4JUQA

Pseudomonas aeruginosa metap t2n mutant, in mn form
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
258
structure length
258
Chain Sequence
NVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 79
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4juqA00
4QR8A 2B3HA 2V3YA 2GU6A 4MATA 4PNCA 2P99A 5FCFA 2GZ5A 5JI6A 2G6PA 2BHAA 3L24A 1BOAA 2BWXA 4ZWOA 3MATA 1O0XA 1R5GA 3BITA 2GG5A 4S2RP 2V3XA 4U70A 1C27A 3BIPA 1JAWA 1WY2A 4S2TP 2OKNA 3PKAA 4FLKA 2OAZA 1BN5A 2BB7A 2BHCA 2EA4A 2Q92A 3PKDA 3CB6A 3FM3A 5E5BA 1XGNA 2BWVA 2Q93A 2BWWA 2P9AA 4HXXA 1N51A 4ZNGA 3FMRA 1YW7A 2EVOA 3CTZA 1WL6A 3IU8A 2GTXA 3RVAA 3PKBA 5CIKA 4IPAA 5CDLA 1YVMA 1C24A 4ZWPA 1MATA 2GG9A 3IG4A 1R58A 5CNXA 2ZSGA 1Y1NA 2BWUA 5JFRA 4U6EA 2EA2A 1WL9A 4JUQA 2GU7A 4FUKA 2NQ6A 3BIQA 2ADUA 3Q6DA 4A6WA 1C22A 1C23A 4FKCA 3S6BA 4KM3A 4Z7MA 1XGSA 2BN7A 2EVCA 2BHBA 1PV9A 4IDYA 5JHUA 1KQ0A 4S00A 1QXYA 2GG8A 2HOWA 4RZZA 4FLIA 3TB5A 2GU4A 4FO7A 4U6JA 2Q94A 4FLLA 3CB5A 4IKTA 1WKMA 4U76A 2BWYA 3MR1A 1XGOA 2NQ7A 2GU5A 3PKCA 4U71A 2BHDA 2GA2A 4EGEA 4RZYA 3MX6A 2EVMA 5FCHA 1KP0A 2V3ZA 2Q96A 4U75A 1B6AA 2GG2A 4U6CA 4U73A 1KQ9A 4IKUA 5CE6A 2Q8KA 1QXZA 1M35A 1WBQA 4B28A 1C21A 1QXWA 3FMQA 1A16A 1CHMA 4PV4A 3IU9A 4IECA 2GG3A 4IKSA 2GGBA 3L7GA 2BWTA 1W2MA 4ZWUA 5CLSA 3RORA 2GGCA 4FO8A 4S01A 4IF7A 2BWSA 4FLJA 1WN1A 4U6WA 5D6FA 1YW8A 2P98A 2MATA 3IU7A 4U1BA 2GG7A 2V6CA 4RGZ1 2BH3A 1R5HA 5CDEA 2IW2A 2GG0A 5D6EA 4IKRA 4U69A 4U6ZA 3PKEA 3TAVA 1QZYA 1XGMA 2B3LA 2Q95A 4OOKA 1YW9A 1W7VA 4IU6A 2B3KA 5CDVA 1B59A 4A6VA 1YJ3A 1WLRA 3D27A 4R60A 2DFIA 1XNZA
chains in the Genus database with same CATH superfamily
4QR8A 2B3HA 2V3YA 2GU6A 4MATA 4PNCA 2P99A 5FCFA 2GZ5A 5JI6A 2G6PA 2BHAA 3L24A 1BOAA 2BWXA 4ZWOA 3MATA 1O0XA 1R5GA 3BITA 2GG5A 4S2RP 2V3XA 4U70A 1C27A 3BIPA 1JAWA 1WY2A 4S2TP 2OKNA 3PKAA 4FLKA 2OAZA 1BN5A 2BB7A 2BHCA 2EA4A 2Q92A 3PKDA 3CB6A 3FM3A 5E5BA 1XGNA 2BWVA 2Q93A 2BWWA 2P9AA 4HXXA 1N51A 4ZNGA 3FMRA 1YW7A 2EVOA 3CTZA 1WL6A 3IU8A 2GTXA 3RVAA 3PKBA 5CIKA 4IPAA 5CDLA 1YVMA 1C24A 4ZWPA 1MATA 2GG9A 3IG4A 1R58A 