A;  2EA2 A;  1B59 A;  3CTZ A;  3IU9 A;  4ZWU A;  1QZY A;  3CB5 A;  1XGS A;  5CNX A;  4RZY A;  1WLR A;  2BWY A;  2GU5 A;  4OOK A;  4Z7M A;  2V3Y A;  1O0X A;  1C22 A;  1WL6 A;  1KQ9 A;  4RGZ 1;  1C23 A;  5D6F A;  1YVM A;  3D27 A;  5E5B A;  2B3K A;  1QXY A;  4FLK A;  2V6C A;  4FO8 A;  3PKA A;  1KP0 A;  4ZNG A;  2EVO A;  2GGC A;  2NQ7 A;  3CB6 A;  4IU6 A;  4U6E A;  4EGE A;  3BIT A;  3MR1 A;  4FKC A;  4FLI A;  4IEC A;  5CIK A;  1QXZ A;  1R5H A;  1Y1N A;  4ZWP A;  2Q8K A;  2GG5 A;  3L7G A;  2B3H A;  4U6Z A;  3FMR A;  2BWS A;  2GZ5 A;  2Q93 A;  4IKS A;  2ZSG A;  3PKE A;  4IPA A;  1PV9 A;  4U6W A;  1W2M A;  4ZWO A;  2P99 A;  1YW8 A;  1MAT A;  3ROR A;  1M35 A;  4U75 A;  1A16 A;  2G6P A;  2GU7 A;  3IG4 A;  2IW2 A;  2P9A A;  2V3X A;  4FO7 A;  4IDY A;  2P98 A;  4U76 A;  4S00 A;  3BIQ A;  3FM3 A;  2GG0 A;  4IF7 A;  2BB7 A;  4KM3 A;  4IKR A;  1XGO A;  5D6E A;  5CDE A;  1JAW A;  3Q6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...