5CNXA 2ZSGA 1Y1NA 2BWUA 5JFRA 4U6EA 2EA2A 1WL9A 4JUQA 2GU7A 4FUKA 2NQ6A 3BIQA 2ADUA 3Q6DA 4A6WA 1C22A 1C23A 4FKCA 3S6BA 4KM3A 4Z7MA 1XGSA 2BN7A 2EVCA 2BHBA 1PV9A 4IDYA 5JHUA 1KQ0A 4S00A 1QXYA 2GG8A 2HOWA 4RZZA 4FLIA 3TB5A 2GU4A 4FO7A 4U6JA 2Q94A 4FLLA 3CB5A 4IKTA 1WKMA 4U76A 2BWYA 3MR1A 1XGOA 2NQ7A 2GU5A 3PKCA 4U71A 2BHDA 2GA2A 4EGEA 4RZYA 3MX6A 2EVMA 5FCHA 1KP0A 2V3ZA 2Q96A 4U75A 1B6AA 2GG2A 4U6CA 4U73A 1KQ9A 4IKUA 5CE6A 2Q8KA 1QXZA 1M35A 1WBQA 4B28A 1C21A 1QXWA 3FMQA 1A16A 1CHMA 4PV4A 3IU9A 4IECA 2GG3A 4IKSA 2GGBA 3L7GA 2BWTA 1W2MA 4ZWUA 5CLSA 3RORA 2GGCA 4FO8A 4S01A 4IF7A 2BWSA 4FLJA 1WN1A 4U6WA 5D6FA 1YW8A 2P98A 2MATA 3IU7A 4U1BA 2GG7A 2V6CA 4RGZ1 2BH3A 1R5HA 5CDEA 2IW2A 2GG0A 5D6EA 4IKRA 4U69A 4U6ZA 3PKEA 3TAVA 1QZYA 1XGMA 2B3LA 2Q95A 4OOKA 1YW9A 1W7VA 4IU6A 2B3KA 5CDVA 1B59A 4A6VA 1YJ3A 1WLRA 3D27A 4R60A 2DFIA 1XNZA
chains in the Genus database with same CATH topology
4QR8A 2B3HA 2V3YA 2GU6A 4MATA 4PNCA 2P99A 5FCFA 2GZ5A 5JI6A 2G6PA 2BHAA 3L24A 1BOAA 2BWXA 4ZWOA 3MATA 1O0XA 1R5GA 3BITA 2GG5A 4S2RP 2V3XA 4U70A 1C27A 3BIPA 1JAWA 1WY2A 4S2TP 2OKNA 3PKAA 4FLKA 2OAZA 1BN5A 2BB7A 2BHCA 2EA4A 2Q92A 3PKDA 3CB6A 3FM3A 5E5BA 1XGNA 2BWVA 2Q93A 2BWWA 2P9AA 4HXXA 1N51A 4ZNGA 3FMRA 1YW7A 2EVOA 3CTZA 1WL6A 3IU8A 2GTXA 3RVAA 3PKBA 5CIKA 4IPAA 5CDLA 1YVMA 1C24A 4ZWPA 1MATA 2GG9A 3IG4A 1R58A 5CNXA 2ZSGA 1Y1NA 2BWUA 5JFRA 4U6EA 2EA2A 1WL9A 4JUQA 2GU7A 4FUKA 2NQ6A 3BIQA 2ADUA 3Q6DA 4A6WA 1C22A 1C23A 4FKCA 3S6BA 4KM3A 4Z7MA 1XGSA 2BN7A 2EVCA 2BHBA 1PV9A 4IDYA 5JHUA 1KQ0A 4S00A 1QXYA 2GG8A 2HOWA 4RZZA 4FLIA 3TB5A 2GU4A 4FO7A 4U6JA 2Q94A 4FLLA 3CB5A 4IKTA 1WKMA 4U76A 2BWYA 3MR1A 1XGOA 2NQ7A 2GU5A 3PKCA 4U71A 2BHDA 2GA2A 4EGEA 4RZYA 3MX6A 2EVMA 5FCHA 1KP0A 2V3ZA 2Q96A 4U75A 1B6AA 2GG2A 4U6CA 4U73A 1KQ9A 4IKUA 5CE6A 2Q8KA 1QXZA 1M35A 1WBQA 4B28A 1C21A 1QXWA 3FMQA 1A16A 1CHMA 4PV4A 3IU9A 4IECA 2GG3A 4IKSA 2GGBA 3L7GA 2BWTA 1W2MA 4ZWUA 5CLSA 3RORA 2GGCA 4FO8A 4S01A 4IF7A 2BWSA 4FLJA 1WN1A 4U6WA 5D6FA 1YW8A 2P98A 2MATA 3IU7A 4U1BA 2GG7A 2V6CA 4RGZ1 2BH3A 1R5HA 5CDEA 2IW2A 2GG0A 5D6EA 4IKRA 4U69A 4U6ZA 3PKEA 3TAVA 1QZYA 1XGMA 2B3LA 2Q95A 4OOKA 1YW9A 1W7VA 4IU6A 2B3KA 5CDVA 1B59A 4A6VA 1YJ3A 1WLRA 3D27A 4R60A 2DFIA 1XNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QR8 A;  2B3H A;  2V3Y A;  2GU6 A;  4MAT A;  4PNC A;  2P99 A;  5FCF A;  2GZ5 A;  5JI6 A;  2G6P A;  2BHA A;  3L24 A;  1BOA A;  2BWX A;  4ZWO A;  3MAT A;  1O0X A;  1R5G A;  3BIT A;  2GG5 A;  4S2R P;  2V3X A;  4U70 A;  1C27 A;  3BIP A;  1JAW A;  1WY2 A;  4S2T P;  2OKN A;  3PKA A;  4FLK A;  2OAZ A;  1BN5 A;  2BB7 A;  2BHC A;  2EA4 A;  2Q92 A;  3PKD A;  3CB6 A;  3FM3 A;  5E5B A;  1XGN A;  2BWV A;  2Q93 A;  2BWW A;  2P9A A;  4HXX A;  1N51 A;  4ZNG A;  3FMR A;  1YW7 A;  2EVO A;  3CTZ A;  1WL6 A;  3IU8 A;  2GTX A;  3RVA A;  3PKB A;  5CIK A;  4IPA A;  5CDL A;  1YVM A;  1C24 A;  4ZWP A;  1MAT A;  2GG9 A;  3IG4 A;  1R58 A;  5CNX A;  2ZSG A;  1Y1N A;  2BWU A;  5JFR A;  4U6E A;  2EA2 A;  1WL9 A;  4JUQ A;  2GU7 A;  4FUK A;  2NQ6 A;  3BIQ A;  2ADU A;  3Q6D A;  4A6W A;  1C22 A;  1C23 A;  4FKC A;  3S6B A;  4KM3 A;  4Z7M A;  1XGS A;  2BN7 A;  2EVC A;  2BHB A;  1PV9 A;  4IDY A;  5JHU A;  1KQ0 A;  4S00 A;  1QXY A;  2GG8 A;  2HOW A;  4RZZ A;  4FLI A;  3TB5 A;  2GU4 A;  4FO7 A;  4U6J A;  2Q94 A;  4FLL A;  3CB5 A;  4IKT A;  1WKM A;  4U76 A;  2BWY A;  3MR1 A;  1XGO A;  2NQ7 A;  2GU5 A;  3PKC A;  4U71 A;  2BHD A;  2GA2 A;  4EGE A;  4RZY A;  3MX6 A;  2EVM A;  5FCH A;  1KP0 A;  2V3Z A;  2Q96 A;  4U75 A;  1B6A A;  2GG2 A;  4U6C A;  4U73 A;  1KQ9 A;  4IKU A;  5CE6 A;  2Q8K A;  1QXZ A;  1M35 A;  1WBQ A;  4B28 A;  1C21 A;  1QXW A;  3FMQ A;  1A16 A;  1CHM A;  4PV4 A;  3IU9 A;  4IEC A;  2GG3 A;  4IKS A;  2GGB A;  3L7G A;  2BWT A;  1W2M A;  4ZWU A;  5CLS A;  3ROR A;  2GGC A;  4FO8 A;  4S01 A;  4IF7 A;  2BWS A;  4FLJ A;  1WN1 A;  4U6W A;  5D6F A;  1YW8 A;  2P98 A;  2MAT A;  3IU7 A;  4U1B A;  2GG7 A;  2V6C A;  4RGZ 1;  2BH3 A;  1R5H A;  5CDE A;  2IW2 A;  2GG0 A;  5D6E A;  4IKR A;  4U69 A;  4U6Z A;  3PKE A;  3TAV A;  1QZY A;  1XGM A;  2B3L A;  2Q95 A;  4OOK A;  1YW9 A;  1W7V A;  4IU6 A;  2B3K A;  5CDV A;  1B59 A;  4A6V A;  1YJ3 A;  1WLR A;  3D27 A;  4R60 A;  2DFI A;  1XNZ A; 
#chains in the Genus database with same CATH topology
 4QR8 A;  2B3H A;  2V3Y A;  2GU6 A;  4MAT A;  4PNC A;  2P99 A;  5FCF A;  2GZ5 A;  5JI6 A;  2G6P A;  2BHA A;  3L24 A;  1BOA A;  2BWX A;  4ZWO A;  3MAT A;  1O0X A;  1R5G A;  3BIT A;  2GG5 A;  4S2R P;  2V3X A;  4U70 A;  1C27 A;  3BIP A;  1JAW A;  1WY2 A;  4S2T P;  2OKN A;  3PKA A;  4FLK A;  2OAZ A;  1BN5 A;  2BB7 A;  2BHC A;  2EA4 A;  2Q92 A;  3PKD A;  3CB6 A;  3FM3 A;  5E5B A;  1XGN A;  2BWV A;  2Q93 A;  2BWW A;  2P9A A;  4HXX A;  1N51 A;  4ZNG A;  3FMR A;  1YW7 A;  2EVO A;  3CTZ A;  1WL6 A;  3IU8 A;  2GTX A;  3RVA A;  3PKB A;  5CIK A;  4IPA A;  5CDL A;  1YVM A;  1C24 A;  4ZWP A;  1MAT A;  2GG9 A;  3IG4 A;  1R58 A;  5CNX A;  2ZSG A;  1Y1N A;  2BWU A;  5JFR A;  4U6E A;  2EA2 A;  1WL9 A;  4JUQ A;  2GU7 A;  4FUK A;  2NQ6 A;  3BIQ A;  2ADU A;  3Q6D A;  4A6W A;  1C22 A;  1C23 A;  4FKC A;  3S6B A;  4KM3 A;  4Z7M A;  1XGS A;  2BN7 A;  2EVC A;  2BHB A;  1PV9 A;  4IDY A;  5JHU A;  1KQ0 A;  4S00 A;  1QXY A;  2GG8 A;  2HOW A;  4RZZ A;  4FLI A;  3TB5 A;  2GU4 A;  4FO7 A;  4U6J A;  2Q94 A;  4FLL A;  3CB5 A;  4IKT A;  1WKM A;  4U76 A;  2BWY A;  3MR1 A;  1XGO A;  2NQ7 A;  2GU5 A;  3PKC A;  4U71 A;  2BHD A;  2GA2 A;  4EGE A;  4RZY A;  3MX6 A;  2EVM A;  5FCH A;  1KP0 A;  2V3Z A;  2Q96 A;  4U75 A;  1B6A A;  2GG2 A;  4U6C A;  4U73 A;  1KQ9 A;  4IKU A;  5CE6 A;  2Q8K A;  1QXZ A;  1M35 A;  1WBQ A;  4B28 A;  1C21 A;  1QXW A;  3FMQ A;  1A16 A;  1CHM A;  4PV4 A;  3IU9 A;  4IEC A;  2GG3 A;  4IKS A;  2GGB A;  3L7G A;  2BWT A;  1W2M A;  4ZWU A;  5CLS A;  3ROR A;  2GGC A;  4FO8 A;  4S01 A;  4IF7 A;  2BWS A;  4FLJ A;  1WN1 A;  4U6W A;  5D6F A;  1YW8 A;  2P98 A;  2MAT A;  3IU7 A;  4U1B A;  2GG7 A;  2V6C A;  4RGZ 1;  2BH3 A;  1R5H A;  5CDE A;  2IW2 A;  2GG0 A;  5D6E A;  4IKR A;  4U69 A;  4U6Z A;  3PKE A;  3TAV A;  1QZY A;  1XGM A;  2B3L A;  2Q95 A;  4OOK A;  1YW9 A;  1W7V A;  4IU6 A;  2B3K A;  5CDV A;  1B59 A;  4A6V A;  1YJ3 A;  1WLR A;  3D27 A;  4R60 A;  2DFI A;  1XNZ A; 
#chains in the Genus database with same CATH homology
 4QR8 A;  2B3H A;  2V3Y A;  2GU6 A;  4MAT A;  4PNC A;  2P99 A;  5FCF A;  2GZ5 A;  5JI6 A;  2G6P A;  2BHA A;  3L24 A;  1BOA A;  2BWX A;  4ZWO A;  3MAT A;  1O0X A;  1R5G A;  3BIT A;  2GG5 A;  4S2R P;  2V3X A;  4U70 A;  1C27 A;  3BIP A;  1JAW A;  1WY2 A;  4S2T P;  2OKN A;  3PKA A;  4FLK A;  2OAZ A;  1BN5 A;  2BB7 A;  2BHC A;  2EA4 A;  2Q92 A;  3PKD A;  3CB6 A;  3FM3 A;  5E5B A;  1XGN A;  2BWV A;  2Q93 A;  2BWW A;  2P9A A;  4HXX A;  1N51 A;  4ZNG A;  3FMR A;  1YW7 A;  2EVO A;  3CTZ A;  1WL6 A;  3IU8 A;  2GTX A;  3RVA A;  3PKB A;  5CIK A;  4IPA A;  5CDL A;  1YVM A;  1C24 A;  4ZWP A;  1MAT A;  2GG9 A;  3IG4 A;  1R58 A;  5CNX A;  2ZSG A;  1Y1N A;  2BWU A;  5JFR A;  4U6E A;  2EA2 A;  1WL9 A;  4JUQ A;  2GU7 A;  4FUK A;  2NQ6 A;  3BIQ A;  2ADU A;  3Q6D A;  4A6W A;  1C22 A;  1C23 A;  4FKC A;  3S6B A;  4KM3 A;  4Z7M A;  1XGS A;  2BN7 A;  2EVC A;  2BHB A;  1PV9 A;  4IDY A;  5JHU A;  1KQ0 A;  4S00 A;  1QXY A;  2GG8 A;  2HOW A;  4RZZ A;  4FLI A;  3TB5 A;  2GU4 A;  4FO7 A;  4U6J A;  2Q94 A;  4FLL A;  3CB5 A;  4IKT A;  1WKM A;  4U76 A;  2BWY A;  3MR1 A;  1XGO A;  2NQ7 A;  2GU5 A;  3PKC A;  4U71 A;  2BHD A;  2GA2 A;  4EGE A;  4RZY A;  3MX6 A;  2EVM A;  5FCH A;  1KP0 A;  2V3Z A;  2Q96 A;  4U75 A;  1B6A A;  2GG2 A;  4U6C A;  4U73 A;  1KQ9 A;  4IKU A;  5CE6 A;  2Q8K A;  1QXZ A;  1M35 A;  1WBQ A;  4B28 A;  1C21 A;  1QXW A;  3FMQ A;  1A16 A;  1CHM A;  4PV4 A;  3IU9 A;  4IEC A;  2GG3 A;  4IKS A;  2GGB A;  3L7G A;  2BWT A;  1W2M A;  4ZWU A;  5CLS A;  3ROR A;  2GGC A;  4FO8 A;  4S01 A;  4IF7 A;  2BWS A;  4FLJ A;  1WN1 A;  4U6W A;  5D6F A;  1YW8 A;  2P98 A;  2MAT A;  3IU7 A;  4U1B A;  2GG7 A;  2V6C A;  4RGZ 1;  2BH3 A;  1R5H A;  5CDE A;  2IW2 A;  2GG0 A;  5D6E A;  4IKR A;  4U69 A;  4U6Z A;  3PKE A;  3TAV A;  1QZY A;  1XGM A;  2B3L A;  2Q95 A;  4OOK A;  1YW9 A;  1W7V A;  4IU6 A;  2B3K A;  5CDV A;  1B59 A;  4A6V A;  1YJ3 A;  1WLR A;  3D27 A;  4R60 A;  2DFI A;  1XNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...